![]() |
EBI DbfetchID ABR85531; SV 1; linear; genomic DNA; STD; PRO; 657 BP. XX PA CP000744.1 XX DE Pseudomonas aeruginosa PA7 thiopurine methyltransferase XX OS Pseudomonas aeruginosa PA7 OC Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; OC Pseudomonadaceae; Pseudomonas. OX NCBI_TaxID=381754; XX FH Key Location/Qualifiers FH FT source 1..657 FT /organism="Pseudomonas aeruginosa PA7" FT /strain="PA7" FT /mol_type="genomic DNA" FT CDS CP000744.1:2378434..2379090 FT /codon_start=1 FT /transl_table=11 FT /gene="tpm" FT /locus_tag="PSPA7_2323" FT /product="thiopurine methyltransferase" FT /note="Annotation generated by automatically transferring FT the annotation from the manually curated GenBank accession FT AE004091; identified by match to protein family HMM FT PF05724" FT /db_xref="GOA:A6V3Q8" FT /db_xref="InterPro:IPR016822" FT /db_xref="UniProtKB/Swiss-Prot:A6V3Q8" FT /func_characterised="identical sequence" FT /protein_id="ABR85531.1" FT /translation="MQADFWHARWANNQIGFHLDEVNPYLMRHLSRLRLQAGEQVLVPL FT CGKTLDLAWLAAQGLDVLGVELSEKAVSDFFAENGLQPAIDQMDGFRRYRAAGITLLQG FT DFFALQSGHLAGCRAFYDRAALIALPPDMRERYAGHLQAILPARSLGLLVTIDYPQGEM FT AGPPFAVPDAEVREHYAAGWRIEELERGDVLGVNWKFLERGVSWLNEAVYLLQRG" XX SQ Sequence 657 BP; 98 A; 209 C; 236 G; 114 T; 0 other; 502396090 CRC32; atgcaggcgg atttttggca cgcccgctgg gcgaacaacc agatcggctt ccatctggac 60 gaggtcaatc cctacctgat gcgccacctg tcgcggctgc gactgcaagc gggcgagcag 120 gtcctggtgc cgctgtgcgg caagaccctg gacctggcct ggctggccgc gcagggcctg 180 gatgtgctgg gggtggagct ttcggaaaag gccgtgagcg atttcttcgc ggagaacggc 240 ctgcaaccgg cgatcgacca gatggatggc ttccgtcgct accgggccgc cggcatcacc 300 ctgctgcagg gggacttctt cgctctgcag tccgggcacc tggcagggtg ccgcgcgttc 360 tacgaccgcg ccgcgctgat cgccttgccg ccggatatgc gcgagcgcta tgccggccat 420 ctgcaggcga tcctgccggc gcgcagcctg gggctgctgg tcaccatcga ctatccgcag 480 ggggaaatgg ccgggccgcc gttcgccgtg cccgacgccg aggtgcgtga gcattacgcc 540 gcgggctggc gcatcgagga actggagcgc ggcgacgtgc tcggcgtcaa ctggaagttc 600 ctcgagcgcg gggtgtcctg gctgaacgaa gccgtctacc tgctgcagag aggttga 657 // ![]() |