![]() |
EBI DbfetchID CAH06667; SV 1; linear; genomic DNA; STD; PRO; 354 BP. XX PA CR626927.1 XX DE Bacteroides fragilis NCTC 9343 putative aspartate 1-decarboxylase precursor XX OS Bacteroides fragilis NCTC 9343 OC Bacteria; Bacteroidetes; Bacteroidia; Bacteroidales; Bacteroidaceae; OC Bacteroides. OX NCBI_TaxID=272559; XX FH Key Location/Qualifiers FH FT source 1..354 FT /organism="Bacteroides fragilis NCTC 9343" FT /strain="ATCC 25285 = NCTC 9343" FT /mol_type="genomic DNA" FT CDS CR626927.1:1157401..1157754 FT /transl_table=11 FT /gene="panD" FT /locus_tag="BF0925" FT /product="putative aspartate 1-decarboxylase precursor" FT /EC_number="4.1.1.11" FT /note="Similar to Escherichia coli, Escherichia coli O6, FT Escherichia coli O157:H7, and Shigella flexneri aspartate FT 1-decarboxylase precursor PanD or B0131 or C0160 or Z0142 FT or ECS0135 or SF0128 or s0130 SWALL:PAND_ECOLI FT (SWALL:P31664) (126 aa) fasta scores: E(): 5.4e-13, 44.86% FT id in 107 aa, and to Bacteroides thetaiotaomicron aspartate FT 1-decarboxylase precursor pand or BT4309 SWALL:AAO79414 FT (EMBL:AE016944) (117 aa) fasta scores: E(): 5.8e-43, 98.29% FT id in 117 aa, and to Wolinella succinogenes aspartate FT 1-decarboxylase precursor PanD SWALL:PAND_WOLSU FT (SWALL:O34246) (121 aa) fasta scores: E(): 4.3e-22, 58.97% FT id in 117 aa" FT /db_xref="GOA:Q5LGS0" FT /db_xref="InterPro:IPR003190" FT /db_xref="UniProtKB/Swiss-Prot:Q5LGS0" FT /func_characterised="identical sequence" FT /protein_id="CAH06667.1" FT /translation="MMIEVLKSKIHCARVTEANLNYMGSITIDENLLDAANMIAGEKVY FT IADNNNGERFETYIIKGERGSGKICLNGAAARKVQPDDIVIIMSYALMDFEEAKSFKPT FT VIFPDPATNSVVK" XX SQ Sequence 354 BP; 103 A; 55 C; 93 G; 103 T; 0 other; 2527055298 CRC32; atgatgattg aagtgttgaa gtcaaaaatt cattgtgccc gtgtcacgga agccaatctg 60 aattatatgg gtagtattac gattgatgag aatctattgg atgcagctaa tatgattgcc 120 ggtgagaagg tgtacattgc cgacaataat aacggcgagc gttttgagac ctacattatc 180 aaaggtgaac gcggatcagg taaaatctgc ttgaatggcg ctgcggcccg taaagtacaa 240 ccggatgata ttgtgatcat tatgtcgtat gcgttgatgg attttgagga agctaagtcg 300 tttaagccga ctgttatttt tccggatccg gctacaaata gtgtagtgaa gtaa 354 // ![]() |