![]() |
EBI DbfetchID BAA16257; SV 2; linear; genomic DNA; STD; PRO; 327 BP. XX PA AP009048.1 XX DE Escherichia coli str. K-12 substr. W3110 predicted enzyme IIB component of DE PTS XX OS Escherichia coli str. K-12 substr. W3110 OC Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; OC Enterobacteriaceae; Escherichia. OX NCBI_TaxID=316407; XX FH Key Location/Qualifiers FH FT source 1..327 FT /organism="Escherichia coli str. K-12 substr. W3110" FT /strain="K12" FT /sub_strain="W3110" FT /mol_type="genomic DNA" FT CDS complement(AP009048.1:2513362..2513688) FT /codon_start=1 FT /transl_table=11 FT /gene="ypdH" FT /product="predicted enzyme IIB component of PTS" FT /note="ECK2383:JW5389:b2387" FT /db_xref="GOA:P69808" FT /db_xref="InterPro:IPR003353" FT /db_xref="UniProtKB/Swiss-Prot:P69808" FT /func_characterised="identical sequence" FT /protein_id="BAA16257.2" FT /translation="MSKKLIALCACPMGLAHTFMAAQALEEAAVEAGYEVKIETQGADG FT IQNRLTAQDIAEATIIIHSVAVTPEDNERFESRDVYEITLQDAIKNAAGIIKEIEEMIA FT SEQQ" XX SQ Sequence 327 BP; 95 A; 81 C; 87 G; 64 T; 0 other; 4240135287 CRC32; atgagtaaga aactgattgc cttatgtgcc tgcccgatgg gcctggctca cacctttatg 60 gccgctcagg cgctggaaga agcggcggta gaagccggtt atgaagtgaa aattgaaacc 120 cagggcgcgg acggtatcca gaatcgcctg acggcgcagg atatcgccga agcgaccatc 180 atcatccact ccgtggcagt taccccggaa gataacgaac gtttcgaatc acgcgacgtt 240 tatgaaatca ctttgcagga cgcaattaaa aacgctgcgg gcatcatcaa agaaatcgaa 300 gagatgattg cctctgaaca acagtaa 327 // ![]() |