![]() |
EBI DbfetchID CAG69994; SV 1; linear; genomic DNA; STD; PRO; 951 BP. XX PA CR543861.1 XX DE Acinetobacter sp. ADP1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase DE (also involved in penicillin tolerance and control of the stringent DE response. Seems to directly or indirectly interact with relA to maintain it DE in an inactive form during normal growth.) XX OS Acinetobacter sp. ADP1 OC Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; OC Moraxellaceae; Acinetobacter. OX NCBI_TaxID=62977; XX FH Key Location/Qualifiers FH FT source 1..951 FT /organism="Acinetobacter sp. ADP1" FT /strain="ADP1" FT /mol_type="genomic DNA" FT CDS complement(CR543861.1:3227449..3228399) FT /codon_start=1 FT /transl_table=11 FT /gene="ispH" FT /locus_tag="ACIAD3322" FT /product="4-hydroxy-3-methylbut-2-enyl diphosphate FT reductase (also involved in penicillin tolerance and FT control of the stringent response. Seems to directly or FT indirectly interact with relA to maintain it in an inactive FT form during normal growth.)" FT /function="3.1.4 : regulation level unknown" FT /function="5.6.4 : drug resistance/sensitivity" FT /EC_number="1.17.1.2" FT /note="Evidence 1 : Function experimentally demonstrated in FT the studied organism; PubMedId : 10763755; Product type e : FT enzyme" FT /db_xref="GOA:Q9RBJ0" FT /db_xref="InterPro:IPR003451" FT /db_xref="UniProtKB/Swiss-Prot:Q9RBJ0" FT /experiment="publication(s) with functional evidences, FT PMID:10763755" FT /func_characterised="identical sequence" FT /protein_id="CAG69994.1" FT /translation="MEIVLANPRGFCAGVDRAIAIVNRALECFNPPIYVRHEVVHNKFV FT VDDLRQRGAIFVDELDQVPDDSIVIFSAHGVSKAVQQEAEHRGLKVFDATCPLVTKVHI FT EVTKYAREGTEAILIGHEGHPEVEGTMGQYDKSKGGHIYLVEDEADVEALAVNHPEKLA FT FVTQTTLSIDDTAKVIDALRTKFPQIQGPRKDDICYATQNRQDAVRDLASRCDVVLVVG FT SPNSSNSNRLRELAERMGKAAYLVDNADQLEQQWFDGVAKIGVTAGASAPEILIKQVIQ FT RLQDWGAEAPKELDGREENITFSLPKELRIQVTQA" XX SQ Sequence 951 BP; 268 A; 184 C; 240 G; 259 T; 0 other; 2710339055 CRC32; atggaaattg tgttggcaaa tccgcgtggt ttttgtgcag gtgttgaccg tgccatagca 60 atcgtaaatc gcgcgctcga atgctttaat ccacccatct atgtgcgtca tgaagtggta 120 cataataagt tcgtggtcga tgatctgcgt cagcgtggcg caatttttgt tgatgaactg 180 gatcaggtgc ctgacgattc gattgttatt tttagcgcac atggtgtatc taaagctgtt 240 cagcaagaag cagagcaccg tggtttaaaa gtatttgatg ccacttgtcc gctggtcacc 300 aaggtccata ttgaagtgac caaatatgca cgtgaaggta ccgaagcgat tctcattggt 360 catgaaggac atccagaagt tgaaggtacc atggggcaat atgacaaaag taaaggtggt 420 catatttatc tggtagaaga tgaggctgat gtcgaagcac ttgctgtaaa tcacccagag 480 aaattggcct ttgtcaccca aaccacttta tccattgatg atacagcaaa agttattgat 540 gccttgcgaa ccaagttccc ccaaattcag ggaccacgta aagacgatat ctgctatgcc 600 acgcaaaacc gtcaggatgc agtgcgtgat cttgcaagtc gttgtgatgt tgtgcttgtt 660 gtgggttcac caaattcatc taactccaat cgtttacgcg aattggcgga acgtatgggc 720 aaagctgcat atttggtcga taatgcagat cagcttgaac agcaatggtt tgatggtgtg 780 gctaaaattg gtgtaaccgc aggtgcatcg gcaccagaaa tcttgattaa acaagtgatt 840 cagcgtttac aggactgggg tgcagaagcg ccaaaagagc ttgatggtcg tgaagaaaat 900 atcacgttta gtttgcctaa agaattaaga attcaagtta cgcaagcgta a 951 // ![]() |