![]() |
EBI DbfetchID AL111168; SV 1; circular; genomic DNA; STD; PRO; 1641481 BP. XX AC AL111168; AL139074-AL139079; XX PR Project:8; XX DT 14-AUG-2006 (Rel. 88, Created) DT 13-MAY-2009 (Rel. 100, Last updated, Version 6) XX DE Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome. XX KW complete genome. XX OS Campylobacter jejuni subsp. jejuni NCTC 11168 OC Bacteria; Proteobacteria; Epsilonproteobacteria; Campylobacterales; OC Campylobacteraceae; Campylobacter. XX RN [1] RX DOI; 10.1038/35001088 RX PUBMED; 10688204. RA Parkhill J., Wren B.W., Mungall K., Ketley J.M., Churcher C., Basham D., RA Chillingworth T., Davies R.M., Feltwell T., Holroyd S., Jagels K., RA Karlyshev A., Moule S., Pallen M.J., Penn C.W., Quail M., Rajandream M.A., RA Rutherford K.M., VanVliet A., Whitehead S., Barrell B.G.; RT "The genome sequence of the food-borne pathogen Campylobacter jejuni RT reveals hypervariable sequences"; RL Nature 403(6770):665-668(2000). XX RN [2] RC revised by [4] RP 1-1641481 RA Parkhill J.; RT ; RL Submitted (09-FEB-2000) to the EMBL/GenBank/DDBJ databases. RL Submitted on behalf of the Campylobacter sequencing team, Sanger Centre, RL Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA E-mail: RL parkhill@sanger.ac.uk XX RN [3] RX DOI; 10.1186/1471-2164-8-162 RX PUBMED; 17565669. RA Gundogdu O., Bentley S.D., Holden M.T., Parkhill J., Dorrell N., Wren B.W.; RT "Re-annotation and re-analysis of the Campylobacter jejuni NCTC11168 genome RT sequence"; RL BMC Genomics 8:162-162(2007). XX RN [4] RP 1-1641481 RA Gundogdu O.; RT ; RL Submitted (07-AUG-2006) to the EMBL/GenBank/DDBJ databases. RL Submitted on behalf of the Campylobacter sequencing team, Sanger Centre, RL Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA. In Collaboration RL with the Pathogen Molecular Biology Department at The London School of RL Hygiene & Tropical Medicine, London, Keppel Street, WC1E 7HT. RL E-mail:ozan.gundogdu@lshtm.ac.uk XX DR GR; AL111168_GR. DR RFAM; RF01118; PK-G12rRNA. DR SILVA-LSU; AL111168. DR SILVA-SSU; AL111168. DR Sample; ERS000062. XX CC Notes: CC Details of C. jejuni sequencing at the Sanger Centre CC are available on the World Wide Web. CC (URL, http://www.sanger.ac.uk/Projects/C_jejuni/) XX FH Key Location/Qualifiers FH FT source 1..1641481 FT /organism="Campylobacter jejuni subsp. jejuni NCTC 11168" FT /sub_species="jejuni" FT /strain="NCTC 11168" FT /mol_type="genomic DNA" FT /db_xref="taxon:192222" FT CDS 1..1323 FT /transl_table=11 FT /gene="dnaA" FT /locus_tag="Cj0001" FT /product="chromosomal replication initiator protein" FT /note="Original (2000) note: Cj0001, dnaA, probable FT chromosomal replication initiator protein, len: 440 aa; FT similar to many e.g. DNAA_ECOLI (467 aa), fasta scores; FT opt: 839 z-score: 949.6 E(): 0, 32.3% identity in 470 aa FT overlap. 39.9% identity to HP1529. Contains PS00017 FT ATP/GTP-binding site motif A (P-loop) and Pfam match to FT entry PF00308 bac_dnaA, Bacterial dnaA protein, score FT 419.90, E-value 4e-141" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with marginal identity score. Appropriate FT motifs present. Putative not added to product function. FT Functional classification - DNA FT replication,restriction/modification, recombination and FT repair" FT /note="PMID:6234204, PMID:9417934, PMID:160000" FT /db_xref="GOA:Q9PJB0" FT /db_xref="HSSP:1L8Q" FT /db_xref="InterPro:IPR013317" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJB0" FT /inference="protein motif:Pfam:PF00308" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34182.1" FT /translation="MNPSQILENLKKELSENEYENYLSNLKFNEKQSKADLLVFNAPNE FT LMAKFIQTKYGKKIAHFYEVQSGNKAIINIQAQSAKQSNKSTKIDIAHIKAQSTILNPS FT FTFESFVVGDSNKYAYGACKAIAHKDKLGKLYNPIFVYGPTGLGKTHLLQAVGNASLEM FT GKKVIYATSENFINDFTSNLKNGSLDKFHEKYRNCDVLLIDDVQFLGKTDKIQEEFFFI FT FNEIKNNDGQIIMTSDNPPNMLKGITERLKSRFAHGIIADITPPQLDTKIAIIRKKCEF