![]() |
EBI DbfetchID AAA53141; SV 1; linear; genomic DNA; STD; PLN; 297 BP. XX PA U08846.1 XX DE Glycine max (soybean) partial 3-methylcrotonyl-CoA carboxylase precursor, DE biotin-carboxylase domain XX OS Glycine max (soybean) OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids; OC eurosids I; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine. OX NCBI_TaxID=3847; XX FH Key Location/Qualifiers FH FT source 1..297 FT /organism="Glycine max" FT /strain="Corsoy 79" FT /mol_type="genomic DNA" FT /clone_lib="genomic library by J.L. Slightom in the vector FT Charon 34." FT /clone="pSMS" FT CDS U08846.1:352..>648 FT /codon_start=1 FT /product="3-methylcrotonyl-CoA carboxylase precursor, FT biotin-carboxylase domain" FT /EC_number="6.4.1.4" FT /note="biotinylated subunit; the carboxy-terminal portion FT of this protein, deduced from the mRNA, can be found in FT GenBank Accession Number U08469" FT /db_xref="GOA:Q42777" FT /db_xref="HSSP:1BNC" FT /db_xref="InterPro:IPR013817" FT /db_xref="UniProtKB/Swiss-Prot:Q42777" FT /func_characterised="similar sequence" FT /protein_id="AAA53141.1" FT /translation="MASLALLRRTTLSHSHVRARAFSEGKSSNRHRIEKILVANRGEIA FT CRITRTARRLGIQTVAVYSDADKDSLHVASADKAIRIGPPPARLSYLNGASIVD" XX SQ Sequence 297 BP; 64 A; 102 C; 83 G; 48 T; 0 other; 4227709364 CRC32; atggcttctc tggcgttgct ccgcagaacc acgctctccc actcgcacgt gcgtgcacga 60 gccttctctg aggggaagag cagcaacaga caccgcatcg agaagattct agtagccaac 120 cgcggcgaaa tcgcttgcag gatcacgagg accgcgcgga ggctcggcat tcaaaccgtc 180 gccgtttaca gcgacgccga caaggactcg ctccacgttg cgtccgccga caaggccatc 240 cgaatcggac cgccaccggc gcggctcagt tacttgaacg gagcctccat cgtcgac 297 // ![]() |