![]() |
EBI DbfetchID ABQ61538; SV 1; linear; genomic DNA; STD; PRO; 294 BP. XX PA CP000708.1 XX DE Brucella ovis ATCC 25840 pterin-4-alpha-carbinolamine dehydratase XX OS Brucella ovis ATCC 25840 OC Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Brucellaceae; OC Brucella. OX NCBI_TaxID=444178; XX FH Key Location/Qualifiers FH FT source 1..294 FT /organism="Brucella ovis ATCC 25840" FT /chromosome="I" FT /strain="ATCC 25840" FT /mol_type="genomic DNA" FT CDS complement(CP000708.1:88104..88397) FT /codon_start=1 FT /transl_table=11 FT /gene="phhB" FT /locus_tag="BOV_0080" FT /product="pterin-4-alpha-carbinolamine dehydratase" FT /EC_number="4.2.1.96" FT /note="this annotation is based on an automated transfer of FT annotation from Brucella suis 1330 GenBank records FT (AE014291 and AE014292); identified by match to protein FT family HMM PF01329" FT /db_xref="GOA:A5VN26" FT /db_xref="InterPro:IPR001533" FT /db_xref="UniProtKB/Swiss-Prot:A5VN26" FT /func_characterised="identical sequence" FT /protein_id="ABQ61538.1" FT /translation="MARNRLTESEMNEALRALDGWQKVDGREAITRSFKFKDFSTAFGF FT MAQAALYAEKLDHHPEWFNAYNRVDVTLATHSENGVTELDIKMARKMNAIAG" XX SQ Sequence 294 BP; 82 A; 77 C; 85 G; 50 T; 0 other; 2870620589 CRC32; atggcacgca accgattgac ggaaagcgaa atgaacgagg cgctcagggc gctggacggc 60 tggcagaaag ttgatgggcg cgaggcaatc actcgcagct tcaaattcaa ggatttcagc 120 accgccttcg gtttcatggc gcaggcagca ctttacgcag aaaagctcga ccatcacccc 180 gaatggttca atgcctataa ccgtgtggac gtaacacttg cgacccacag cgaaaacggg 240 gttacagaac tggatatcaa gatggcgcgc aagatgaacg cgatcgccgg ctga 294 // ![]() |