![]() |
EBI DbfetchID AAU92905; SV 1; linear; genomic DNA; STD; PRO; 669 BP. XX PA AE017282.2 XX DE Methylococcus capsulatus str. Bath thiopurine methyltransferase XX OS Methylococcus capsulatus str. Bath OC Bacteria; Proteobacteria; Gammaproteobacteria; Methylococcales; OC Methylococcaceae; Methylococcus. OX NCBI_TaxID=243233; XX FH Key Location/Qualifiers FH FT source 1..669 FT /organism="Methylococcus capsulatus str. Bath" FT /strain="Bath" FT /mol_type="genomic DNA" FT CDS complement(AE017282.2:836081..836749) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="MCA0794" FT /product="thiopurine methyltransferase" FT /EC_number="2.1.1.67" FT /note="identified by similarity to SP:O86262; match to FT protein family HMM PF05724" FT /db_xref="GOA:Q60AQ2" FT /db_xref="InterPro:IPR016822" FT /db_xref="UniProtKB/Swiss-Prot:Q60AQ2" FT /func_characterised="identical sequence" FT /protein_id="AAU92905.1" FT /translation="MDPDFWHERWRQKQTGFHQTQVNPLLETFWPRCVGPARPRVFVPL FT CGKSLDMVWLRNRGHSVLGNELSPIAVDEFFRENGLSAVTTPLGNGFVRAESGDISLLC FT GNYFDLTPDLIGKVGAIYDRAALVAMPPEMQGRYAEQVFRLLPETPPMLLITLEYDAEE FT MSGPPFPVPEEAVVRLFGPAYRIELLSARDALEGNPQLRAKGLSRLTEKAYWLRAQASA FT " XX SQ Sequence 669 BP; 119 A; 212 C; 215 G; 123 T; 0 other; 3670876334 CRC32; atggatcccg atttctggca cgagcgctgg cggcagaagc agacgggctt tcaccagaca 60 caagtcaatc cgctgctcga gaccttctgg cctcgatgcg tcggtcctgc gcggcccagg 120 gttttcgttc ccctctgcgg caagtccctg gacatggtct ggctgcggaa tcgggggcat 180 tccgtactcg ggaacgaact cagccccatc gcggtcgacg agttcttccg ggaaaacggc 240 ttgtcggcgg ttacgacacc gctcggaaac ggcttcgtcc gcgccgagag cggcgatata 300 agcctgctgt gcggaaacta tttcgacttg actccggacc tcatcggcaa ggtcggagcg 360 atctacgacc gggcagctct ggtggcgatg cccccggaaa tgcagggccg ctatgccgag 420 caggtcttcc ggctgctgcc ggaaaccccg cccatgctgc tcattacgct ggaatacgac 480 gccgaggaaa tgagcggccc gccgttcccc gtccctgagg aagcggtggt tcgcctgttc 540 ggaccagcct accggatcga gctgctgtcg gcgcgcgatg cgttggaagg gaatccgcag 600 ctgcgcgcca aaggattgag ccgcctgacc gaaaaggcct attggctgcg ggcccaggcc 660 tcggcctga 669 // ![]() |