![]() |
EBI DbfetchID ABV92824; SV 1; linear; genomic DNA; STD; PRO; 858 BP. XX PA CP000830.1 XX DE Dinoroseobacter shibae DFL 12 arginyltransferase XX OS Dinoroseobacter shibae DFL 12 OC Bacteria; Proteobacteria; Alphaproteobacteria; Rhodobacterales; OC Rhodobacteraceae; Dinoroseobacter. OX NCBI_TaxID=398580; XX FH Key Location/Qualifiers FH FT source 1..858 FT /organism="Dinoroseobacter shibae DFL 12" FT /strain="DFL 12" FT /mol_type="genomic DNA" FT CDS complement(CP000830.1:1111025..1111882) FT /codon_start=1 FT /transl_table=11 FT /gene="ate" FT /locus_tag="Dshi_1082" FT /product="arginyltransferase" FT /EC_number="2.3.2.8" FT /note="catalyses the post-translational conjugation of FT arginine to the N terminus of a protein, Reaction: FT L-arginyl-tRNA + protein = tRNA + L-arginyl-protein" FT /db_xref="GOA:A8LSL0" FT /db_xref="InterPro:IPR007471" FT /db_xref="UniProtKB/Swiss-Prot:A8LSL0" FT /func_characterised="identical sequence" FT /protein_id="ABV92824.1" FT /translation="MRHTLPLAPQFYVTAPQPCPYIDGRMERKLFTALQGEFAETLNDS FT LSKQGFRRSQNVLYRPSCADCTACLSARIDVSAFTPSRSQRRTLKRNAVMEREATSPWA FT TEDQYSLFRKYLDARHAEGGMADMDIFEFAAMIEETPVRSRVVEYRQSAEAAPNRKRAP FT RNLAGVCLTDVLDDGLSMVYSFYDPDLVRQSLGTFMVLDHVEIAREAGLPYVYLGYWVP FT GSPKMGYKASFSGLEIYKNGEWQPIGDPESHSRDTHPLNVDPIAEQVAKINLPDTLPTD FT RRKG" XX SQ Sequence 858 BP; 157 A; 301 C; 263 G; 137 T; 0 other; 4254504934 CRC32; atgcgtcaca cccttcctct cgcgccacaa ttctatgtga cggcgccgca gccatgcccg 60 tatatcgacg ggcgcatgga gcggaagctg ttcaccgccc tgcaagggga gttcgccgag 120 accctgaacg attccctgtc caagcagggg ttccggcgct cccagaacgt gctctaccgg 180 cccagctgcg ccgattgcac cgcctgcctg tcggcgcgga tcgacgtctc ggccttcact 240 ccgtcccgct cccagcggcg cacgctgaag cgcaacgctg tgatggagcg agaggcgacc 300 tcgccctggg cgaccgagga tcagtacagc ctgttccgca aatacctgga cgcgcggcat 360 gccgaaggcg gcatggcgga catggacatc ttcgagttcg ccgcgatgat cgaggaaacg 420 cccgtgcgct cccgcgtggt ggaataccgc cagagcgccg aggccgcgcc caaccgcaag 480 cgcgcgccgc gcaacctcgc cggggtatgc ctgaccgacg tgctcgatga cgggctgtcc 540 atggtgtatt cgttctacga cccggacctc gtgcgccagt ccctcggcac cttcatggtc 600 ctcgaccacg tggagatcgc tcgcgaggcg ggcctgccct atgtctatct cggctactgg 660 gtgcccggca gtcccaagat gggctacaag gccagtttct cggggctgga gatctacaag 720 aatggcgaat ggcagcccat cggcgacccc gaaagccata gccgcgatac ccacccgctg 780 aacgtggacc cgatcgccga gcaggtcgcc aagatcaacc tgcccgacac cctgccgacg 840 gaccgcagga aaggctga 858 // ![]() |