![]() |
EBI DbfetchID AAG57150; SV 1; linear; genomic DNA; STD; PRO; 285 BP. XX PA AE005174.2 XX DE Escherichia coli O157:H7 EDL933 galactitol-specific enzyme IIB of DE phosphotransferase system XX OS Escherichia coli O157:H7 EDL933 OC Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; OC Enterobacteriaceae; Escherichia. OX NCBI_TaxID=155864; XX FH Key Location/Qualifiers FH FT source 1..285 FT /organism="Escherichia coli O157:H7 EDL933" FT /strain="EDL933" FT /serotype="O157:H7" FT /mol_type="genomic DNA" FT CDS complement(AE005174.2:2918042..2918326) FT /codon_start=1 FT /transl_table=11 FT /gene="gatB" FT /locus_tag="Z3256" FT /product="galactitol-specific enzyme IIB of FT phosphotransferase system" FT /function="enzyme; Transport of small molecules: FT Carbohydrates, organic acids, alcohols" FT /note="Residues 1 to 94 of 94 are 95.74 pct identical to FT residues 1 to 94 of 94 from Escherichia coli K-12 Strain FT MG1655: B2093" FT /db_xref="GOA:P0A436" FT /db_xref="InterPro:IPR003501" FT /db_xref="InterPro:IPR013011" FT /db_xref="UniProtKB/Swiss-Prot:P0A436" FT /func_characterised="identical sequence" FT /protein_id="AAG57150.1" FT /translation="MKRKIIVACGGAVATSTMAAEEIKELCQSHNIPVELIQCRVNEIE FT TYMDGVHLICTTARVDRSFGDIPLVHGMPFVSGVGIEALQNKILTILQG" XX SQ Sequence 285 BP; 75 A; 49 C; 76 G; 85 T; 0 other; 1217211108 CRC32; atgaaacgca agattattgt cgcttgcgga ggcgcggttg cgacctctac gatggcggcg 60 gaagaaatta aagagttgtg tcagagtcat aatattcctg ttgaattaat ccagtgtcgg 120 gttaatgaaa tagaaaccta tatggatggc gtgcatttga tatgcaccac tgccagggtg 180 gatcgtagtt ttggcgatat tccgttagtt cacggcatgc cttttgtttc tggtgtcggt 240 atcgaagcat tacaaaataa aattctgact atcttacagg ggtga 285 // ![]() |