EBI Dbfetch

ID   ACK95379; SV 1; linear; genomic DNA; STD; PRO; 306 BP.
XX
PA   CP001186.1
XX
DE   Bacillus cereus G9842 phosphoribosyl-ATP pyrophosphatase
XX
OS   Bacillus cereus G9842
OC   Bacteria; Firmicutes; Bacillales; Bacillaceae; Bacillus;
OC   Bacillus cereus group.
OX   NCBI_TaxID=405531;
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..306
FT                   /organism="Bacillus cereus G9842"
FT                   /strain="G9842"
FT                   /mol_type="genomic DNA"
FT   CDS             CP001186.1:1348883..1349188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="BCG9842_B3880"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF01502"
FT                   /db_xref="GOA:B7INA4"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7INA4"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ACK95379.1"
FT                   /translation="MKPNFSKGLIPAIVIEEGTKEVLMLAYMNEDAYEKTLETKRTWFY
FT                   SRSRQSLWNKGETSGNVQYVQSLYLDCDQDSIVVNVKQVGPACHTGEKTCFHYQII"
XX
SQ   Sequence 306 BP; 110 A; 41 C; 68 G; 87 T; 0 other; 2670886081 CRC32;
     atgaaaccta atttttcaaa aggattaata ccagcaattg tcatcgaaga aggtacgaaa        60
     gaagttttaa tgctagctta tatgaatgaa gacgcatatg aaaaaacgtt agagacgaaa       120
     agaacatggt tttattctcg ttcgaggcag tcgttatgga ataagggaga aacatcaggg       180
     aatgttcaat atgtgcaatc tctatactta gattgtgatc aagattcaat tgttgtgaat       240
     gtgaaacaag tagggcctgc ttgtcatacg ggggagaaga catgctttca ctatcaaatt       300
     atatag                                                                  306
//