![]() |
EBI DbfetchID CAH39648; SV 1; linear; genomic DNA; STD; PRO; 297 BP. XX PA BX571966.1 XX DE Burkholderia pseudomallei K96243 putative acylphosphatase protein XX OS Burkholderia pseudomallei K96243 OC Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; OC Burkholderiaceae; Burkholderia; pseudomallei group. OX NCBI_TaxID=272560; XX FH Key Location/Qualifiers FH FT source 1..297 FT /organism="Burkholderia pseudomallei K96243" FT /chromosome="2" FT /strain="K96243" FT /mol_type="genomic DNA" FT CDS complement(BX571966.1:2927298..2927594) FT /transl_table=11 FT /locus_tag="BPSS2164" FT /product="putative acylphosphatase protein" FT /note="Similar to Pyrococcus furiosus putative FT acylphosphatase pf0283 SWALL:Q8U414 (EMBL:AE010152) (91 aa) FT fasta scores: E(): 3.1e-11, 49.38% id in 81 aa, and to FT Ralstonia solanacearum putative acylphosphatase protein FT rsc0219 or rs00651 SWALL:Q8Y2W3 (EMBL:AL646058) (119 aa) FT fasta scores: E(): 3.4e-11, 52.87% id in 87 aa, and to FT Pyrococcus abyssi acylphosphatase pab7421 SWALL:Q9UY47 FT (EMBL:AJ248288) (91 aa) fasta scores: E(): 9.4e-11, 48.14% FT id in 81 aa" FT /db_xref="GOA:Q63IA7" FT /db_xref="InterPro:IPR017968" FT /db_xref="UniProtKB/Swiss-Prot:Q63IA7" FT /func_characterised="identical sequence" FT /protein_id="CAH39648.1" FT /translation="MSGDDLDERIETYYVRVRGVVQGVGFRHATVREAHALKLRGWVAN FT LDDGSVEAMLQGSAPQIDRMLAWLRHGPPAAHVTEVTFEEHRTDKRFERFQQH" XX SQ Sequence 297 BP; 49 A; 93 C; 115 G; 40 T; 0 other; 3709500479 CRC32; atgagcggcg acgatctgga cgagcggatc gaaacctatt acgtgcgggt gcgcggcgtg 60 gtgcagggcg tgggcttccg gcacgcgacc gtgcgcgagg cgcacgcgct gaagctgcgc 120 ggctgggtgg cgaacctcga cgacggctcg gtcgaggcga tgctgcaagg ctccgcgccg 180 cagatcgaca ggatgctcgc gtggctgcgg cacggcccgc ccgccgcgca cgtgaccgag 240 gtgacgttcg aggagcaccg gaccgacaag cgcttcgagc gcttccagca gcattga 297 // ![]() |