![]() |
EBI DbfetchID ABR80926; SV 1; linear; genomic DNA; STD; PRO; 510 BP. XX PA CP000744.1 XX DE Pseudomonas aeruginosa PA7 conserved hypothetical protein XX OS Pseudomonas aeruginosa PA7 OC Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; OC Pseudomonadaceae; Pseudomonas. OX NCBI_TaxID=381754; XX FH Key Location/Qualifiers FH FT source 1..510 FT /organism="Pseudomonas aeruginosa PA7" FT /strain="PA7" FT /mol_type="genomic DNA" FT CDS CP000744.1:3956818..3957327 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="PSPA7_3821" FT /product="conserved hypothetical protein" FT /note="Annotation generated by automatically transferring FT the annotation from the manually curated GenBank accession FT AE004091; identified by match to protein family HMM FT PF04115" FT /db_xref="GOA:A6V7Z0" FT /db_xref="InterPro:IPR007247" FT /db_xref="UniProtKB/Swiss-Prot:A6V7Z0" FT /func_characterised="identical sequence" FT /protein_id="ABR80926.1" FT /translation="MRTLKIEPLTKEAFAPFGDVIETEGSDYFMINNGSTRRYHKLATV FT ETAQPEDNAIISIFSAEKLEMPLRIRMLERHPLGSQAFIPLLGNPFLVVVAPLGDVPVP FT GLVRAFLTNGRQGVNYHRGVWHHPVLTIEKRDDFLVVDRSGSGNNCDEHFFTEDEQLLL FT DPQSNQ" XX SQ Sequence 510 BP; 112 A; 168 C; 137 G; 93 T; 0 other; 702303813 CRC32; atgcgcactc tcaagatcga gccgttgacc aaggaagcct tcgccccgtt cggtgatgtg 60 atcgaaaccg aaggcagcga ctatttcatg atcaacaacg gctccacccg ccgttatcac 120 aagctggcca cggtcgagac cgcgcagccg gaggataacg cgatcatcag catcttcagc 180 gccgaaaagc tggagatgcc attgcgcatc cgcatgctgg aacgccatcc gctgggcagc 240 caggccttca tcccgctgct cggcaacccc tttctggtcg tggtcgcgcc acttggcgat 300 gtacctgtac cgggcctcgt ccgcgccttc ctgaccaacg gaaggcaggg cgtcaattac 360 caccgcggcg tctggcacca tccggtgctg acgatcgaaa agcgggatga cttcctggtg 420 gtcgatcgca gcggttcagg gaacaactgc gacgagcatt tcttcaccga ggacgaacag 480 ctcctcctcg acccccaatc aaaccaataa 510 // ![]() |