![]() |
EBI DbfetchID AAP17772; SV 1; linear; genomic DNA; STD; PRO; 327 BP. XX PA AE014073.1 XX DE Shigella flexneri 2a str. 2457T putative PTS system enzyme IIB component XX OS Shigella flexneri 2a str. 2457T OC Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; OC Enterobacteriaceae; Shigella. OX NCBI_TaxID=198215; XX FH Key Location/Qualifiers FH FT source 1..327 FT /organism="Shigella flexneri 2a str. 2457T" FT /strain="2457T" FT /serotype="2a" FT /mol_type="genomic DNA" FT CDS complement(AE014073.1:2488893..2489219) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="S2592" FT /old_locus_tag="S_2592" FT /product="putative PTS system enzyme IIB component" FT /note="putative transport; Not classified; residues 1 to FT 108 of 108 are 88.88 pct identical to residues 1 to 108 of FT 108 from Escherichia coli K-12 : B2387" FT /db_xref="GOA:Q821A9" FT /db_xref="InterPro:IPR003353" FT /db_xref="UniProtKB/Swiss-Prot:Q821A9" FT /func_characterised="identical sequence" FT /protein_id="AAP17772.1" FT /translation="MSKKLIALCACPMGLAHTFMAAQVLEEAAVEAGYEVKIETQGADG FT IQNRLTAQDIAEATIIIHSVAVTPEDNERFESRDVYEITLQDAIKNAAGIIKEIEEMIA FT SEQQ" XX SQ Sequence 327 BP; 96 A; 79 C; 86 G; 66 T; 0 other; 401431263 CRC32; atgagtaaga aactgattgc cttatgtgcc tgcccaatgg gcctggctca cacttttatg 60 gccgctcagg tgctggaaga agcggcggta gaagccggtt atgaagtgaa aattgaaacc 120 cagggcgcgg acggcatcca gaatcgcctg acggcgcagg atatcgccga agcgaccatc 180 atcatccatt ccgtggcagt taccccggaa gataacgaac gtttcgaatc acgcgacgtt 240 tatgaaatca ctttgcagga cgcaattaaa aacgctgcgg gcatcatcaa agaaatcgaa 300 gagatgattg cctctgaaca acagtaa 327 // ![]() |