![]() |
EBI DbfetchID CAK46627; SV 1; linear; genomic DNA; STD; FUN; 1179 BP. XX PA AM270320.1 XX DE Aspergillus niger hypothetical protein XX OS Aspergillus niger OC Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes; OC Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; OC Aspergillus. OX NCBI_TaxID=5061; XX FH Key Location/Qualifiers FH FT source 1..1179 FT /organism="Aspergillus niger" FT /mol_type="genomic DNA" FT /clone="An14c0130" FT CDS join(AM270320.1:257881..257922,AM270320.1:257976..258758, FT AM270320.1:258810..259098,AM270320.1:259149..259213) FT /locus_tag="An14g03910" FT /EC_number="2.4.1.131" FT /note="Function: kre2 of C. albicans is involved in the FT synthesis of mannoproteins, the third major class of FT macromolecule found in the cell wall." FT /note="Function: kre2 of C. albicans transfers an FT alpha-D-mannosyl residue from GDP-mannose into lipid-linked FT oligosaccharide, forming an alpha-1,2-D-mannosyl-D-mannose FT linkage." FT /note="Golgi" FT /note="Phenotype: both heterozygous and homozygous kre2 FT null mutants of C. albicans showed strong attenuation of FT virulence in guinea pig and mouse models of systemic FT candidosis, which, in guinea pigs, could be attributed to a FT decreased ability to reach and/or adhere internal organs." FT /note="Phenotype: the absence of kre2 in C. albicans FT reduced the ability of C. albicans cells to adhere to each FT other, to human buccal epithelial cells, and to rat vaginal FT epithelial cells." FT /note="Remark: kre2 of C. albicans is also called mnt1." FT /note="Title: strong similarity to FT alpha-1,2-mannosyltransferase kre2 - Candida albicans" FT /db_xref="GOA:A2R3D5" FT /db_xref="InterPro:IPR002685" FT /db_xref="UniProtKB/TrEMBL:A2R3D5" FT /inference="profile:COGS:COG5020" FT /inference="profile:PFAM:PF01793" FT /inference="similar to AA sequence:SWISSPROT:KRE2.CANAL" FT /protein_id="CAK46627.1" FT /translation="MAIGPLRYLLFAITGLAIFFFISRSAIPIPENIGTKLTPATYKDT FT FSSSHSSQNDALSSSGPIKDIPTDRVNATFVTLARNTDLWEMVKSIRTVEDRFNHNYHY FT DWVFLNDKPFDEEFKKVTSALISGNTHYGVIPKEHWSYPEWIDQDKAKKVRQEMGEKKI FT IYGDSESYRHMCRYESGFFFRHPLMLNYEYYWRVEPSIELFCDVSFDPFRYVKENDKKY FT SFVLSLYEYYDTIPSLWGTVQKFMEEHPEHIADGNSMGFLSDDGGKTYNKCHFWSNFEI FT GSLEWLRSKEYIDYFETLDHAGGFFYERWGDAPVHSIAAGLLLKKEQIHFFNEIGYYHV FT PFTHCPTGEQLRLDLKCHCNPKDNFDWKGYSCTSRFFQVNDMDKPKGYENES" XX SQ Sequence 1179 BP; 294 A; 314 C; 301 G; 270 T; 0 other; 2573466154 CRC32; atggctatag ggccattgcg atatcttttg tttgccatca cggggttggc catcttcttc 60 tttatctcta ggagcgctat cccaatcccc gagaatatcg gcacaaaatt aacccccgcg 120 acctacaaag acaccttttc ctcctctcac tcctcgcaaa atgatgcgct gtcatcaagt 180 ggaccgatca aagacatccc gacggaccgc gtgaacgcca cctttgtgac cctggcgcgc 240 aacactgatc tttgggagat ggtcaagtcc atccggacgg tggaggaccg ctttaaccac 300 aactatcact acgactgggt atttttgaac gacaagccgt ttgacgagga gttcaagaag 360 gtcacgtcag ccttgatctc cggcaataca cactatggcg tgatcccgaa ggagcattgg 420 tcttatcccg agtggatcga ccaggataag gccaagaagg tccgacagga aatgggagag 480 aagaagatca tctacggcga ctcggaaagc taccgtcaca tgtgccgtta tgagtccggg 540 ttcttcttcc ggcacccgtt gatgctgaac tatgagtact actggcgtgt ggagcccagc 600 attgagctct tctgtgatgt cagctttgac ccgttccgct acgtgaaaga gaacgacaag 660 aagtacagct tcgtgctgag cctatacgag tactacgaca ccatcccgag cctgtggggt 720 acggtgcaaa agttcatgga agaacacccg gagcatatcg cggacggtaa ctccatggga 780 ttcttgagtg atgatggcgg caagacctac aacaagtgtc acttctggtc caactttgag 840 attggaagtc tggaatggct gcggtccaag gaatacattg actacttcga gacgctcgac 900 cacgctggtg gcttcttcta tgaacgttgg ggcgatgcac cagtccactc tatcgctgcg 960 ggacttctct tgaagaagga gcagatccat ttcttcaacg agattggcta ctaccacgtc 1020 ccctttaccc actgcccgac tggtgagcag cttaggctgg acctgaagtg ccactgcaac 1080 cctaaagaca actttgactg gaagggatac tcttgcacgt cccggttctt ccaagtcaac 1140 gacatggaca agcccaaggg ctacgagaat gagagctga 1179 // ![]() |