![]() |
EBI DbfetchID BAA19837; SV 1; linear; genomic DNA; STD; PRO; 492 BP. XX PA AB003087.1 XX DE Geobacillus stearothermophilus partial Pyrophosphatase XX OS Geobacillus stearothermophilus OC Bacteria; Firmicutes; Bacillales; Bacillaceae; Geobacillus. OX NCBI_TaxID=1422; XX FH Key Location/Qualifiers FH FT source 1..492 FT /organism="Geobacillus stearothermophilus" FT /strain="ATCC 12016" FT /mol_type="genomic DNA" FT CDS AB003087.1:<1..>492 FT /codon_start=1 FT /transl_table=11 FT /gene="pMK2PPA" FT /product="Pyrophosphatase" FT /note="Bst.PPase" FT /note="Region amplified by PCR is base 21-472 FT (corresponding to amino acid Val 7 to Ala 158" FT /note="The expression vector contains start codon ATG and FT stop codon TGA and TAA" FT /db_xref="GOA:O05724" FT /db_xref="HSSP:1FAJ" FT /db_xref="InterPro:IPR008162" FT /db_xref="UniProtKB/Swiss-Prot:O05724" FT /func_characterised="similar sequence" FT /protein_id="BAA19837.1" FT /translation="AFENKIVEAFIEIPTGSQNKYEFDKERGIFKLDRVLYSPMFYPAE FT YGYLQNTLALDGDPLDILVITTNPTFPGCVIDTRVIGYLNMVDSGEEDAKLIGVPVEDP FT RFDEVRSIEDLPQHKLKEIAHFFERYKDLQGKRTEIGTWEGPEAAAKLIDECIARYNEQ FT K" XX SQ Sequence 492 BP; 143 A; 118 C; 125 G; 106 T; 0 other; 3901047122 CRC32; gcctttgaga ataagattgt cgaagcgttt atcgaaattc caactgggag ccaaaacaaa 60 tacgaattcg acaaagaacg gggcattttc aagctcgacc gcgtcttata ttcaccgatg 120 ttttatccgg ctgaatacgg ctatttgcaa aatacgttgg cgctggatgg cgacccgctc 180 gacattttgg tcatcacgac aaacccgacg ttcccgggct gtgtcattga tacgcgtgtc 240 atcggctatt tgaacatggt cgacagcggc gaagaagatg cgaaattgat cggcgttccg 300 gtcgaagatc cgcgctttga cgaagttaga tcgattgaag atctcccgca gcacaaactg 360 aaagaaatcg cccacttctt tgaacgctac aaagacttgc aagggaaacg gacggaaatc 420 ggcacatggg aggggccgga agcagccgcc aaattgatcg acgaatgcat cgcccgctat 480 aacgaacaaa aa 492 // ![]() |