FT NDINLSNDIINYIATSLGDNIREIEGIIISLNAYATILGQEITLELAKSVMKDHIKEKK FT ENITIDDILSLVCKEFNIKPSDVKSNKKTQNIVTARRIVIYLARALTALTMPQLANYFE FT MKDHTAISHNVKKITEMIENDASLKAKIEELKNKILVKSQS" FT misc_feature 301..1239 FT /note="HMMPfam hit to PF00308, Bacterial dnaA protein,score FT 4.2e-124" FT /inference="protein motif:Pfam:PF00308" FT misc_feature 427..450 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 1483..2550 FT /transl_table=11 FT /gene="dnaN" FT /locus_tag="Cj0002" FT /product="DNA polymerase III, beta chain" FT /EC_number="2.7.7.7" FT /note="Original (2000) note: Cj0002, dnaN, probable DNA FT polymerase III, beta chain, len: 355 aa; similar to e.g. FT DP3B_ECOLI DNA polymerase III, beta chain (EC 2.7.7.7) (366 FT aa), fasta scores; opt: 349 z-score: 372.3 E(): 1.7e-13, FT 19.6% identity in 367 aa overlap. 34.2% identity to HP0500. FT Contains Pfam match to entry PF00712 DNA_pol3_beta, DNA FT polymerase III beta subunit, score 119.80, E-value 5.2e-32" FT /note="Updated (2006) note: Characterised within FT Escherichia coli, however, identity score was marginal. FT Alignment matched full sequence length and appropriate FT motifs were present. Thus, putative not added to product FT function. Functional classification - DNA FT replication,restriction/modification, recombination and FT repair" FT /note="PMID:6234204, PMID:12832762, PMID:1575709" FT /db_xref="GOA:Q0PCC3" FT /db_xref="InterPro:IPR001001" FT /db_xref="UniProtKB/TrEMBL:Q0PCC3" FT /inference="protein motif:Pfam:PF00712" FT /protein_id="CAL34183.1" FT /translation="MKLSINKNTLESAVILCNAYVEKKDSSTITSHLFFHADEDKLLIK FT ASDYEIGINYKIKKIRVESSGFATANAKSIADVIKSLNNEEVVLETIDNFLFVRQKSTK FT YKLPMFNHEDFPNFPNTEGKNQFDIDSSDLSRSLKKILPSIDTNNPKYSLNGAFLDIKT FT DKINFVGTDTKRLAIYTLEKANNQEFSFSIPKKAIMEMQKLFYEKIEIFYDQNMLIAKN FT ENFEFFTKLINDKFPDYEKVIPKTFKQELSFSTEDFIDSLKKISVVTEKMRLHFNKDKI FT IFEGISLDNMEAKTELEIQTGVSEEFNLTIKIKHLLDFLTSIEEEKFTLSVNEPNSAFI FT VKSQGLSMIIMPMIL" FT misc_feature 1483..1839 FT /note="HMMPfam hit to PF00712, DNA polymerase III beta FT subunit, N-te, score 1.9e-11" FT /inference="protein motif:Pfam:PF00712" FT misc_feature 1864..2196 FT /note="HMMPfam hit to PF02767, DNA polymerase III beta FT subunit, cent, score 4e-11" FT /inference="protein motif:Pfam:PF02767" FT misc_feature 2200..2544 FT /note="HMMPfam hit to PF02768, DNA polymerase III beta FT subunit, C-te, score 2.7e-05" FT /inference="protein motif:Pfam:PF02768" FT CDS 2579..4888 FT /transl_table=11 FT /gene="gyrB" FT /locus_tag="Cj0003" FT /product="DNA gyrase subunit B" FT /EC_number="5.99.1.3" FT /note="Original (2000) note: Cj0003, gyrB, probable DNA FT gyrase subunit B, len: 769 aa; similar to many e.g. FT GYRB_BACSU DNA gyrase subunit B (EC 5.99.1.3) (638 FT aa),fasta scores; opt: 2130 z-score: 3165.8 E(): 0, 47.7% FT identity in 773 aa overlap. 61.2% identity to HP0501. FT Contains PS00177 DNA topoisomerase II signature and Pfam FT matches to entry PF00204 DNA_topoisoII, DNA topoisomerase FT II (N-terminal region), score 915.20, E-value 1.9e-271,and FT to entry PF00986 DNA_gyraseB_C, DNA gyrase B FT subunit,carboxyl terminus, score 154.00, E-value 2.6e-42" FT /note="Updated (2006) note: Characterised within FT Escherichia coli and Bacillus subtilis with acceptable FT identity scores. Thus, putative not added to product FT function. Functional classification - DNA FT replication,restriction/modification, recombination and FT repair" FT /note="PMID:160000, PMID:9817874, PMID:2987847" FT /db_xref="GOA:O87667" FT /db_xref="HSSP:1AJ6" FT /db_xref="InterPro:IPR006171" FT /db_xref="UniProtKB/Swiss-Prot:O87667" FT /inference="protein motif:Pfam:PF00986" FT /inference="protein motif:Pfam:PF00204" FT /inference="protein motif:Prosite:PS00177" FT /protein_id="CAL34184.1" FT /translation="MQENYGASNIKVLKGLEAVRKRPGMYIGDTNIGGLHHMIYEVVDN FT SIDEAMAGHCDTIDVEITTEGSCIVSDNGRGIPVDMHPTENMPTLTVVLTVLHAGGKFD FT