![]() |
EBI DbfetchID AAF40754; SV 1; linear; genomic DNA; STD; PRO; 489 BP. XX PA AE002098.2 XX DE Neisseria meningitidis MC58 dihydrofolate reductase XX OS Neisseria meningitidis MC58 OC Bacteria; Proteobacteria; Betaproteobacteria; Neisseriales; Neisseriaceae; OC Neisseria. OX NCBI_TaxID=122586; XX FH Key Location/Qualifiers FH FT source 1..489 FT /organism="Neisseria meningitidis MC58" FT /strain="MC58" FT /mol_type="genomic DNA" FT CDS AE002098.2:317533..318021 FT /codon_start=1 FT /transl_table=11 FT /gene="folA" FT /locus_tag="NMB0308" FT /product="dihydrofolate reductase" FT /EC_number="1.5.1.3" FT /note="identified by similarity to EGAD:8105; match to FT protein family HMM PF00186" FT /db_xref="GOA:Q9K168" FT /db_xref="HSSP:1DF7" FT /db_xref="InterPro:IPR017925" FT /db_xref="UniProtKB/Swiss-Prot:Q9K168" FT /func_characterised="identical sequence" FT /protein_id="AAF40754.1" FT /translation="MLKITLIAACAENLCIGAGNAMPWHIPEDFAFFKAYTLGKPVIMG FT RKTWESLPVKPLPGRRNIVISRQADYCAAGAETAASLEAALALCAGAEEAVIMGGAQIY FT GQAMPLATDLRITEVDLSVEGDAFFPAIDRTHWKEAERTERRVSSKGTRYAFVHYLRY" XX SQ Sequence 489 BP; 119 A; 119 C; 152 G; 99 T; 0 other; 539083462 CRC32; atgctcaaaa taaccctaat tgcggcgtgt gcggaaaacc tgtgcatcgg ggcgggcaat 60 gctatgcctt ggcacatccc cgaagatttc gcatttttca aagcctatac cttgggcaaa 120 cccgtcatta tggggcggaa aacgtgggaa tccctgcccg tcaaacccct gcccggacgg 180 aggaacatcg tcatcagccg gcaggcggat tattgcgcgg caggcgcgga aacggcggca 240 agtttggagg cggcattggc attgtgcgca ggcgcggaag aagccgtcat tatgggcggc 300 gcgcagatat acggacaagc gatgccattg gcgaccgatt tgcggataac cgaagtggat 360 ttgtctgtgg aaggagatgc atttttcccc gcaatagacc ggacgcattg gaaagaagca 420 gagcggacgg aacgccgtgt cagcagcaaa ggcacgcgct atgcttttgt gcattatttg 480 agatattga 489 // ![]() |