![]() |
EBI DbfetchID AAB85216; SV 1; linear; genomic DNA; STD; PRO; 456 BP. XX PA AE000666.1 XX DE Methanothermobacter thermautotrophicus str. Delta H transcriptional DE regulator XX OS Methanothermobacter thermautotrophicus str. Delta H OC Archaea; Euryarchaeota; Methanobacteria; Methanobacteriales; OC Methanobacteriaceae; Methanothermobacter. OX NCBI_TaxID=187420; XX FH Key Location/Qualifiers FH FT source 1..456 FT /organism="Methanothermobacter thermautotrophicus str. FT Delta H" FT /strain="Delta H" FT /mol_type="genomic DNA" FT /clone="MTH" FT CDS AE000666.1:634220..634675 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="MTH_711" FT /product="transcriptional regulator" FT /note="Function Code:10.02 - Metabolism of Macromolecules, FT Transcription--mRNA synthesis and modification (includes FT regulators); similar to, gp:GI:e266415:g1550715, FT p()=5.8E-38, pid=49%" FT /db_xref="GOA:O26807" FT /db_xref="InterPro:IPR002579" FT /db_xref="PDB:2K8D" FT /db_xref="UniProtKB/Swiss-Prot:O26807" FT /func_characterised="identical sequence" FT /protein_id="AAB85216.1" FT /translation="MKDRIPIFSVAKNRVEMVERIELSDDEWREILDPEAFRVARKAGT FT EPPFTGKYHDLHDDGIYRCICCGTDLFDSETKFDSGTGWPSFYDVVSEHNIKLREDRSL FT GMVRCEVLCARCDAHLGHVFDDGPRPTGKRYCMNSAALKFIPRDQIG" XX SQ Sequence 456 BP; 125 A; 106 C; 127 G; 98 T; 0 other; 3698160831 CRC32; atgaaagaca ggatcccgat attctctgtt gcaaaaaacc gtgttgaaat ggttgagagg 60 attgaactct cagatgatga gtggcgggag atacttgacc ccgaagcctt ccgtgttgca 120 aggaaagccg gcacagagcc accattcaca ggtaaatatc atgacctcca cgatgacggc 180 atataccgct gcatatgctg tggtacagac ctctttgact cagaaaccaa attcgattca 240 gggacaggat ggccgagctt ctatgatgtg gtatcagaac acaacattaa actgagggag 300 gatcgcagcc tcgggatggt acgctgtgag gtcctctgtg caaggtgcga cgcccacctt 360 ggccatgtat tcgatgatgg tcccaggccc acagggaaga ggtactgcat gaactcagcg 420 gcactgaagt tcatcccgag ggatcagata gggtga 456 // ![]() |