KDTYKVSGGLHGVGVSVVNALSKKLVATVERNGEIYRQEFSEGKVISEFGVIGKSKKTG FT TTIEFWPDDQIFEVTEFDYEILAKRFRELAYLNPKITINFKDNRVGKHESFHFEGGISQ FT FVTDLNKKEALTKAIFFSVDEEDVNVEVALLYNDTYSENLLSFVNNIKTPDGGTHEAGF FT RMGLTRVISNYIEANASAREKDNKITGDDVREGLIAIVSVKVPEPQFEGQTKGKLGSTY FT VRPIVSKASFEYLTKYFEENPIEAKAIMNKALMAARGREAAKKARELTRKKESLSVGTL FT PGKLADCQSKDPSESEIYLVEGDSAGGSAKQGRERSFQAILPLRGKILNVEKARLDKIL FT KSEQIQNMITAFGCGIGEDFDLSKLRYHKIIIMTDADVDGSHIQTLLLTFFFRFMNELV FT ANGHIYLAQPPLYLYKKAKKQIYLKDEKALSEYLIETGIEGLNYEGIGMNDLKDYLKIV FT AAYRAILKDLEKRFNVISVIRYMIENSNLVKGNNEELFSVIKQFLETQGHNILNHYINE FT NEIRAFVQTQNGLEELVINEELFTHPLYEEASYIFDKIKDRSLEFDKDILEVLEDVETN FT AKKGATIQRYKGLGEMNPEQLWETTMDPSVRRLLKITIEDAQSANDTFNLFMGDEVEPR FT RDYIQAHAKDVKHLDV" FT misc_feature 2666..3097 FT /note="HMMPfam hit to PF02518, Histidine kinase-, DNA FT gyrase B-, and H, score 1.1e-30" FT /inference="protein motif:Pfam:PF02518" FT misc_feature 3233..3739 FT /note="HMMPfam hit to PF00204, DNA gyrase B, score 6.7e-81" FT /inference="protein motif:Pfam:PF00204" FT misc_feature 3818..4153 FT /note="HMMPfam hit to PF01751, Toprim domain, score 1e-08" FT /inference="protein motif:Pfam:PF01751" FT misc_feature 3830..3856 FT /note="PS00177 DNA topoisomerase II signature" FT /inference="protein motif:Prosite:PS00177" FT misc_feature 3962..3994 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 4652..4852 FT /note="HMMPfam hit to PF00986, DNA gyrase B FT subunit,carboxyl terminus, score 3.1e-43" FT /inference="protein motif:Pfam:PF00986" FT CDS complement(4916..5257) FT /transl_table=11 FT /locus_tag="Cj0004c" FT /product="monohaem cytochrome C" FT /note="Original (2000) note: Cj0004c, possible periplasmic FT protein, len: 113 aa. No Hp match. Contains possible FT N-terminal signal sequence" FT /note="Updated (2006) note: NCTC11168 Cj0004c encodes a FT monohaem cytochrome C (PMID:15632441). Together with Cj0005 FT (molybdopterin oxidoreductase), they are homologous to FT sulphite:cytochrome C oxidoreductase (SOR) of Starkeya FT novella (PMID:11557133). Cj0004 mutants showed wild-type FT rates of formate-dependent respiration but were unable to FT respire with sulphite or metabisulphite as electron donors. FT Periplasmic extracts of wild-type NCTC11168 showed a FT symmetrical absorption peak (552nm) after addition of FT sulphite, demonstrating the reduction of cytochrome C. No FT cytochrome C reduction was observed after addition of FT sulphite to periplasmic extracts of the Cj0004c mutant FT (PMID:15632441). Characterised within Campylobacter jejuni, FT so putative not added to product function. Functional FT classification - Energy metabolism -Respiration - Electron FT transport" FT /note="PMID:15632441" FT /db_xref="GOA:Q0PCC1" FT /db_xref="UniProtKB/TrEMBL:Q0PCC1" FT /protein_id="CAL34185.1" FT /translation="MKKIILILALFLSASWAQNLEINPDTGLIIDPDSPLVEANCLACH FT GSNLITNMHASRKAWLAAIRWMQDSEGLWEIEPEDEEKILNYLEKYYGEKYDTRRRIPL FT AILLQNKTH" FT misc_feature complement(5120..5137) FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT sig_peptide complement(5207..5257) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000000_4916_5257 by SignalP 2.0 HMM FT (Signal peptide probability 0.973) with cleavage site FT probability 0.940 between residues 17 and 18" FT CDS complement(5260..6498) FT /transl_table=11 FT /locus_tag="Cj0005c" FT /product="molydopterin containing oxidoreductase" FT /note="Original (2000) note: Cj0005c, possible molybdenum FT containing oxidoreductase, len: 412 aa; similar to many FT eukaryotic oxidoreductases e.g. SUOX_HUMAN sulfite oxidase FT precursor (488 aa), fasta scores; opt: 543 z-score: 338.2 FT E(): 1.4e-11, 29.8% identity in 372 aa overlap and FT NIA_PETHY nitrate reductase from Petunia hybrida (909 FT aa),fasta scores; opt: 281 z-score: 312.5 E(): 3.8e-10, FT 28.9% identity in 395 aa overlap. No Hp match. Contains FT Pfam match to entry PF00174 