spacer
spacer
EBIDatabasesDatabase BrowsingDbfetch

EBI Dbfetch

ID   EU176233; SV 1; linear; other DNA; STD; SYN; 1024 BP.
XX
AC   EU176233;
XX
DT   11-OCT-2007 (Rel. 93, Created)
DT   11-OCT-2007 (Rel. 93, Last updated, Version 1)
XX
DE   Synthetic construct Homo sapiens clone IMAGE:100006583; FLH263906.01X;
DE   RZPDo839B03246D FK506 binding protein 6, 36kDa (FKBP6) gene, encodes
DE   complete protein.
XX
KW   FLEXGene; Full-length ORF with stop codon; Gateway cloning system;
KW   Human ORF project; ORFeome collaboration.
XX
OS   synthetic construct
OC   other sequences; artificial sequences.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1024
RA   Rolfs A., Kelley F., McCarron S., Jepson D., Shen B., Shi Z., Hu Y.,
RA   Taycher E., Zuo D., Ebert L., Hoerlein A., Ernst U., Korn B., LaBaer J.;
RT   "Cloning of human full-length CDS FLEXGene in Gateway recombinational
RT   vector system";
RL   Unpublished.
XX
RN   [2]
RP   1-1024
RA   Rolfs A., Kelley F., McCarron S., Jepson D., Shen B., Shi Z., Hu Y.,
RA   Taycher E., Zuo D., Ebert L., Hoerlein A., Ernst U., Korn B., LaBaer J.;
RT   ;
RL   Submitted (24-SEP-2007) to the EMBL/GenBank/DDBJ databases.
RL   Department of Biological Chemistry and Molecular Pharmacology, Harvard
RL   Institute of Proteomics, 320 Charles Street, Cambridge, MA 02141, USA
XX
CC   This clone is part of the international ORFeome Collaboration
CC   (http://www.orfeomecollaboration.org/). It is part of a collection
CC   of human full-length ORF clones generated and verified by Harvard
CC   Institute of Proteomics (HIP) and Deutsches Ressourcenzentrum fuer
CC   Genomforschung GmbH (RZPD, Germany). This ORF clone has been cloned
CC   with normalized stop-codon (tag). AttB recombination sites have
CC   been added to either end of the ORF and directionally cloned using
CC   the Gateway cloning system into pDONR221. Additional sequences in
CC   the clone: 'ACC' before the 'ATG' (corresponding to Kozak consensus
CC   sequences).  Each clone is clonally isolated and full-length
CC   sequence-verified. This clone is available for distribution at HIP
CC   (http://plasmid.hms.harvard.edu/) and RZPD (http://www.rzpd.de/).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1024
FT                   /organism="synthetic construct"
FT                   /focus
FT                   /mol_type="other DNA"
FT                   /clone_lib="HIP_Gateway221_closed"
FT                   /clone="IMAGE:100006583; FLH263906.01X; RZPDo839B03246D"
FT                   /note="Vector: pDONR221; derived from parent clone
FT                   IMAGE:5744865 (accession BC036817.1)"
FT                   /db_xref="taxon:32630"
FT   source          23..1006
FT                   /organism="Homo sapiens"
FT                   /mol_type="other DNA"
FT                   /db_xref="taxon:9606"
FT   misc_feature    1..17
FT                   /note="attL1 site"
FT   misc_feature    18..22
FT                   /note="linker at the 5' end of the ORF that includes ACC
FT                   for minimal Kozak consensus"
FT   gene            23..1006
FT                   /gene="FKBP6"
FT   CDS             23..1006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FKBP6"
FT                   /product="FK506 binding protein 6, 36kDa"
FT                   /note="normalized stop codon"
FT                   /protein_id="ABW03684.1"
FT                   /translation="MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIRE
FT                   GAGDLVAPDASVLVKYSGYLEHMDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRR
FT                   GELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELLDFLDCAESDKFCALSAEQQDQFP
FT                   LQKVLKVAATEREFGNYLFRQNRFYDAKVRYKRALLLLRRRSAPPEEQHLVEAAKLPVL
FT                   LNLSFTYLKLDRPTIALCYGEQALIIDQKNAKALFRCGQACLLLTEYQKARDFLVRAQK
FT                   EQPFNHDINNELKKLASCYRDYVDKEKEMWHRMFAPCGDGSTAGES"
FT   misc_feature    1004..1007
FT                   /note="linker at the 3' end of the ORF that includes
FT                   normalized stop codon TAG"
FT   misc_feature    1008..1024
FT                   /note="attL2 site"
XX
SQ   Sequence 1024 BP; 253 A; 259 C; 284 G; 228 T; 0 other;
     gtacaaaaaa gcaggctcca ccatgggggg aagcgcgtta aaccagggag tcctggaagg        60
     ggacgacgcc cccggccagt ccctgtacga gcggttaagt cagaggatgc tggacatctc       120
     gggggaccgg ggcgtgctga aggacgtcat ccgagaagga gctggagacc tagtggcgcc       180
     tgatgcttcg gtgctagtga aatactcggg atacctggaa cacatggaca gacccttcga       240
     ttctaattac tttaggaaaa ctcctcggct aatgaaactt ggagaggata ttacactgtg       300
     gggcatggag ctgggccttc tgagcatgcg gagaggagag ctggccaggt ttctgttcaa       360
     accgaactac gcctatggaa cgctgggctg ccctcccttg atccccccaa acaccactgt       420
     cctgtttgag attgagctgc ttgacttcct ggactgtgct gagtcagaca agttttgtgc       480
     tctctcagct gagcagcaag accaatttcc acttcagaag gtcctgaaag tggcagctac       540
     ggaacgggag tttggcaact accttttccg ccagaatcgt ttctatgatg ccaaagtgag       600
     atataaaagg gccctgttgc ttctgcgccg gcgatcagca ccccctgaag agcagcacct       660
     ggtggaggcc gccaagcttc ctgttctcct gaacctgtcc tttacatacc tgaagctaga       720
     ccgacccacc atagccctgt gctatggaga gcaggctttg atcattgacc aaaagaatgc       780
     caaggccctc ttcaggtgtg gacaggcttg tcttctcctg actgagtatc aaaaggcccg       840
     ggattttcta gttcgagccc agaaggagca acccttcaat catgacatca ataatgagct       900
     gaagaaactg gctagctgtt acagggacta tgtggataaa gagaaagaaa tgtggcaccg       960
     catgttcgcg ccctgtggcg atggttctac agcaggagaa agttaggacc cagctttctt      1020
     gtac                                                                   1024
//
spacer
spacer