EBI Dbfetch

ID   ACJ77522; SV 1; linear; genomic DNA; STD; PRO; 324 BP.
XX
PA   CP001177.1
XX
DE   Bacillus cereus AH187 phosphoribosyl-ATP pyrophosphohydrolase
XX
OS   Bacillus cereus AH187
OC   Bacteria; Firmicutes; Bacillales; Bacillaceae; Bacillus;
OC   Bacillus cereus group.
OX   NCBI_TaxID=405534;
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..324
FT                   /organism="Bacillus cereus AH187"
FT                   /strain="AH187"
FT                   /mol_type="genomic DNA"
FT   CDS             CP001177.1:1459503..1459826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="BCAH187_A1571"
FT                   /product="phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF01503; match to protein family HMM PF03819; match to
FT                   protein family HMM TIGR03188"
FT                   /db_xref="GOA:B7HKD6"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7HKD6"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ACJ77522.1"
FT                   /translation="MKNAFTLLFETIKERKRNPLSESYTNYLFSKGEDKILKKIGEECT
FT                   EVIIASKNNDNEELVKEMVDVMYHCFVLLAEKNISLEDIMEEVTERNGKLSRVGDRREI
FT                   DTL"
XX
SQ   Sequence 324 BP; 139 A; 34 C; 66 G; 85 T; 0 other; 598475115 CRC32;
     atgaaaaacg cctttacatt actattcgaa acaattaaag aacgaaagag aaatccactt        60
     tctgaatcat atacaaatta cttgttttca aaaggagaag ataaaatttt aaagaaaatt       120
     ggtgaggaat gtacggaagt aattattgca tccaaaaata atgataacga agagctagtg       180
     aaagaaatgg ttgatgtaat gtatcactgc ttcgttttat tagccgaaaa aaatatatca       240
     ttagaagata ttatggagga agtgacagaa agaaatggga agctttcgag agtaggggac       300
     agaagagaaa tagatacatt atag                                              324
//