oxidored_molyb, Oxidoreductase FT molybdopterin binding domain, score 45.20, E-value 1e-12" FT /note="Updated (2006) note: Pfam domain PF03404 Mo-co FT oxidoreductase dimerisation domain identified within CDS. FT One probable transmembrane helix predicted by TMHMM2.0. FT Further support given to product function. Supporting paper FT identified showing interaction with Cj0004c FT (PMID:15632441). Product function modified to more specific FT family member based on characterisation paper. Functional FT classification - Misc" FT /note="PMID:15632441" FT /db_xref="GOA:Q0PCC0" FT /db_xref="InterPro:IPR017909" FT /db_xref="UniProtKB/TrEMBL:Q0PCC0" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF03404" FT /inference="protein motif:Pfam:PF00174" FT /protein_id="CAL34186.1" FT /translation="MKQNDQKENRRDFLKNIGLGLFGISVLSNFSFENFLGSKALAKEL FT PDFKIEGKKDLIYHGEKPLTAETEIYALDSDFTKPENFFVRNNGLPPSLETIKERLHKG FT WTLEIDGESIINKKSYTIEDLKKKFKTYTYALTVECGGNGRSEVIPSTKGTQWGYGAVA FT CGRWTGVRLKDILKDCGIKNDAVYIGYYGIDTKLNGEETSPISRGVPISKALQDETLIA FT WAYEGKDIPLVNGYPLRLVCGGYPASTSGKWLYKISVRNKIHDGEKMEGSYKVPVNPVK FT PGDFNYKGEMKIIESMPIRSVITNIKNGSEIKANKKFEVRGKAWAGELEVSEVYVSNDY FT GVTWTKAKVEKPLNRLAWQKWSAQISIPTKGYYEIWARAIDSQGNSQPMVLAQWNPGGY FT INNACHRVNVYGV" FT misc_feature complement(5263..5628) FT /note="HMMPfam hit to PF03404, Mo-co oxidoreductase FT dimerisation doma, score 6.8e-19" FT /inference="protein motif:Pfam:PF03404" FT misc_feature complement(5707..6375) FT /note="HMMPfam hit to PF00174, Oxidoreductase molybdopterin FT binding d, score 2.1e-14" FT /inference="protein motif:Pfam:PF00174" FT misc_feature complement(6007..6039) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT sig_peptide complement(6373..6498) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000001_5260_6498 by SignalP 2.0 HMM FT (Signal peptide probability 0.861) with cleavage site FT probability 0.853 between residues 42 and 43" FT misc_feature complement(6403..6462) FT /note="1 probable transmembrane helix predicted for Cj0005c FT by TMHMM2.0 at aa 13-32" FT /inference="protein motif:TMHMM:2.0" FT CDS 6703..8010 FT /transl_table=11 FT /locus_tag="Cj0006" FT /product="putative Na+/H+ antiporter family protein" FT /note="Original (2000) note: Cj0006, probable integral FT membrane protein, len: 435 aa; similar to e.g. Y325_HAEIN FT hypothetical protein HI0325 (450 aa), fasta scores; opt: FT 757 z-score: 1654.9 E(): 0, 44.0% identity in 450 aa FT overlap. 47.2% identity to HP0758" FT /note="Updated (2006) note: Pfam domain PF03553 Na+/H+ FT antiporter family identified within CDS. Product modified FT to more specific family member due to motif match. FT Also,eleven probable transmembrane helices predicted by FT TMHMM2.0 giving further support to product function. No FT specific characterisation with acceptable identity score FT has been carried out yet. Thus, putative kept within FT product function. Functional classification FT -Transport/binding proteins - Cations" FT /db_xref="GOA:Q0PCB9" FT /db_xref="InterPro:IPR018461" FT /db_xref="UniProtKB/TrEMBL:Q0PCB9" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF03553" FT /protein_id="CAL34187.1" FT /translation="MILTLLTNPIIISVVLMTLLCLFRFNVLLSLLISALVAGVFSHLE FT LVDTMNILISGMKENLKTALSYILLGAIAAAISKTNLTAYLIKIVSHFISHKKYLLLLS FT IALISCFSQNLIPIHVAFIPLLIPPLLSLFNKLKIDRRAVACALTFGLTTPYMVLPVGF FT GLTFQDLLKDNLNANNVSASLNDVTNTMYFAAICMIAGLFLALFVFYRKPREYQEVEIA FT KVDLENLEMTRKEWGVLAGLVLTLILQILTMNLPLSGLLGFVLMVILGGVEFSKVNEVF FT DDGLKMMGFIAFVILVAAGYGEVLKESGSVVDLVNSVVPWMEQSKFLAVFFMLLIGLII FT TMGIGTSFGTIPIIATLFCPICLELGFSTALIIFILGVAGALGDAGSPASETTMGTTVG FT LNADKQHDHIKDTCIPTFIFYNGPLLILGSIIAMFL" FT sig_peptide 6703..6813 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000002_6703_8010 by SignalP 2.0 HMM FT (Signal peptide probability 0.887) with cleavage site FT probability 0.659 between residues 37 and 38" FT misc_feature