EBI Dbfetch
ID AY036464; SV 1; linear; genomic DNA; STD; VRL; 297 BP.
XX
AC AY036464;
XX
DT 16-AUG-2001 (Rel. 68, Created)
DT 16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE HIV-1 isolate NL4-3 resting pha 12hrs clone 2 from USA protease (pol) gene,
DE partial cds.
XX
KW .
XX
OS Human immunodeficiency virus 1
OC Viruses; Retro-transcribing viruses; Retroviridae; Orthoretrovirinae;
OC Lentivirus; Primate lentivirus group.
XX
RN [1]
RP 1-297
RX DOI; 10.1128/JVI.75.17.7973-7986.2001.
RX PUBMED; 11483742.
RA Janini M., Rogers M., Birx D.R., McCutchan F.E.;
RT "Human immunodeficiency virus type 1 DNA sequences genetically damaged by
RT hypermutation are often abundant in patient peripheral blood mononuclear
RT cells and may be generated during near-simultaneous infection and
RT activation of CD4(+) T cells";
RL J. Virol. 75(17):7973-7986(2001).
XX
RN [2]
RP 1-297
RA Janini M., Rogers M., Birx D.R., McCutchan F.E.;
RT ;
RL Submitted (16-MAY-2001) to the EMBL/GenBank/DDBJ databases.
RL Retrovirology, Henry M. Jackson Foundation, 1 Taft Court, Rockville, MD
RL 20850, USA
XX
FH Key Location/Qualifiers
FH
FT source 1..297
FT /organism="Human immunodeficiency virus 1"
FT /isolate="NL4-3 resting pha 12hrs"
FT /mol_type="genomic DNA"
FT /country="USA"
FT /clone="2"
FT /proviral
FT /note="in vitro virus propagation; sequences obtained after
FT HIV-1 infection of unstimulated CD4+ T-cells using cloned
FT NL4-3 virus stocks; cells were PHA stimulated 24 hours
FT after the 2 hour infection period; cells were collected 6,
FT 12, 24, 48, 72 hours after activation"
FT /db_xref="taxon:11676"
FT CDS <1..>297
FT /codon_start=1
FT /gene="pol"
FT /product="protease"
FT /db_xref="GOA:Q90EE8"
FT /db_xref="HSSP:1PRO"
FT /db_xref="InterPro:IPR001969"
FT /db_xref="InterPro:IPR001995"
FT /db_xref="InterPro:IPR009007"
FT /db_xref="InterPro:IPR018061"
FT /db_xref="UniProtKB/TrEMBL:Q90EE8"
FT /protein_id="AAK67562.1"
FT /translation="PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPK
FT MIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF"
XX
SQ Sequence 297 BP; 109 A; 48 C; 66 G; 74 T; 0 other;
cctcaaatca ctctttggca acgacccctc gtcacaataa agataggggg gcaattaaag 60
gaagctctat tagatacagg agcagatgat acagtattag aagaaatgaa tttgccagga 120
agatggaaac caaaaatgat agggggaatt ggaggtttta tcaaagtaag acagtatgat 180
cagatactca tagaaatctg cggacataaa gctataggta cagtattagt aggacctaca 240
cctgtcaaca taattggaag aaatctgttg actcagattg gctgcacttt aaatttt 297
//
 |