![]() |
EBI DbfetchID CAH64328; SV 1; linear; genomic DNA; STD; PRO; 618 BP. XX PA CR848038.1 XX DE Chlamydophila abortus S26/3 ATP-dependent Clp protease proteolytic subunit XX OS Chlamydophila abortus S26/3 OC Bacteria; Chlamydiae; Chlamydiales; Chlamydiaceae; Chlamydophila. OX NCBI_TaxID=218497; XX FH Key Location/Qualifiers FH FT source 1..618 FT /organism="Chlamydophila abortus S26/3" FT /strain="S26/3" FT /mol_type="genomic DNA" FT CDS CR848038.1:1037333..1037950 FT /transl_table=11 FT /gene="clpP" FT /gene_synonym="lopP" FT /locus_tag="CAB888" FT /product="ATP-dependent Clp protease proteolytic subunit" FT /EC_number="3.4.21.92" FT /note="Similar to Escherichia coli, Escherichia coli O6, FT Escherichia coli O157:H7, and Shigella flexneri FT ATP-dependent Clp protease proteolytic subunit ClpP or LopP FT or B0437 or C0553 or Z0542 or ECS0491 or SF0382 or S0388 FT SWALL:CLPP_ECOLI (SWALL:P19245) (207 aa) fasta scores: E(): FT 5.6e-40, 53.12% id in 192 aa, and to Chlamydia muridarum FT ATP-dependent Clp protease proteolytic subunit 2 ClpP2 or FT TC0079 SWALL:CLP2_CHLMU (SWALL:Q9PLM0) (203 aa) fasta FT scores: E(): 2.8e-73, 94.58% id in 203 aa" FT /db_xref="GOA:Q5L4W7" FT /db_xref="InterPro:IPR018215" FT /db_xref="UniProtKB/Swiss-Prot:Q5L4W7" FT /func_characterised="identical sequence" FT /protein_id="CAH64328.1" FT /translation="MQMTLVPYVVEDTGRGERAMDIYSRLLKDRIVMIGQEITEPLANT FT VIAQLLFLMSEDPKKDIKVFINSPGGYITAGLAIYDTIRFLGCDVNTYCIGQAASMGAL FT LLSAGTKGKRYALPHSRMMIHQPSGGIIGTSADIQLQAAEILTLKKHLANILSECTGQP FT VEKIIEDSERDFFMGAEDAISYGLIDKVVSSAKDTKDKDTIS" XX SQ Sequence 618 BP; 188 A; 125 C; 129 G; 176 T; 0 other; 1134268737 CRC32; atgcaaatga cattggtgcc ttatgtggtc gaggatacag gtcgtggcga gcgtgccatg 60 gatatttact cgcgtctttt aaaagatcgc attgtaatga ttggccaaga aattaccgag 120 cccctcgcta ataccgtcat agcacaacta cttttcctca tgtccgaaga tcctaaaaag 180 gacattaaag ttttcattaa ctccccagga gggtatatca cagctggatt ggctatctat 240 gatactattc gtttcttagg ttgtgatgta aatacttatt gcataggtca agcggcttct 300 atgggagctt tactactttc tgcagggact aaaggtaagc gttatgctct acctcacagt 360 cggatgatga tccatcagcc ttcaggagga attataggaa cttctgctga tattcagtta 420 caagctgcag aaatcttaac attaaaaaaa caccttgcaa acattctttc cgagtgcaca 480 ggacaacctg tagaaaaaat catagaagat tctgaaagag atttctttat gggagctgaa 540 gacgcaatct cctatggttt aattgataaa gtggtctctt cagcaaaaga cacgaaagat 600 aaggacacca tctcctag 618 // ![]() |