spacer
spacer
EBIDatabasesDatabase BrowsingDbfetch

EBI Dbfetch

ID   CAL35313; SV 1; linear; genomic DNA; STD; PRO; 495 BP.
XX
PA   AL111168.1
XX
DE   Campylobacter jejuni subsp. jejuni NCTC 11168 S-ribosylhomocysteine lyase
DE   (autoinducer-2 production protein LuxS)
XX
OS   Campylobacter jejuni subsp. jejuni NCTC 11168
OC   Bacteria; Proteobacteria; Epsilonproteobacteria; Campylobacterales;
OC   Campylobacteraceae; Campylobacter.
OX   NCBI_TaxID=192222;
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..495
FT                   /organism="Campylobacter jejuni subsp. jejuni NCTC 11168"
FT                   /sub_species="jejuni"
FT                   /strain="NCTC 11168"
FT                   /mol_type="genomic DNA"
FT   CDS             AL111168.1:1127437..1127931
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="Cj1198"
FT                   /product="S-ribosylhomocysteine lyase (autoinducer-2
FT                   production protein LuxS)"
FT                   /EC_number="4.4.1.21"
FT                   /note="Original (2000) note: Cj1198, unknown, len: 164 aa;
FT                   highly similar to hypothetical proteins e.g. YGAG_ECOLI
FT                   (170 aa), fasta scores; opt: 808 z-score: 1003.1 E():
FT                   0,71.3% identity in 160 aa overlap. 40.0% identity to
FT                   HP0105"
FT                   /note="Updated (2006) note: Pfam domain PF02664
FT                   S-Ribosylhomocysteinase (LuxS) identified within CDS. In
FT                   bacteria, the regulation of gene expression in response to
FT                   changes in cell density is called quorum sensing.
FT                   Quorum-sensing bacteria produce, release, and respond to
FT                   hormone-like molecules (autoinducers) that accumulate in
FT                   the external environment as the cell population grows. The
FT                   LuxS protein is involved in quorum sensing and is a
FT                   autoinducer-production protein. Product function modified
FT                   to new family member based on this information.
FT                   Characterised in Campylobacter spp. and other related
FT                   bacteria, so putative not added to product function.
FT                   Functional classification - Pathogenicity"
FT                   /note="PMID:11988522, PMID:9990077, PMID:12200329"
FT                   /db_xref="GOA:Q9PN97"
FT                   /db_xref="HSSP:1JOE"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9PN97"
FT                   /inference="protein motif:Pfam:PF02664"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="CAL35313.1"
FT                   /translation="MPLLDSFKVDHTKMPAPAVRLAKVMKTPKGDDISVFDLRFCIPNK
FT                   DIMSEKGTHTLEHLFAGFMRDHLNSNSVEIIDISPMGCRTGFYMSLIGTPDEKSIAKAW
FT                   EAAMKDVLSVSDQSKIPELNIYQCGTCAMHSLDEAKQIAQKVLNLGISIINNKELKLEN
FT                   A"
XX
SQ   Sequence 495 BP; 177 A; 78 C; 91 G; 149 T; 0 other; 1293753312 CRC32;
     atgccattat tagacagctt taaagttgac catactaaaa tgccagctcc tgctgtgcgt        60
     ttagctaaag ttatgaaaac acctaagggt gatgatatta gcgtatttga tttgcgtttt       120
     tgcataccaa ataaagacat tatgagcgaa aaaggtactc ataccttaga acatttattc       180
     gcaggattta tgagagatca tcttaattca aattcagttg aaattattga tatttcacct       240
     atgggttgtc gcacgggttt ttatatgagt ttaattggaa cacctgatga gaaaagtatt       300
     gcaaaagctt gggaagcagc catgaaagat gttttaagcg taagcgatca aagcaaaatt       360
     cctgaactta atatctacca atgcggaact tgcgcaatgc attctttaga tgaagccaaa       420
     caaattgccc aaaaagtttt aaatctaggt attagcataa taaataacaa agaattaaaa       480
     ctcgagaatg cttaa                                                        495
//
spacer
spacer