![]() |
EBI DbfetchID AAN29128; SV 1; linear; genomic DNA; STD; PRO; 663 BP. XX PA AE014291.4 XX DE Brucella suis 1330 ham1 protein XX OS Brucella suis 1330 OC Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Brucellaceae; OC Brucella. OX NCBI_TaxID=204722; XX FH Key Location/Qualifiers FH FT source 1..663 FT /organism="Brucella suis 1330" FT /chromosome="I" FT /strain="1330" FT /mol_type="genomic DNA" FT CDS AE014291.4:186815..187477 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="BR0175" FT /product="ham1 protein" FT /note="identified by match to protein family HMM PF01725; FT match to protein family HMM TIGR00042" FT /db_xref="GOA:P64306" FT /db_xref="HSSP:1B78" FT /db_xref="InterPro:IPR002637" FT /db_xref="UniProtKB/Swiss-Prot:P64306" FT /func_characterised="identical sequence" FT /protein_id="AAN29128.1" FT /translation="MRMLEKGKLIVASHNAGKLREFDGLIGPFGFEVSSVAALGLPEPD FT ETGTTFEENAYIKALAAAKATGFPALSDDSGLMVDALDGEPGVYTANWAETEDGKRDFD FT MAMQKVENLLQEKGATTPDKRKARFVSVICLAWPDGEAEYFRGEVEGTLVWPPRGNIGF FT GYDPVFLPDGYGKTFGEMTAEEKHGWKPGDASALSHRARAFKLFAEKALNVVSAPAE" XX SQ Sequence 663 BP; 145 A; 179 C; 216 G; 123 T; 0 other; 1202085920 CRC32; atgagaatgc tggaaaaggg caagctgatc gtcgcctcgc acaatgcggg caagctcagg 60 gaatttgacg ggttgatcgg cccgttcggt ttcgaggtga gttcggtcgc ggcccttggc 120 ctgccagaac cggacgagac cggcacgacc tttgaggaaa acgcctatat caaggcgctt 180 gccgccgcca aggcaacggg ctttccagct ttatccgacg attccggcct gatggtggac 240 gcacttgacg gcgaaccggg cgtctacacg gccaactggg cggaaacgga agacggcaaa 300 cgcgatttcg acatggccat gcagaaggtg gaaaatcttt tgcaggaaaa gggcgcgacg 360 acgcctgata aacgcaaggc gcgtttcgtc tcggtcatct gccttgcctg gcccgatggc 420 gaggcggaat atttccgtgg tgaagtggaa ggcacgctcg tctggccacc gcgcggcaat 480 atcggtttcg gttacgatcc ggtgtttctg cccgatggat acgggaaaac cttcggcgaa 540 atgacggcgg aagaaaagca tggctggaag ccgggtgacg ccagcgcgct gtcgcaccgg 600 gcccgcgcct tcaagctttt tgccgaaaag gcactcaacg tggtatcggc tccggcagaa 660 tga 663 // ![]() |