order(6730..6834,6895..6963,7045..7104,7138..7206, FT 7264..7332,7408..7461,7471..7527,7564..7617,7681..7749, FT 7783..7851,7936..8004) FT /note="11 probable transmembrane helices predicted for FT Cj0006 by TMHMM2.0 at aa 10-44, 65-87, 115-134, FT 146-168,188-210, 236-253, 257-275, 288-305, 327-349, FT 361-383 and 412-434" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 7000..7032 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 7141..7989 FT /note="HMMPfam hit to PF03553, Na+/H+ antiporter FT family,score 4.4e-90" FT /inference="protein motif:Pfam:PF03553" FT CDS 8144..12634 FT /transl_table=11 FT /gene="gltB" FT /locus_tag="Cj0007" FT /product="glutamate synthase (NADPH) large subunit" FT /EC_number="1.4.1.13" FT /note="Original (2000) note: Cj0007, gltB, probable FT glutamate synthase (NADPH) large subunit, len: 1496 aa; FT similar to many e.g. GLTB_ECOLI glutamate synthase (NADPH) FT large chain (1517 aa), fasta scores; opt: 3846 z-score: FT 3828.3 E(): 0, 42.5% identity in 1488 aa overlap. No Hp FT match" FT /note="Updated (2006) note: Pfam domains PF00310 Glutamine FT amidotransferases class-II, PF04898 Glutamate synthase FT central domain, PF01645 Conserved region in glutamate FT synthase and PF01493 GXGXG motif were all identified within FT CDS. Further support given to product function. FT Characterised within Bacillus subtilis with acceptable FT identity score. Thus, putative not added to product FT function. Functional classification - Central intermediary FT metabolism - General" FT /note="PMID:2548995, PMID:11029411" FT /db_xref="GOA:Q0PCB8" FT /db_xref="InterPro:IPR006982" FT /db_xref="UniProtKB/TrEMBL:Q0PCB8" FT /inference="protein motif:Pfam:PF01493" FT /inference="protein motif:Pfam:PF01645" FT /inference="protein motif:Pfam:PF04898" FT /inference="protein motif:Pfam:PF00310" FT /protein_id="CAL34188.1" FT /translation="MDLENILENNQSIGLYHPKNEHDACGIAAVANIRGIASYKVICDA FT LEILMNLEHRGGTGAEENSGDGAGILIQIPHDFFKTQELGFELPKKGDYAVAQMFLSPN FT TDAKEEAKEIFLQGLKDKKLEFLGFREVPFNPSDIGASALKAMPYFLQAFVKKPSKISA FT GLEFERVLYSTRRLIEKRAINVPKFYFSSFSSRTIVYKGMLLSTQLSDFYLDFKDVNMK FT SAIALVHSRFSTNTFPSWERAHPNRYMVHNGEINTIRGNVDSIRAREGLMQSEYFENLD FT EIFPIIAKLSSDSAMFDNTLEFLALNGRTLEEAFMMMVPEPWHKNENMESKKRAFYEYH FT SLLMEPWDGPAAIVFTDGVIMGASLDRNGFRPSRYYLTKDDMLILSSETGALKLDEKNI FT KAKKRLEPGKLLLVDTARGRVIADNEIKEHYANAKPYKKWLKNLVELEKQKSGVYKHQF FT LKEDEVLKLQKAFGWSYDELKMSVAAMAQNGKEAIAAMGVDTPLAILSKTYQPLYNYFK FT QLFAQVTNPPLDAIREEIVTSTRIYLGSEGNLLKPDENNAKRVKIALPVISNEELFEVK FT ALNKFQVKEFSILYDYSKKTLEKALDELCVKIEDEVKKGVSIIILSDKGVDEKNAYIPA FT LLAVSGVHNHLVRKNLRTHTSLIIESGEPREIHHFACLLGYGATVINPYLVYESIQKLI FT ANKDLNLSYEKAVENFIKASSSGIVKIASKMGVSTLQSYNGSALFECLGLSSKVIDKYF FT TSTTSRIEGMDLEDFEKELIALHKHAFNDTHKALDSKGIHGFRSAKEEHLIDPLVIFNL FT QQACRNKDYKSFKKYSALVDEKQVNLRSLMEFDFSEAISIDKVESVESIVKRFRTGAMS FT YGSISKEAHECLAQAMNKIGAKSNSGEGGEDEERYEIKEGVDKNSAIKQVASGRFGVDL FT NYLSHAKEIQIKVAQGAKPGEGGQLMGFKVYPWIAKARHSTAGVTLISPPPHHDIYSIE FT DLAQLIYDLKHANKDAKISVKLVSENGIGTVAAGVAKAGANLILVSGYDGGTGASPRTS FT IPHAGIPWELGLAETHQTLILNKLRDRVRLETDGKLMNGRDLAIAALLGAEEFGFATAP FT LIVLGCTMMRVCHLNTCPFGIATQDTELRDRFKGKVDDVINFMYFIAEELREYMARLGF FT ERLDDMIGRVDKLRQKSVQGKAGKLNLDKILKSLPTYNRTAVHFKDYKDNKLEKTIDYR FT ILLPLCKNAVEKKEPIKLSLEVGNQSRTFATMLSSEILKTYGKDALDEDSIHIKAIGNA FT GNSFGAFLLKGIKLEIIGDSNDYLGKGLSGGKIIAKISNEATFSPEENIIAGNACLYGA FT TKGEVYLDGIAGERFCVRNSGALAVVLGTGVHGCEYMTGGQVVVLGDVGANFAAGMSGG FT VVYIFGRHNEAHVNTELVDIKDLNAKDEKELKAVIEKHITYTDSKKAKDILEKFDKKDF FT FKVMPRDYEKMLKMLDLCKNEKDPNLAAFLKITQK" FT misc_feature 8216..9310 FT /note="HMMPfam hit to PF00310, Glutamine amidotransferases FT class-II, score 5.9e-222" FT /inference="protein motif:Pfam:PF00310" FT misc_feature 9533..10381 FT /note="HMMPfam hit to PF04898, Glutamate synthase central FT domain, score 1.8e-181" FT /inference="protein motif:Pfam:PF04898" FT misc_feature 10547..11644 FT /note="HMMPfam hit to PF01645, Conserved region