![]() |
EBI DbfetchID ABQ61630; SV 1; linear; genomic DNA; STD; PRO; 1137 BP. XX PA CP000708.1 XX DE Brucella ovis ATCC 25840 glutamate 5-kinase XX OS Brucella ovis ATCC 25840 OC Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Brucellaceae; OC Brucella. OX NCBI_TaxID=444178; XX FH Key Location/Qualifiers FH FT source 1..1137 FT /organism="Brucella ovis ATCC 25840" FT /chromosome="I" FT /strain="ATCC 25840" FT /mol_type="genomic DNA" FT CDS complement(CP000708.1:1783466..1784602) FT /codon_start=1 FT /transl_table=11 FT /gene="proB" FT /locus_tag="BOV_1777" FT /product="glutamate 5-kinase" FT /EC_number="2.7.2.11" FT /note="this annotation is based on an automated transfer of FT annotation from Brucella suis 1330 GenBank records FT (AE014291 and AE014292); identified by match to protein FT family HMM PF00696; match to protein family HMM PF01472; FT match to protein family HMM TIGR01027" FT /db_xref="GOA:A5VSI4" FT /db_xref="InterPro:IPR002478" FT /db_xref="UniProtKB/Swiss-Prot:A5VSI4" FT /func_characterised="identical sequence" FT /protein_id="ABQ61630.1" FT /translation="MLKKLKDYRRIVVKIGSALLVDRATGLKREWLESLGQDIAALQHA FT GVEVLVVSSGAIALGRTVLGLPKKALKLEESQAAAAAGQIALAKAYADVLGGHGIKSGQ FT ILVTLSDTEERRRYLNARATIETLLKLKAVPIINENDTVATTEIRYGDNDRLAARVATM FT MGADLLILLSDIDGLYTAPPHKNPDAQFLPFVETITPQIEAMAGAAASELSRGGMKTKL FT DAGKIANAAGTAMIITSGTRFGPLSAIDRGERATLFEAAHAPVNAWKTWISGNLEPAGR FT LTVDAGAVKALKSGKSLLPAGVKEVDGDFERGDTVAVMNEDGREIARGLIAYDAADARK FT VAGHKSDEISAILGYDARAAMIHRNDLVVRAASDAKAA" XX SQ Sequence 1137 BP; 231 A; 302 C; 384 G; 220 T; 0 other; 2963578255 CRC32; atgctgaaga aactgaaaga ctatcgccgc atcgttgtta aaataggctc tgcccttctg 60 gtggaccggg ccacaggcct gaagcgcgaa tggctggaaa gcctggggca ggatattgcc 120 gccttgcagc atgcgggcgt tgaggtgctg gtggtttcgt cgggtgcaat tgcactgggg 180 cgcacggttc tgggcctgcc gaaaaaggcg ctgaagcttg aggaaagcca ggcggcggca 240 gcagccgggc agattgcgct ggcgaaggct tatgcggatg tgctgggcgg acatggcatc 300 aagtcgggac agattctggt cacgctttcc gatacggaag agcgccgccg ctatctcaat 360 gcgcgcgcaa ccatcgagac cctgctgaag ctcaaggccg tgccgatcat caatgaaaac 420 gatacggtgg caaccaccga aatccgttat ggcgacaatg acaggttggc ggcgcgcgtc 480 gcgaccatga tgggcgcgga ccttctgatc ctgctttccg acattgacgg gctttatacc 540 gcgccgccgc acaagaatcc ggatgcgcaa tttctgccct ttgtcgaaac catcacgccg 600 cagatcgaag ccatggcggg ggcggcagca tccgagcttt cgcggggtgg catgaagacc 660 aagctcgatg cgggcaagat tgcaaacgct gccgggaccg cgatgattat cacttcgggc 720 acgcgtttcg gcccgctttc ggcaattgac cgaggggagc gtgcgacatt gttcgaggct 780 gcccatgcgc cggtcaatgc gtggaagacg tggatttccg gcaatctgga accggctggc 840 cggttgactg tggatgcggg tgctgtcaag gcgctcaaat ccggcaaatc gcttttgcct 900 gcgggcgtga aggaagttga cggggatttc gagcgtggcg acacggttgc cgtcatgaac 960 gaggatgggc gggagattgc gcgcggtctg atcgcctatg atgctgctga cgcccgcaag 1020 gttgccgggc ataaaagcga tgagatcagt gccattcttg gctatgatgc ccgcgcggcg 1080 atgatccatc gcaacgatct ggtggtgcgg gccgccagcg atgcgaaagc cgcatag 1137 // ![]() |