EBI Dbfetch

ID   ACK61594; SV 1; linear; genomic DNA; STD; PRO; 324 BP.
XX
PA   CP001176.1
XX
DE   Bacillus cereus B4264 phosphoribosyl-ATP diphosphatase
XX
OS   Bacillus cereus B4264
OC   Bacteria; Firmicutes; Bacillales; Bacillaceae; Bacillus;
OC   Bacillus cereus group.
OX   NCBI_TaxID=405532;
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..324
FT                   /organism="Bacillus cereus B4264"
FT                   /host="Homo sapiens"
FT                   /strain="B4264"
FT                   /mol_type="genomic DNA"
FT                   /collection_date="1969"
FT   CDS             CP001176.1:1405784..1406107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="BCB4264_A1465"
FT                   /product="phosphoribosyl-ATP diphosphatase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF01503; match to protein family HMM PF03819; match to
FT                   protein family HMM TIGR03188"
FT                   /db_xref="GOA:B7HHG7"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7HHG7"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ACK61594.1"
FT                   /translation="MENAFKLLYKTIEERKESPLPESYTNYLFSKGEDKILKKIGEECA
FT                   EVIIACKNNDKEEVVKEMVDVFYHCFVLLAEKNIALEDVMREVKERNGKLSRVGDRREI
FT                   DTL"
XX
SQ   Sequence 324 BP; 131 A; 28 C; 74 G; 91 T; 0 other; 2943615685 CRC32;
     atggaaaatg cctttaagtt gctgtataaa acaattgaag aacgaaagga aagcccactt        60
     cctgaatcgt atacaaatta tttattttca aaaggagaag ataaaatttt aaagaagatt       120
     ggtgaagagt gtgctgaagt aattatcgca tgtaaaaata atgataaaga agaagtagtg       180
     aaagaaatgg ttgatgtatt ttatcactgt ttcgttttat tagctgaaaa aaatattgca       240
     ttggaagatg tcatgcgaga ggtgaaagaa cgaaatggaa agctttcgag agttggggat       300
     agaagggaaa tagatacatt ataa                                              324
//