in FT glutamate synthas, score 1e-224" FT /inference="protein motif:Pfam:PF01645" FT misc_feature 11450..11482 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 11870..12451 FT /note="HMMPfam hit to PF01493, GXGXG motif, score 4.1e-72" FT /inference="protein motif:Pfam:PF01493" FT misc_feature 11987..12043 FT /note="PS00095 C-5 cytosine-specific DNA methylases FT C-terminal signature" FT /inference="protein motif:Prosite:PS00095" FT CDS 12644..14395 FT /transl_table=11 FT /locus_tag="Cj0008" FT /product="conserved hypothetical protein Cj0008" FT /note="Original (2000) note: Cj0008, unknown, len: 583 aa; FT similar to Y686_METJA hypothetical protein MJ0686 (580 aa), FT fasta scores; opt: 171 z-score: 228.3 E(): 1.9e-05,22.8% FT identity in 609 aa overlap. 37.5% identity in N-term to FT HP0938, 30.0% identity in C-term to HP0937" FT /note="Updated (2006) note: Pfam PF03235 Protein of unknown FT function (DUF262), was present within CDS. Conserved added FT to product function as motif was identified. Functional FT classification - Conserved hypothetical proteins" FT /db_xref="InterPro:IPR004919" FT /db_xref="UniProtKB/TrEMBL:Q0PCB7" FT /inference="protein motif:Pfam:PF03235" FT /protein_id="CAL34189.1" FT /translation="MAGFQSPITINEAMQRIKNNEYLLPAFQREYVWEPWQIEELFDSL FT IRGYPISSMLFWKVKDESKTAWKFYRFLEYYRESYHTHNDYFNTSNHKDFYAILDGQQR FT LTSLYFALFGNYDIHRSYNKWENNDRYFKICHFYFNLTQSKKPENENIEYEFLWLDKLE FT TKEQNIYIDKYQQKWFKCQYLYQYDSGRVRKIAKEFNLNENEEDRLDLLHQKIFDKNLI FT NFYLEEEQDPDKAVNIFIRINSNGEPLDYSDILFSIAIANWNKIDARTEINNLVDKINE FT NFDISKDLILKGFLYLFHNNIKFQINSFDKNFIESIEAKWEGIKNAFIETFRLLRSFGF FT EAKTLSSNNAILPILYFIYHKNLTNNIVDSVKCNENRAIIKKWLLRAIILKPFGGSSDT FT VLSNMRKAFIKDFKQNSGFFDREIELFPLEEIEKEAKYIQTIDEEYLENNVIECRKNSP FT EAFAVLSLLYPNLDYKNNNFHKDHLHPESAYKEYEKLYKATDNCISFNIYDSLPNLQML FT DANENESKNNKPLKQWVNEKCNGNRKEFLGKHLIPDVDLSLENFNNFIEERKKIIIDKL FT KSILNKE" FT misc_feature 12668..13450 FT /note="HMMPfam hit to PF03235, Protein of unknown function FT DUF262, score 0.00029" FT /inference="protein motif:Pfam:PF03235" FT CDS 14398..15843 FT /transl_table=11 FT /gene="gltD" FT /locus_tag="Cj0009" FT /product="glutamate synthase (NADPH) small subunit" FT /EC_number="1.4.1.13" FT /note="Original (2000) note: Cj0009, gltD, probable FT glutamate synthase (NADPH) small subunit, len: 481 aa; FT similar to many e.g. GLTD_ECOLI glutamate synthase (NADPH) FT small chain (EC 1.4.1.13) (471 aa), fasta scores; opt: 807 FT z-score: 909.0 E(): 0, 33.0% identity in 482 aa overlap. No FT Hp match" FT /note="Updated (2006) note: Pfam domain PF00070 Pyridine FT nucleotide-disulphide oxidoreductase, PF07992 Pyridine FT nucleotide-disulphide oxidoreductase, PF03486 HI0933-like FT protein, PF01266 FAD dependent oxidoreductase, PF00890 FAD FT binding domain and PF01593 Flavin containing amine FT oxidoreductase were identified within CDS. All Pfam matches FT were identified by carrying out individual Pfam search. FT Further support given to product function. Characterised FT within Escherichia coli with acceptable identity score. FT Thus, putative not added to product function. Functional FT classification - Central intermediary metabolism - General" FT /note="PMID:10481090" FT /db_xref="GOA:Q0PCB6" FT /db_xref="InterPro:IPR006005" FT /db_xref="UniProtKB/TrEMBL:Q0PCB6" FT /inference="protein motif:Pfam:PF01593" FT /inference="protein motif:Pfam:PF00890" FT /inference="protein motif:Pfam:PF01266" FT /inference="protein motif:Pfam:PF03486" FT /inference="protein motif:Pfam:PF07992" FT /inference="protein motif:Pfam:PF00070" FT /protein_id="CAL34190.1" FT /translation="MGNARGFLDFKRMDFKKIAPKERILNYKEFTIPLDKKEQEVQGGR FT CMDCGVAFCHTGVMSEGKDVGCPLNNLIPEWNDLVYRSLWKEAYERLDLTNPFPEFTGR FT VCPAPCEDSCVCAINGVSVSIKNNELSIIENAFKENLVRVNKPKQYNGKKIAVIGSGPA FT GLACANTLNSLGYKVSVFERSDKIGGLLMYGIPDMKLDKSIVQRRVDLLKKSGIEFKVN FT ENIDSKDKVSKLLKEFDALVLCTGASKPIDLDIEGRKLKGVEFALDFLTQNTKTLLKTG