EBI Dbfetch

ID   ACJ82482; SV 1; linear; genomic DNA; STD; PRO; 306 BP.
XX
PA   CP001177.1
XX
DE   Bacillus cereus AH187 phosphoribosyl-ATP pyrophosphatase
XX
OS   Bacillus cereus AH187
OC   Bacteria; Firmicutes; Bacillales; Bacillaceae; Bacillus;
OC   Bacillus cereus group.
OX   NCBI_TaxID=405534;
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..306
FT                   /organism="Bacillus cereus AH187"
FT                   /strain="AH187"
FT                   /mol_type="genomic DNA"
FT   CDS             CP001177.1:1459187..1459492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="BCAH187_A1570"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF01502"
FT                   /db_xref="GOA:B7HKD5"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7HKD5"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ACJ82482.1"
FT                   /translation="MKPNFSKGLLPAIVIEEGTKEVLMLAYMNEEAYEKTLKTKRTWFY
FT                   SRSRRSLWNKGETSGNVQHVQSLYLDCDQDAIVVVVKQVGPACHTGEKTCFHYKII"
XX
SQ   Sequence 306 BP; 115 A; 41 C; 63 G; 87 T; 0 other; 3929934961 CRC32;
     atgaaaccta acttttcaaa aggactatta ccagcaattg taattgaaga aggtacaaaa        60
     gaagttttaa tgctagctta tatgaatgaa gaagcgtatg aaaaaacgct aaaaacgaaa       120
     agaacgtggt tttattctcg ttcaagaagg tcgttatgga ataaaggaga aacatcaggt       180
     aatgtccaac atgtgcaatc tctttattta gattgtgatc aagatgcaat tgttgttgtc       240
     gtaaagcaag tagggcctgc ttgccatacg ggagaaaaaa cgtgttttca ttacaaaatt       300
     atatag                                                                  306
//