![]() |
EBI DbfetchID ACB16336; SV 1; linear; genomic DNA; STD; PRO; 414 BP. XX PA CP000970.1 XX DE Escherichia coli SMS-3-5 methionine-R-sulfoxide reductase XX OS Escherichia coli SMS-3-5 OC Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; OC Enterobacteriaceae; Escherichia. OX NCBI_TaxID=439855; XX FH Key Location/Qualifiers FH FT source 1..414 FT /organism="Escherichia coli SMS-3-5" FT /strain="SMS-3-5" FT /mol_type="genomic DNA" FT CDS CP000970.1:1397884..1398297 FT /codon_start=1 FT /transl_table=11 FT /gene="msrB" FT /locus_tag="EcSMS35_1413" FT /product="methionine-R-sulfoxide reductase" FT /EC_number="1.8.4.-" FT /note="identified by match to protein family HMM PF01641; FT match to protein family HMM TIGR00357" FT /db_xref="GOA:B1LDV3" FT /db_xref="InterPro:IPR002579" FT /db_xref="UniProtKB/Swiss-Prot:B1LDV3" FT /func_characterised="identical sequence" FT /protein_id="ACB16336.1" FT /translation="MANKPSAEELKKNLSEMQFYVTQNHGTEPPFTGRLLHNKRDGVYH FT CLICDAPLFHSQTKYDSGCGWPSFYEPVSEESIRYIKDLSHGMQRIEIRCGNCDAHLGH FT VFPDGPQPTGERYCVNSASLRFTDGENGEEING" XX SQ Sequence 414 BP; 108 A; 99 C; 104 G; 103 T; 0 other; 2170654953 CRC32; atggctaata aaccttcggc agaagaactg aaaaaaaatt tgtccgagat gcagttctac 60 gtgacgcaga atcatgggac agagccgcca tttacgggtc gtttactgca taacaagcgt 120 gacggcgtat atcactgttt gatctgcgat gccccgctgt ttcattccca aaccaagtat 180 gattccggct gtggctggcc cagtttctac gaaccggtga gtgaagaatc cattcgttat 240 atcaaagact tgtcacatgg aatgcagcgc atagaaattc gttgcggtaa ctgtgatgcc 300 catctggggc atgtcttccc cgacgggccg cagccaacgg gcgaacgtta ttgtgttaac 360 tctgcctctt tacgctttac cgatggcgaa aacggcgaag aaatcaacgg ttga 414 // ![]() |