EBI Dbfetch

ID   CAE49786; SV 1; linear; genomic DNA; STD; PRO; 264 BP.
XX
PA   BX248357.1
XX
DE   Corynebacterium diphtheriae phosphoribosyl-ATP pyrophosphatase
XX
OS   Corynebacterium diphtheriae
OC   Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
OC   Corynebacterineae; Corynebacteriaceae; Corynebacterium.
OX   NCBI_TaxID=1717;
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Corynebacterium diphtheriae"
FT                   /strain="NCTC13129"
FT                   /mol_type="genomic DNA"
FT   CDS             complement(BX248357.1:224919..225182)
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="DIP1257"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /note="Similar to Corynebacterium glutamicum
FT                   phosphoribosyl-ATP pyrophosphatase HisE SWALL:HIS2_CORGL
FT                   (SWALL:Q9Z471) (87 aa) fasta scores: E(): 3e-23, 73.56% id
FT                   in 87 aa, to the C-terminal region of Bacillus subtilis
FT                   histidine biosynthesis bifunctional protein [includes:
FT                   phosphoribosyl-AMP cyclohydrolase; phosphoribosyl-ATP
FT                   pyrophosphatase] HisI or HisIE SWALL:HIS2_BACSU
FT                   (SWALL:O34912) (209 aa) fasta scores: E(): 0.023, 32.53% id
FT                   in 83 aa, and to the C-terminal region of Escherichia coli
FT                   histidine biosynthesis bifunctional protein [includes:
FT                   phosphoribosyl-AMP cyclohydrolase; phosphoribosyl-ATP
FT                   pyrophosphatase] HisI or HisIE or B2026 SWALL:HIS2_ECOLI
FT                   (SWALL:P06989) (203 aa) fasta scores: E(): 0.08, 38.88% id
FT                   in 72 aa. Note: Although in E. coli and B. subtillis HisE
FT                   is part of a bifunctional protein (together with HisI), it
FT                   seems that in C. diphtheriae they are separate proteins"
FT                   /db_xref="GOA:P60535"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60535"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="CAE49786.1"
FT                   /translation="MKNFDSLYHELAERAEKRPEGSGTVAALNSSLHTLGKKVIEEAGE
FT                   VWLAAEYQSDAELAEEISQLMYWAQVIMIKRGLTPEDIYKYL"
XX
SQ   Sequence 264 BP; 78 A; 59 C; 63 G; 64 T; 0 other; 1552679020 CRC32;
     gtgaaaaatt tcgattccct ttaccatgaa ctagccgaac gagcagaaaa gcgacctgaa        60
     ggctccggca cggttgctgc tttaaattcg agcctccaca ctttaggcaa aaaagtgatt       120
     gaagaggccg gtgaagtttg gctcgctgct gagtaccaga gcgatgcaga actcgctgaa       180
     gagatctcgc aacttatgta ctgggcgcaa gtcatcatga ttaaacgtgg ccttactccg       240
     gaagatatct ataaatatct ttaa                                              264
//