![]() |
EBI DbfetchID BAC06195; SV 1; linear; genomic DNA; STD; PRO; 1236 BP. XX PA AB078775.1 XX DE Bacillus circulans 1,3-(1,3;1,4)-beta-D-glucan 3(4)-glucanohydrolase XX OS Bacillus circulans OC Bacteria; Firmicutes; Bacillales; Bacillaceae; Bacillus. OX NCBI_TaxID=1397; XX FH Key Location/Qualifiers FH FT source 1..1236 FT /organism="Bacillus circulans" FT /mol_type="genomic DNA" FT CDS AB078775.1:89..1324 FT /codon_start=1 FT /transl_table=11 FT /gene="bglM" FT /product="1,3-(1,3;1,4)-beta-D-glucan FT 3(4)-glucanohydrolase" FT /note="Enzyme BglM (42 kDa) degrades Aspergillus oryzae FT cell walls actively. The central domain of enzyme BglM FT shows a bacterial beta-1,3-glucan-hydrolase motif belonging FT to glycosyl hydrolase family 16. The 141 C-terminal amino FT acid sequence is composed of three reiterated amino acid FT sequences and binds to pachyman, lichenan, and A. oryzae FT cell walls. This domain shows a motif of FT carbohydrate-binding module family 13. By proteolytic FT removal of the C-terminal domain in the IAM1165 culture, FT mature BglM was processed to several 27-kDa fragments FT (BglLs) that hydrolyze a soluble beta-1,3-glucan." FT /db_xref="GOA:Q8KKH3" FT /db_xref="HSSP:1AJO" FT /db_xref="InterPro:IPR013320" FT /db_xref="UniProtKB/TrEMBL:Q8KKH3" FT /protein_id="BAC06195.1" FT /translation="MMLRKGICVVILFSLLVVLLPVNKTNAAPNWNLVWSDEFNGTSLN FT RANWTPEIGTGSGGWGNNELQYYTDRAQNVQVTGGNLVITAQKESYGGMNYTSARIKTQ FT DLKSFTYGKVEARIKLPSGQGLWPAFWMLGSNISSVGWPKSGEIDIMERVNNNPYVNGT FT VHWDAGGHADFGRVSGNLDFSQFHVYSIEWDSKYIRWFVDGQQFNEFYIENGTGNTEEF FT QRPFFILLNLAVGGNWPGSPNNSTPFPSQMLVDYVRVYQDTGASNVISDGIYTIASKAS FT GKVMDVVDVSTARGAKIQQWTNYVANNQRFRVESTGDGYYKLTAVHSGKVLDVPSSSTS FT TGVQLQQWDDNGSNAQRWKIVDVGGGYYKLVSKVSGLAVDVASASTADGAVVQQWTDNG FT TDAQKWLFTKIN" XX SQ Sequence 1236 BP; 338 A; 264 C; 352 G; 282 T; 0 other; 913578036 CRC32; atgatgctaa gaaaaggaat atgtgtagtt atactgttca gtcttctggt cgttctattg 60 cctgtcaaca aaaccaatgc cgcaccgaac tggaatttgg tatggagtga cgagttcaac 120 ggaacctcgc tcaatagagc caattggaca ccggaaatcg gtaccggcag cggcggatgg 180 ggaaacaatg agctgcagta ttataccgac cgggcacaga atgtgcaggt tactggcggt 240 aaccttgtca ttacagcgca gaaggaatct tatggcggga tgaattatac ttctgcccgg 300 atcaaaaccc aagacttgaa gagctttact tacgggaaag tggaggcgcg gatcaagctg 360 ccatcgggtc aaggcttgtg gccggcgttt tggatgctcg gaagcaacat cagttcggtt 420 ggctggccga aaagcggaga aattgacatt atggaacggg taaacaataa cccttacgtg 480 aatggtaccg tacactggga tgcaggtggg catgccgatt ttggacgagt gtccggcaat 540 ttggatttct cccaattcca tgtctacagc atagaatggg actctaaata tatccgttgg 600 ttcgtggacg gccagcagtt caatgagttc tatattgaga atggaaccgg taataccgag 660 gaattccagc gcccgttctt tatattattg aatctggcgg tcggcggaaa ttggcctgga 720 agtccgaaca attccacacc gttcccatcg cagatgctgg tggattatgt acgcgtctat 780 caggacacgg gtgcatcaaa cgtgatcagt gatgggattt acacgatcgc ttccaaggcg 840 agcggcaaag tgatggatgt tgtggatgtc tccacggcaa ggggagccaa gatacagcaa 900 tggaccaact acgtcgccaa taatcaaaga ttcagagtag aaagcaccgg agacgggtac 960 tacaagctca cagccgtaca cagcggaaaa gttctcgacg tgccgagttc atccacatcc 1020 actggcgttc agctgcagca atgggatgat aatggatcga atgcgcagcg atggaagatc 1080 gttgatgtgg gcggagggta ttataaactt gtgtccaagg tgagcggact ggcagtcgat 1140 gtagccagtg cttccacagc agatggggct gttgtccagc agtggacgga caatgggacg 1200 gatgcacaaa agtggttgtt caccaaaatt aactaa 1236 // ![]() |