EBI Dbfetch

ID   ACK91892; SV 1; linear; genomic DNA; STD; PRO; 324 BP.
XX
PA   CP001283.1
XX
DE   Bacillus cereus AH820 phosphoribosyl-ATP pyrophosphohydrolase
XX
OS   Bacillus cereus AH820
OC   Bacteria; Firmicutes; Bacillales; Bacillaceae; Bacillus;
OC   Bacillus cereus group.
OX   NCBI_TaxID=405535;
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..324
FT                   /organism="Bacillus cereus AH820"
FT                   /strain="AH820"
FT                   /mol_type="genomic DNA"
FT   CDS             CP001283.1:1420321..1420644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="BCAH820_1503"
FT                   /product="phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF01503; match to protein family HMM PF03819; match to
FT                   protein family HMM TIGR03188"
FT                   /db_xref="GOA:B7JFZ7"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7JFZ7"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ACK91892.1"
FT                   /translation="MENTFKLLFETIEERKRNPLPESYTNYLFSKGEDKILKKIGEECT
FT                   EVIIASKNNDKEELVKEMVDVLYHCFVLLAEKNIPLEDIMEEVTERNGKLSRVGDRREI
FT                   DTL"
XX
SQ   Sequence 324 BP; 138 A; 35 C; 69 G; 82 T; 0 other; 3571879090 CRC32;
     atggaaaata ccttcaaatt actattcgaa acaattgaag aacgaaagag aaatccactt        60
     cctgaatcat atacaaatta cttgttttca aaaggagaag ataaaatttt aaagaaaatt       120
     ggtgaggaat gcacggaagt aattatcgca tctaaaaata atgataaaga agagctggtg       180
     aaagaaatgg ttgatgtatt gtatcactgc ttcgtgttat tagccgaaaa aaatatacca       240
     ttagaagata ttatggagga agtgacagaa agaaatggga agctttcgag agtaggggac       300
     agaagagaaa tagatacatt atag                                              324
//