![]() |
EBI DbfetchID ABB16170; SV 1; linear; genomic DNA; STD; PRO; 1089 BP. XX PA CP000141.1 XX DE Carboxydothermus hydrogenoformans Z-2901 histidinol-phosphate DE aminotransferase XX OS Carboxydothermus hydrogenoformans Z-2901 OC Bacteria; Firmicutes; Clostridia; Thermoanaerobacterales; OC Thermoanaerobacteraceae; Carboxydothermus. OX NCBI_TaxID=246194; XX FH Key Location/Qualifiers FH FT source 1..1089 FT /organism="Carboxydothermus hydrogenoformans Z-2901" FT /strain="Z-2901" FT /mol_type="genomic DNA" FT CDS complement(CP000141.1:1728848..1729936) FT /codon_start=1 FT /transl_table=11 FT /gene="hisC2" FT /locus_tag="CHY_1929" FT /product="histidinol-phosphate aminotransferase" FT /EC_number="2.6.1.9" FT /note="identified by match to protein family HMM PF00155; FT match to protein family HMM TIGR01141" FT /db_xref="GOA:Q3AAT6" FT /db_xref="InterPro:IPR001176" FT /db_xref="InterPro:IPR001917" FT /db_xref="InterPro:IPR004839" FT /db_xref="InterPro:IPR005861" FT /db_xref="InterPro:IPR015421" FT /db_xref="InterPro:IPR015424" FT /db_xref="UniProtKB/Swiss-Prot:Q3AAT6" FT /func_characterised="identical sequence" FT /protein_id="ABB16170.1" FT /translation="MVRKALENLKPYVPGKPVEEVERELGITNIDKLASNENLWGISPK FT VAAAIKEAVDKVNYYPDGGAFRLKEKIAAKYGVTPDNIILGNGSDELVMFLAMALIDPG FT DEAIMPVPSFPRYEPVVTMMNGIAREIPLKEHRLDLKTMAEAVNEKTRLVYLCNPNNPT FT GTYITKGELEEFLERVPEEVVVVLDEAYFEFARLFNDYPDGLNFFKKRPNTVVLRTFSK FT AYGLAGLRVGYGFAPENLAKAINSLRPPFNVNFLAQMAAVAALDDEEYVREVVKNTDEG FT KKFLYQEIIRMGLSYIPSAANFLMIKTEKPSALVFRELLKRGVIVRSGDIFGMDDWIRV FT TVGTPVQNARFINELKMVLEIL" XX SQ Sequence 1089 BP; 309 A; 198 C; 284 G; 298 T; 0 other; 622983626 CRC32; atggttcgta aagctttgga aaacttaaaa ccttacgtgc cgggaaagcc ggtagaagag 60 gttgaacggg agctcgggat aaccaatatc gataaacttg cttccaatga aaacctctgg 120 ggcatttctc ccaaagttgc cgcagccatt aaagaagcgg tggataaggt aaattattat 180 cccgacggcg gggcttttcg tttgaaagaa aagattgcgg caaaatacgg agttacgccg 240 gataacatta tcctggggaa tgggtccgac gagttagtaa tgtttttagc gatggcctta 300 attgacccgg gggatgaagc gataatgccg gtgccgagct ttccccggta tgaaccggtg 360 gttacaatga tgaacggaat tgcccgggaa attcccttaa aagaacaccg gctggattta 420 aaaacaatgg cagaggcggt aaatgaaaaa accaggcttg tttatctctg caatcccaat 480 aaccctaccg gtacttatat aacgaaaggt gagctggagg aatttttgga aagagtaccg 540 gaggaagtag ttgtggtttt agatgaagcc tactttgagt ttgcccggct ttttaacgat 600 tatcccgatg gcttaaattt ttttaagaaa cggcccaata cggtggtgtt aagaaccttt 660 tccaaagctt atggcctggc cggtctcagg gtcggttacg gttttgctcc tgagaattta 720 gccaaggcaa ttaatagctt gcgtccgcct tttaacgtaa actttttagc gcagatggct 780 gctgtagctg ctttagatga cgaggagtat gtaagggaag tagtcaaaaa tactgatgag 840 gggaaaaagt ttctctatca ggagataatt cggatggggc tttcctacat tccttcggct 900 gccaattttt taatgattaa aaccgaaaag ccttcagcat tagtatttcg ggaattatta 960 aaacggggtg taattgtccg ttccggggac atttttggga tggacgattg gattagagta 1020 acggtgggta cacctgtcca aaacgcgcgc tttatcaatg agttaaaaat ggtgctggaa 1080 attttgtaa 1089 // ![]() |