![]() |
EBI DbfetchID CAL34782; SV 1; linear; genomic DNA; STD; PRO; 498 BP. XX PA AL111168.1 XX DE Campylobacter jejuni subsp. jejuni NCTC 11168 putative peptide methionine DE sulfoxide reductase XX OS Campylobacter jejuni subsp. jejuni NCTC 11168 OC Bacteria; Proteobacteria; Epsilonproteobacteria; Campylobacterales; OC Campylobacteraceae; Campylobacter. OX NCBI_TaxID=192222; XX FH Key Location/Qualifiers FH FT source 1..498 FT /organism="Campylobacter jejuni subsp. jejuni NCTC 11168" FT /sub_species="jejuni" FT /strain="NCTC 11168" FT /mol_type="genomic DNA" FT CDS complement(AL111168.1:598843..599340) FT /transl_table=11 FT /gene="mrsA" FT /locus_tag="Cj0637c" FT /product="putative peptide methionine sulfoxide reductase" FT /EC_number="1.8.4.6" FT /note="Original (2000) note: Cj0637c, mrsA, probable FT peptide methionine sulfoxide reductase, len: 165 aa; highly FT similar to many e.g. PMSR_STRPN peptide methionine FT sulfoxide reductase (312 aa), fasta scores; opt: 413 FT z-score: 690.6 E(): 3.6e-31, 39.5% identity in 152 aa FT overlap. 43.3% identity to HP0224. May be necessary for the FT production and maintenance of functional adhesins on the FT cell surface. See Proc. Natl. Acad. Sci. U.S.A. FT 93:7985-7990(1996)" FT /note="Updated (2006) note: Pfam domain PF01625 Peptide FT methionine sulfoxide reductase identified within CDS. FT Further support given to product function. Characterised FT within Escherichia coli, however, marginal identity score FT was obtained. Putative kept within product function. FT Functional classification - Pathogenicity" FT /note="PMID:1386361, PMID:10964927" FT /db_xref="GOA:Q9PHN0" FT /db_xref="HSSP:1FVG" FT /db_xref="InterPro:IPR002569" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHN0" FT /inference="protein motif:Pfam:PF01625" FT /func_characterised="identical sequence" FT /protein_id="CAL34782.1" FT /translation="MKNIVLGGGCFWCVEAVFERLKGVINTEVGYSGGKPNPSYESVCN FT GDGNIEVVKINYDEKQISLLEILTLFFKIHDPTSIDKQGGDIGIQYRSIIFYENEEDKI FT LAQNFIEEQQKIFSKKIVTKISRLQTYYKAENYHQHYFINNPDQGYCQAVIAPKLQKIQ FT SD" XX SQ Sequence 498 BP; 202 A; 70 C; 81 G; 145 T; 0 other; 4140615162 CRC32; atgaaaaata tcgttttagg tggtggttgt ttttggtgtg ttgaagccgt atttgaacgc 60 ctaaaaggtg taatcaatac tgaagttgga tatagcggag gaaaaccaaa tcctagctat 120 gaaagcgtgt gtaatggtga tggcaacata gaagttgtca aaataaatta cgatgaaaaa 180 caaatctctc ttcttgaaat cttaacactc ttttttaaaa ttcatgatcc aacaagtata 240 gataaacaag gtggagatat tggtatacaa tatcgctcaa taatctttta cgaaaatgaa 300 gaagataaaa ttttagctca aaatttcatc gaagaacagc aaaaaatatt tagcaaaaaa 360 atagttacta aaatttcaag attgcaaact tattacaaag ctgaaaacta tcatcaacat 420 tattttataa ataatcccga tcaaggatat tgtcaagctg taatagctcc aaaactgcaa 480 aaaatacaat cagactaa 498 // ![]() |