![]() |
EBI DbfetchID AAN30061; SV 1; linear; genomic DNA; STD; PRO; 807 BP. XX PA AE014291.4 XX DE Brucella suis 1330 indole-3-glycerol phosphate synthase XX OS Brucella suis 1330 OC Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Brucellaceae; OC Brucella. OX NCBI_TaxID=204722; XX FH Key Location/Qualifiers FH FT source 1..807 FT /organism="Brucella suis 1330" FT /chromosome="I" FT /strain="1330" FT /mol_type="genomic DNA" FT CDS AE014291.4:1119395..1120201 FT /codon_start=1 FT /transl_table=11 FT /gene="trpC" FT /locus_tag="BR1141" FT /product="indole-3-glycerol phosphate synthase" FT /EC_number="4.1.1.48" FT /note="identified by similarity to EGAD:133573; match to FT protein family HMM PF00218" FT /db_xref="GOA:P66989" FT /db_xref="HSSP:1PII" FT /db_xref="InterPro:IPR001468" FT /db_xref="UniProtKB/Swiss-Prot:P66989" FT /func_characterised="identical sequence" FT /protein_id="AAN30061.1" FT /translation="MSTDILRKIEAYKREEIAAAKARLALDELKARTRDQSAPRGFLKA FT LEAKRAAGQFALIAEIKKASPSKGLIRPDFDPPALAKAYEEGGAACLSVLTDTPSFQGA FT PEFLTAARQACSLPALRKDFLFDPYQVYEARSWGADCILIIMASVDDDLAKELEDTAFA FT LGMDALIEVHDEAEMERALKLSSRLLGVNNRNLRSFEVNLAVSERLAKMAPSDRLLVGE FT SGIFTHEDCLRLEKSGIGTFLIGESLMRQHDVAAATRALLTGAEKL" XX SQ Sequence 807 BP; 172 A; 236 C; 235 G; 164 T; 0 other; 146021672 CRC32; atgtccaccg atattcttcg caagatcgaa gcctataagc gggaagaaat agccgccgcc 60 aaggcgcgtc ttgcccttga tgaactgaag gcccggacga gggatcagtc agcgccgcgc 120 ggttttctga aggcacttga ggccaagcgc gccgccggtc aatttgcact gatcgcggag 180 ataaagaaag caagcccgtc caaaggcttg atccgccccg atttcgaccc gccagcgctt 240 gcaaaggctt atgaagaagg cggtgcggcc tgtctttccg tgctgaccga cacgccttcc 300 tttcagggcg cgccggaatt cctcacggcc gcacgccagg cttgcagcct gcccgcattg 360 cgcaaggatt tcctgttcga cccctatcag gtctatgaag cgcgtagctg gggagcggat 420 tgcattctca tcatcatggc cagcgtcgat gacgatcttg caaaagagct ggaagacacg 480 gctttcgcac tgggcatgga tgcgctgatc gaagtgcatg acgaagctga aatggaacgc 540 gccctgaagc tttcctcgcg cctgctcggc gtcaacaatc gcaatctgcg cagcttcgag 600 gtcaatctcg ccgtttccga gcggcttgcg aaaatggctc cgtccgaccg tctgctggtt 660 ggcgaaagcg gcatcttcac gcatgaggac tgcctgcggc ttgaaaagtc cggcatcggc 720 acttttctga taggcgaaag ccttatgcga caacatgacg ttgcggcagc cacccgcgcg 780 cttttgacgg gtgcggaaaa gctatga 807 // ![]() |