![]() |
EBI DbfetchID ABV18018; SV 1; linear; genomic DNA; STD; PRO; 414 BP. XX PA CP000800.1 XX DE Escherichia coli E24377A methionine-R-sulfoxide reductase XX OS Escherichia coli E24377A OC Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; OC Enterobacteriaceae; Escherichia. OX NCBI_TaxID=331111; XX FH Key Location/Qualifiers FH FT source 1..414 FT /organism="Escherichia coli E24377A" FT /strain="E24377A" FT /mol_type="genomic DNA" FT CDS complement(CP000800.1:1987638..1988051) FT /codon_start=1 FT /transl_table=11 FT /gene="msrB" FT /locus_tag="EcE24377A_2002" FT /product="methionine-R-sulfoxide reductase" FT /EC_number="1.8.4.-" FT /note="identified by match to protein family HMM PF01641; FT match to protein family HMM TIGR00357" FT /db_xref="GOA:A7ZMP8" FT /db_xref="InterPro:IPR002579" FT /db_xref="UniProtKB/Swiss-Prot:A7ZMP8" FT /func_characterised="identical sequence" FT /protein_id="ABV18018.1" FT /translation="MANKPSAEELKKNLSEMQFYVTQNHGTEPPFTGRLLHNKRDGVYH FT CLICDAPLFHSQTKYDSGCGWPSFYEPVSEESIRYIKDLSHGMQRIEIRCGNCDAHLGH FT VFPDGPQPTGERYCVNSASLRFTDGENGEEING" XX SQ Sequence 414 BP; 108 A; 96 C; 104 G; 106 T; 0 other; 196096718 CRC32; atggctaata aaccttcggc agaagaactg aaaaaaaatt tgtccgagat gcagttttac 60 gtgacgcaga atcatgggac agagccgcca tttacgggtc gtttactgca taacaagcgt 120 gacggcgtat atcactgttt gatctgcgat gccccgctgt ttcattccca aaccaagtat 180 gattccggct gtggttggcc cagtttctac gaaccggtga gtgaagaatc cattcgttat 240 atcaaagact tgtcacatgg aatgcagcgc atagaaattc gttgcggtaa ctgtgatgcc 300 catctggggc atgtcttccc tgacgggccg cagccaacgg gcgaacgtta ttgtgttaac 360 tctgcctctt tacgctttac cgatggcgaa aacggcgaag aaatcaacgg ttga 414 // ![]() |