![]() |
EBI DbfetchID AAP17514; SV 1; linear; genomic DNA; STD; PRO; 285 BP. XX PA AE014073.1 XX DE Shigella flexneri 2a str. 2457T galactitol-specific enzyme IIB of DE phosphotransferase system XX OS Shigella flexneri 2a str. 2457T OC Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; OC Enterobacteriaceae; Shigella. OX NCBI_TaxID=198215; XX FH Key Location/Qualifiers FH FT source 1..285 FT /organism="Shigella flexneri 2a str. 2457T" FT /strain="2457T" FT /serotype="2a" FT /mol_type="genomic DNA" FT CDS complement(AE014073.1:2162822..2163106) FT /codon_start=1 FT /transl_table=11 FT /gene="gatB" FT /locus_tag="S2281" FT /old_locus_tag="S_2281" FT /product="galactitol-specific enzyme IIB of FT phosphotransferase system" FT /note="enzyme; Transport of small molecules: Carbohydrates, FT organic acids, alcohols; residues 1 to 94 of 94 are 95.74 FT pct identical to residues 1 to 94 of 94 from Escherichia FT coli K-12 : B2093" FT /db_xref="GOA:P0A437" FT /db_xref="InterPro:IPR003501" FT /db_xref="UniProtKB/Swiss-Prot:P0A437" FT /func_characterised="identical sequence" FT /protein_id="AAP17514.1" FT /translation="MKRKIIVACGGAVATSTMAAEEIKELCQSHNIPVELIQCRVNEIE FT TYMDGVHLICTTARVDRSFGDIPLVHGMPFVSGVGIEALQNKILTILQG" XX SQ Sequence 285 BP; 76 A; 47 C; 75 G; 87 T; 0 other; 1815684431 CRC32; atgaaacgca agattattgt cgcttgcgga ggcgcggttg cgacctctac gatggcggcg 60 gaagaaatta aagagttgtg tcagagtcat aatattcctg ttgaattaat ccagtgtcgg 120 gttaatgaaa tagaaaccta tatggatggt gtgcatttga tatgtaccac tgccagggtg 180 gatcgtagtt ttggcgatat tccgttagtt cacggcatgc cttttgtttc tggtgtcggt 240 atcgaagcat tacaaaataa aattctgact atcttacagg gatga 285 // ![]() |