![]() |
EBI DbfetchID CAK37862; SV 1; linear; genomic DNA; STD; FUN; 1197 BP. XX PA AM270025.1 XX DE Aspergillus niger hypothetical protein XX OS Aspergillus niger OC Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes; OC Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; OC Aspergillus. OX NCBI_TaxID=5061; XX FH Key Location/Qualifiers FH FT source 1..1197 FT /organism="Aspergillus niger" FT /mol_type="genomic DNA" FT /clone="An02c0300" FT CDS complement(join(AM270025.1:91549..91705, FT AM270025.1:91767..92385,AM270025.1:92442..92705, FT AM270025.1:92788..92944)) FT /locus_tag="An02g09940" FT /EC_number="2.4.1.131" FT /note="Catalytic activity: transfers an alpha-D-mannosyl FT residue from GDPmannose into lipid--linked FT oligosaccharide,forming an alpha-1,2-D-mannosyl-D-mannose FT linkage." FT /note="Pathway: glycoprotein biosynthesis." FT /note="Remark: KTR1 S. cerevisiae utilizes FT mannose,methyl-alpha-mannoside, alpha-1,2-mannobiose and FT methyl-alpha-1,2-mannobiose, as well as FT Man15-30GlcNAc,derived from mnn2 mutant glycoproteins, as FT substrates. It did not utilize alpha-1,6-mannobiose, FT alpha-1,6-mannotriose , alpha-1,6-mannotetraose, mammalian FT Man9GlcNAc or yeast Man9-10GlcNAc." FT /note="Remark: glycosylation constitutes one of the most FT important of all the post-translational modifications and FT may have numerous effects on the function, FT structure,physical properties and targeting of particular FT proteins. Eukaryotic glycan structures are progressively FT elaborated in the secretory pathway. Following the addition FT of a core N-linked carbohydrate in the endoplasmic FT reticulum,glycoproteins move to the Golgi complex where the FT elongation of O-linked sugar chains and processing of FT complex N-linked oligosaccharide structures take place." FT /note="Similarity: belongs to the" FT /note="Title: strong similarity to FT alpha-1,2-mannosyltransferase Ktr1 - Saccharomyces FT cerevisiae" FT /db_xref="GOA:A2QEA1" FT /db_xref="InterPro:IPR002685" FT /db_xref="UniProtKB/TrEMBL:A2QEA1" FT /inference="profile:COGS:COG5020" FT /inference="profile:PFAM:PF01793" FT /inference="similar to AA sequence:PIR:S61659" FT /protein_id="CAK37862.1" FT /translation="MAVARPIRMLGASCIILILFLIFQMNKTPISISKGPYATQPYEGI FT TSDPLKEPTGEPTGHLWRATDGDYSPDSTDSPRANAALISLVRNEELNELIPSMRDLER FT TWNSKFNYPWIFFNDVPFTEEFKKRTQAETKAKCYYELVPKEHWDVPEWINWDLFKESA FT QILKEKNIQYSDKVSYHQMCRWNSGLFYKHPALAKYRYYWRVEPKVKFFCDVDYDIFRY FT MADYNITYGFTINLFDAPESIPSLWPETKKFLAANPSYVSDNNMMNWLTDDQLRPEHTE FT GGNGYSTCHFWSNFEIGDMEFFRGEQYSAYFDHLDRSGGFFYERWGDAPVHSIGVGLFA FT DAAKVHWFRDIGYNHIPYYNCPNSPKCSGCTPGKMYAGESWLAKEDCRPSYFHHVGTH" XX SQ Sequence 1197 BP; 286 A; 345 C; 290 G; 276 T; 0 other; 3528274665 CRC32; atggctgtcg caaggcccat tcgcatgctc ggtgcctcgt gcatcatcct catcctcttc 60 ctgatcttcc agatgaacaa aacgcccatc tccattagta aggggccata cgcaacacag 120 ccgtatgagg gcataacttc agaccctctc aaagagccaa ctggagaacc gacaggccac 180 ttatggcgtg cgacagatgg cgattattct cccgacagca ccgactcccc tcgggccaac 240 gcggcactga tctctctcgt ccgtaacgag gagctgaacg agctgattcc atctatgcgt 300 gatctcgagc gcacctggaa cagcaagttc aactacccct ggatcttctt caacgatgtg 360 ccgttcactg aggaattcaa gaagcgcaca caggcggaaa ccaaggcgaa atgctactac 420 gagctggttc ccaaggagca ctgggatgtc cccgagtgga ttaattggga tctcttcaag 480 gagtcggcgc agatcctgaa ggagaagaat atccaatata gtgacaaggt ctcctaccac 540 cagatgtgcc gctggaatag tggcctgttc tacaagcacc ccgctctcgc caaataccgt 600 tactactggc gagtcgagcc caaggtcaag ttcttctgtg acgtggacta cgacattttc 660 cgttacatgg ccgactacaa tatcacatac ggtttcacca tcaatctttt cgacgctccg 720 gagagtatcc catctctttg gcccgagacc aagaagttcc ttgccgcaaa tccctcctat 780 gtttcggaca acaatatgat gaactggctc accgatgacc aacttcgccc ggagcacacc 840 gagggaggaa atggttattc tacctgccat ttctggtcca acttcgaaat cggagatatg 900 gagttcttca ggggcgagca gtattctgct tacttcgacc atctggatcg gtctggtggt 960 ttcttctacg agagatgggg cgatgctcct gtacactcga ttggtgttgg tctcttcgcg 1020 gacgcagcca aggttcattg gttccgcgat atcggttaca accacatccc ctactacaac 1080 tgccccaact cgccgaagtg ctccggctgc acgcccggca agatgtatgc tggtgaatca 1140 tggctggcta aggaggattg ccggccaagc tacttccacc atgtcggtac gcactaa 1197 // ![]() |