![]() |
EBI DbfetchID CAL35701; SV 1; linear; genomic DNA; STD; PRO; 624 BP. XX PA AL111168.1 XX DE Campylobacter jejuni subsp. jejuni NCTC 11168 phosphoribosyl-AMP DE cyclohydrolase/ phosphoribosyl-ATP pyrophosphohydrolase XX OS Campylobacter jejuni subsp. jejuni NCTC 11168 OC Bacteria; Proteobacteria; Epsilonproteobacteria; Campylobacterales; OC Campylobacteraceae; Campylobacter. OX NCBI_TaxID=192222; XX FH Key Location/Qualifiers FH FT source 1..624 FT /organism="Campylobacter jejuni subsp. jejuni NCTC 11168" FT /sub_species="jejuni" FT /strain="NCTC 11168" FT /mol_type="genomic DNA" FT CDS AL111168.1:1531711..1532334 FT /transl_table=11 FT /gene="hisI" FT /locus_tag="Cj1604" FT /product="phosphoribosyl-AMP cyclohydrolase/ FT phosphoribosyl-ATP pyrophosphohydrolase" FT /EC_number="3.5.4.19" FT /EC_number="3.6.1.31" FT /note="Original (2000) note: Cj1604, hisI, probable FT phosphoribosyl-AMP cyclohydrolase/ phosphoribosyl-ATP FT pyrophosphohydrolase, len: 207 aa; highly similar to many FT e.g. HIS2_ECOLI histidine biosynthesis bifunctional protein FT HisIE [includes: phosphoribosyl-AMP cyclohydrolase (EC FT 3.5.4.19); phosphoribosyl-ATP pyrophosphohydrolase (EC FT 3.6.1.31)] (203 aa), fasta scores; opt: 840 z-score: 1036.5 FT E(): 0, 63.4% identity in 205 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domains PF01502 FT Phosphoribosyl-AMP cyclohydrolase and PF01503 FT Phosphoribosyl-ATP pyrophosphohydrolase were identified FT within CDS. Further support given to product function. FT Characterised within Escherichia coli with acceptable FT identity score. Putative not added to product function. FT Functional classification - Amino acid biosynthesis FT -Histidine" FT /db_xref="GOA:Q9PM71" FT /db_xref="InterPro:IPR008179" FT /db_xref="UniProtKB/Swiss-Prot:Q9PM71" FT /inference="protein motif:Pfam:PF01503" FT /inference="protein motif:Pfam:PF01502" FT /func_characterised="identical sequence" FT /protein_id="CAL35701.1" FT /translation="MQNFKELNEKIAWQKVDNLLPVIIQDAKTCEVLMLGFMNNEALEK FT SLESGKVVFFSRTKQRLWMKGEESGNFLNIIDLSLDCDNDTLLILANPVGPTCHTGDIS FT CFEKISKNADFVFLARLEKLINARKNADENTSYTAKLFKSGTKRIAQKVGEEGVETALA FT ATVKDKEELICEAADLMYHLSVLLADANLSFSDVISKLKERHKA" XX SQ Sequence 624 BP; 232 A; 89 C; 116 G; 187 T; 0 other; 3534985171 CRC32; atgcaaaatt tcaaagaact taatgaaaaa atcgcttggc aaaaagtgga taatctttta 60 cctgtcatca tccaagatgc aaaaacttgc gaagttttaa tgctaggctt tatgaataat 120 gaagccttag aaaaaagctt agaaagtggc aaagtagtct ttttttcacg cacaaaacag 180 cgtctttgga tgaagggtga agaaagtgga aatttcttaa atatcataga tttaagctta 240 gattgtgata atgacacgct tttaatttta gcaaatcctg tagggcctac ttgtcatacg 300 ggcgatattt cttgttttga aaaaatttct aaaaatgcag attttgtttt tctagccaga 360 cttgaaaaac ttattaatgc acgcaaaaat gccgatgaaa atacttctta tacagcaaaa 420 cttttcaaaa gtggtacaaa acgcatcgca caaaaagttg gtgaagaagg cgtagaaaca 480 gctttagcag cgacagtaaa agataaagaa gagcttattt gtgaagcagc ggatttaatg 540 tatcatttaa gtgttttact tgcagatgca aatcttagtt tctcagatgt gatttcaaaa 600 ttaaaagaaa gacataaagc ttaa 624 // ![]() |