![]() |
EBI DbfetchID ABQ61505; SV 1; linear; genomic DNA; STD; PRO; 324 BP. XX PA CP000708.1 XX DE Brucella ovis ATCC 25840 phosphoribosyl-ATP pyrophosphohydrolase XX OS Brucella ovis ATCC 25840 OC Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Brucellaceae; OC Brucella. OX NCBI_TaxID=444178; XX FH Key Location/Qualifiers FH FT source 1..324 FT /organism="Brucella ovis ATCC 25840" FT /chromosome="I" FT /strain="ATCC 25840" FT /mol_type="genomic DNA" FT CDS CP000708.1:2012946..2013269 FT /codon_start=1 FT /transl_table=11 FT /gene="hisE" FT /locus_tag="BOV_2006" FT /product="phosphoribosyl-ATP pyrophosphohydrolase" FT /EC_number="3.6.1.31" FT /note="this annotation is based on an automated transfer of FT annotation from Brucella suis 1330 GenBank records FT (AE014291 and AE014292); identified by match to protein FT family HMM PF01503; match to protein family HMM TIGR03188" FT /db_xref="GOA:A5VT44" FT /db_xref="InterPro:IPR008179" FT /db_xref="UniProtKB/Swiss-Prot:A5VT44" FT /func_characterised="identical sequence" FT /protein_id="ABQ61505.1" FT /translation="MSQFTLADLERIVAERASVTDGTSYTASLVAKGQPKAAQKLGEEA FT VETVIAAVSGDRAGVVSESADLLYHLAVVWNIAGVALEDVLQELQRRTAQTGLAEKASR FT PKG" XX SQ Sequence 324 BP; 66 A; 87 C; 114 G; 57 T; 0 other; 678858507 CRC32; atgagccagt ttacgcttgc agaccttgaa cggatcgtgg ccgagcgcgc cagcgtgacg 60 gatggtacat cctatacggc aagccttgtg gcgaaagggc agccgaaggc tgcgcagaaa 120 ctgggcgagg aagcggtgga aacggtgata gcagccgttt ccggcgaccg tgccggtgtc 180 gtctcggaaa gtgccgatct gctctatcat ctggcggtgg tctggaatat tgcaggcgtg 240 gcgctggagg atgtgcttca ggaacttcag cgccgcaccg cccagaccgg ccttgcggaa 300 aaggccagcc gcccgaaggg ctga 324 // ![]() |