![]() |
EBI DbfetchID CAL34783; SV 1; linear; genomic DNA; STD; PRO; 519 BP. XX PA AL111168.1 XX DE Campylobacter jejuni subsp. jejuni NCTC 11168 inorganic pyrophosphatase XX OS Campylobacter jejuni subsp. jejuni NCTC 11168 OC Bacteria; Proteobacteria; Epsilonproteobacteria; Campylobacterales; OC Campylobacteraceae; Campylobacter. OX NCBI_TaxID=192222; XX FH Key Location/Qualifiers FH FT source 1..519 FT /organism="Campylobacter jejuni subsp. jejuni NCTC 11168" FT /sub_species="jejuni" FT /strain="NCTC 11168" FT /mol_type="genomic DNA" FT CDS complement(AL111168.1:599381..599899) FT /transl_table=11 FT /gene="ppa" FT /locus_tag="Cj0638c" FT /product="inorganic pyrophosphatase" FT /EC_number="3.6.1.1" FT /note="Original (2000) note: Cj0638c, ppa, probable FT inorganic pyrophosphatase, len: 172 aa; highly similar to FT many e.g. IPYR_ECOLI inorganic pyrophosphatase (EC 3.6.1.1) FT (175 aa), fasta scores; opt: 564 z-score: 990.9 E(): 0, FT 54.0% identity in 161 aa overlap. 59.3% identity to HP0620. FT Contains PS00387 Inorganic pyrophosphatase signature and FT Pfam match to entry PF00719 Pyrophosphatase,Inorganic FT pyrophosphatase" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Literature search identified FT paper linking protein to glycoprotein (PMID:12186869). FT Functional classification - Central intermediary metabolism FT - General" FT /note="PMID:12186869, PMID:2848015, PMID:9201917" FT /db_xref="GOA:Q9PHM9" FT /db_xref="HSSP:1FAJ" FT /db_xref="InterPro:IPR008162" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHM9" FT /inference="protein motif:Pfam:PF00719" FT /inference="protein motif:Prosite:PS00387" FT /func_characterised="identical sequence" FT /protein_id="CAL34783.1" FT /translation="MNLSKIKIGDIPNKINAVIEIPYGSNIKYEIDKDSGAIMVDRVMA FT SAIFYPANYGFIANTLADDGDPVDILVLNEYPIQAGAVIPCRLIGVLIMEDESGMDEKL FT LAVPNSKIDARYDNIKTYTDLPQATLNKIKNFFETYKILEPNKWVKVQDFKDEKAAIEI FT LEKAIKNYK" XX SQ Sequence 519 BP; 204 A; 79 C; 88 G; 148 T; 0 other; 3123484782 CRC32; atgaatttaa gcaaaatcaa aatcggagat attccaaata aaatcaatgc cgtaatcgaa 60 attccatacg gctcaaatat caaatacgaa atcgataaag atagtggtgc tatcatggta 120 gatcgcgtta tggctagtgc gatattttac ccagcaaact atggttttat tgccaatact 180 ttggctgatg atggtgatcc tgtagatatt ttagtgctta atgaatatcc tatccaagct 240 ggagccgtga ttccttgccg cttaatcggt gttttaatca tggaagatga aagcggaatg 300 gatgaaaaac ttcttgcggt tccaaattca aaaatagatg caagatatga caatataaaa 360 acttacacag atttaccaca agcaacttta aataaaatca aaaatttctt tgaaacttat 420 aaaattttag aaccaaataa atgggttaaa gtgcaagatt tcaaagatga aaaagctgca 480 attgaaattt tagaaaaagc aatcaaaaac tacaaataa 519 // ![]() |