 |
|
EBI DbfetchID AAP24289; SV 1; linear; genomic DNA; STD; PRO; 360 BP. XX PA AE016879.1 XX DE Bacillus anthracis str. Ames holo-[acyl-carrier-protein] synthase XX OS Bacillus anthracis str. Ames OC Bacteria; Firmicutes; Bacillales; Bacillaceae; Bacillus; OC Bacillus cereus group. OX NCBI_TaxID=198094; XX FH Key Location/Qualifiers FH FT source 1..360 FT /organism="Bacillus anthracis str. Ames" FT /strain="Ames" FT /mol_type="genomic DNA" FT CDS AE016879.1:238124..238483 FT /codon_start=1 FT /transl_table=11 FT /gene="acpS" FT /locus_tag="BA_0250" FT /old_locus_tag="BA0250" FT /product="holo-[acyl-carrier-protein] synthase" FT /note="an automated process has identified a potential FT problem with this gene model; the current end5 and/or the FT end3 may need to extended or the current gene model may FT need to be merged with a neighboring gene model; the FT current gene model (or a revised gene model) may contain a FT premature stop; identified by match to protein family HMM FT PF01648; match to protein family HMM TIGR00516; match to FT protein family HMM TIGR00556" FT /db_xref="GOA:Q81JG3" FT /db_xref="InterPro:IPR002582" FT /db_xref="InterPro:IPR004568" FT /db_xref="InterPro:IPR008278" FT /db_xref="PDB:3HYK" FT /db_xref="UniProtKB/Swiss-Prot:Q81JG3" FT /func_characterised="identical sequence" FT /protein_id="AAP24289.1" FT /translation="MIVGIGIDIIELNRIEKMLDGKLKFMERILTENERNVAKGLKGSR FT LTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEVRNDDRGKPILITSTEHIVHLSISHS FT KEFAVAQVVLESSSS" XX SQ Sequence 360 BP; 122 A; 37 C; 93 G; 108 T; 0 other; 2232572758 CRC32; atgattgtag ggattggaat cgatattatt gaattgaatc gaattgaaaa aatgctagat 60 ggaaagctta aatttatgga acgtatttta actgaaaatg aacgtaatgt tgctaaggga 120 ctgaagggaa gccgccttac agagtttgta gctggaagat ttgcagcgaa agaggcgtat 180 tcaaaagcgg taggaactgg tattgggaaa gaagtgagtt ttttagatat tgaagtaaga 240 aatgatgata gagggaagcc gattcttatt acgagtacag aacatattgt tcatttatcg 300 attagtcata gtaaggaatt tgctgttgct caagttgttt tagaaagctc gtcaagctag 360 // |
|