FT KGADMAKGKNVLVIGSGDTSVDCIAVATRQGAKSIVRFERSPKRPLQRSQNNPWPLKAD FT IFTTDYGLEEAIAVYGKDPREYQKMTKKFLGKTHVEGVEANDLKREFKEGKAINVEISN FT SKKTYKADLVLLAMGFSGCEEAISKNFGVKLDEKNNISTENFQTTHKKIFACGDARKGQ FT SLVVWAIKDGIECALSLHQNLAK" FT misc_feature 14857..15774 FT /note="HMMPfam hit to PF00070, Pyridine FT nucleotide-disulphide oxidoreducta, score 2.4e-23" FT /inference="protein motif:Pfam:PF00070" FT misc_feature 14866..14898 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 15619..15651 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(15844..16419) FT /transl_table=11 FT /gene="rnhB" FT /locus_tag="Cj0010c" FT /product="ribonuclease HII" FT /EC_number="3.1.26.4" FT /note="Original (2000) note: Cj0010c, rnhB, probable FT ribonuclease HII, len: 191 aa; similar to many e.g. FT RNH2_ECOLI ribonuclease HII (EC 3.1.26.4) (198 aa), fasta FT scores; opt: 303 z-score: 506.7 E(): 5.7e-21, 38.6% FT identity in 176 aa overlap. 42.7% identity to HP1323" FT /note="Updated (2006) note: Pfam PF01351 Ribonuclease HII FT was identified within CDS. Further support given to product FT function. Characterised within Escherichia coli with FT acceptable identity score. Thus, putative not added to FT product function. Functional classification -Degradation of FT macromolecules" FT /note="PMID:2172991, PMID:9888800" FT /db_xref="GOA:Q9PJA1" FT /db_xref="HSSP:1EKE" FT /db_xref="InterPro:IPR001352" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJA1" FT /inference="protein motif:Pfam:PF01351" FT /protein_id="CAL34191.1" FT /translation="MKTLFDTKELLNEFDINLIGIDEAGRGALAGPMMMAACKLNKQLD FT GLCDSKKLSEKKREELYEIIIKNSNYLILAFSSEQIDALGLSTCLKKGLKLIKKHFKTE FT NNFLYDGNTNLGINGIKTQIKADTSILQVSAASILAKVSKDRVMNFLAKDFPCYEFEKN FT KAYGTKAHKEFIAKFGICKLHRKSFKLL" FT misc_feature complement(15847..16365) FT /note="HMMPfam hit to PF01351, Ribonuclease HII, score FT 7.2e-39" FT /inference="protein motif:Pfam:PF01351" FT misc_feature complement(16306..16338) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(16452..16691) FT /transl_table=11 FT /locus_tag="Cj0011c" FT /product="putative non-specific DNA binding protein. FT Functional classification-Synthesis and modification of FT macromolecules-DNA replication,restriction/modification, FT recombination and repair" FT /note="Updated (2006) note: Characterisation work carried FT out within Bacillus subtilis, however, sequence alignment FT was only partial. Putative kept within product function" FT /note="Original (2000) note: Cj0011c, possible non-specific FT DNA binding protein, len: 79 aa; similar to the C-terminus FT of CME1_BACSU comE operon protein 1 (comeA) (205 aa), fasta FT scores; opt: 223 z-score: 359.5 E(): 9e-13, 56.9% identity FT in 65 aa overlap. No Hp match. Contains Pfam match to entry FT PF00633 HHH,Helix-hairpin-helix motif., score 31.80, FT E-value 1.6e-05" FT /note="PMID:7968523, PMID:7768800" FT /db_xref="GOA:Q0PCB4" FT /db_xref="InterPro:IPR004509" FT /db_xref="UniProtKB/TrEMBL:Q0PCB4" FT /inference="protein motif:Pfam:PF00633" FT /protein_id="CAL34192.1" FT /translation="MKKLLFLFFALTAFLFGAVNINTATLKELKSLNGIGEAKAKAILE FT YRKEANFTSIDDLKKVKGIGDKLFEKIKNDITIE" FT misc_feature complement(16467..16553) FT /note="HMMPfam hit to PF00633, Helix-hairpin-helix FT motif,score 2.1" FT /inference="protein motif:Pfam:PF00633" FT misc_feature complement(16554..16643) FT /note="HMMPfam hit to PF00633, Helix-hairpin-helix FT motif,score 1.5e-06" FT /inference="protein motif:Pfam:PF00633" FT misc_feature complement(16614..16682) FT /note="1 probable transmembrane helix predicted for Cj0011c FT by TMHMM2.0 at aa 4-26" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(16614..16691) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000004_16452_16691 by SignalP 2.0 HMM FT (Signal peptide probability 0.999) with cleavage site FT probability 0.572 between residues 26 and 27" FT CDS complement(16756..17403) FT /transl_table=11 FT /gene="rrc" FT /locus_tag="Cj0012c" FT /product="non-haem iron protein" FT /note="Original (2000) note: Cj0012c, non-haem iron FT protein, len: 215 aa; has three possible iron-binding FT domains; C-terminus is similar to rubrerythrins e.g. FT RUBY_DESVH rubrerythrin (191 aa), fasta scores; opt: 454 FT z-score: 746.8 E(): 0, 39.5% identity in 190 aa FT overlap,with the iron-binding residues of both the FT rubredoxin-like center non-sulfur oxo-bridged di-iron FT center conserved. N-terminal 33 aa are simialar to the FT iron-bindingdomain of desulfoferrodoxins e.g. DESR_DESVH FT desulfoferrodoxin (125 aa), fasta scores; opt: 161 z-score: FT 275.8 E(): 4.2e-08,68.8% identity in 32 aa overlap, with FT the iron-binding residues conserved. No Hp match" FT /note="Updated (2006) note: Pfam domains PF00301 FT Rubredoxin, PF02915 Rubrerythrin and PF06397 FT Desulfoferrodoxin, N-terminal domain were all identified FT within CDS. Further support given to product function. FT Characterisation paper within Campylobacter also identified FT allowing gene name to be designated as Rrc (Rbo/Rbr-like FT protein of C. jejuni) protein. Thus,putative not added to FT product function. Functional classification - FT Transport/binding proteins - Cations" FT /note="PMID:15158262" FT /db_xref="GOA:Q0PCB3" FT /db_xref="InterPro:IPR003251" FT /db_xref="UniProtKB/TrEMBL:Q0PCB3" FT /inference="protein motif:Pfam:PF06397" FT /inference="protein motif:Pfam:PF02915" FT /inference="protein motif:Pfam:PF00301" FT /protein_id="CAL34193.1" FT /translation="MRQYETYKCQKCGNEVEVQNVGGGKLSCCGEEMKCITTDLTAVNL FT MKAFAGESMARNKYDLFADVAEEEGWHAVARHFREAAENEKWHARAEFKAYHEIVDGKP FT LEVTTKNLVTAAEGENYEHTTMYPNFAKIAEDEGKKAIARLFTAIGKVEIEHEREYLAL FT KKMLEEEEFFNSEVEELWVCEVCGHIHRGKKAPAACPLCKAPKEYFKREFLG" FT misc_feature complement(16777..16872) FT /note="HMMPfam hit to PF00301, Rubredoxin, score 1.9e-05" FT /inference="protein motif:Pfam:PF00301" FT misc_feature complement(16903..17283) FT /note="HMMPfam hit to PF02915, Rubrerythrin, score 6e-43" FT /inference="protein motif:Pfam:PF02915" FT misc_feature complement(17296..17403) FT /note="HMMPfam hit to PF06397, Desulfoferrodoxin,N-terminal FT domain, score 4.4e-20" FT /inference="protein motif:Pfam:PF06397" FT CDS 17563..19239 FT /transl_table=11 FT /gene="ilvD" FT /locus_tag="Cj0013" FT /product="dihydroxy-acid dehydratase" FT /EC_number="4.2.1.9" FT /note="Original (2000) note: Cj0013, ilvD, probable FT dihydroxy-acid dehydratase, len: 558 aa; highly similar to FT e.g. ILVD_ECOLI dihydroxy-acid dehydratase (EC 4.2.1.9) FT (605 aa), fasta scores; opt: 1091 z-score: 2191.4 E(): FT 0,46.9% identity in 597 aa overlap. 32.0% identity to FT HP1100 (6-phosphogluconate dehydratase). Contains PS00886 FT and PS00887 Dihydroxy-acid and 6-phosphogluconate FT dehydratases signatures 1 and 2, and Pfam match to entry FT PF00920 ILVD_EDD, Dehydratase family, score 784.10, E-value FT 5.5e-232" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Appropriate motifs present. Thus, putative not added to FT product function. Functional classification - Amino acid FT biosynthesis - Branched chain family" FT /note="PMID:3897211, PMID:790150, PMID:1646790" FT /db_xref="GOA:Q9PJ98" FT /db_xref="InterPro:IPR000581" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ98" FT /inference="protein motif:Pfam:PF00920" FT /inference="protein motif:Prosite:PS00887" FT /inference="protein motif:Prosite:PS00886" FT /protein_id="CAL34194.1" FT /translation="MRSDAIKKGHLRAPNRSLLRACGLKDEDFDKPFIGVANSYIDIIP FT GHYFLNDYAKIIKDEIRKNGCVPFEFNTIGVDDGIAMGHEGMLYSLPSRELIANSIETV FT MNAHQLDALICIPNCDKITPGMLMGALRVNVPTIFVSGGPMASGVTKKGEKISLSSVFE FT AVGAYESKKISEEEFKDIECSACPSGGSCSGMFTANSMNTLCEAMGIALEGNGTILALS FT KEREELLRKAARRICEIALDERFKIRNIITQKAVRNAMVVDMAMGGSSNTVLHMLAISR FT EAGVALDIKDLNFISSKVAHIAKIAPSLNSVYMDDIHKAGGVSAVMAEISSRQGHILEL FT DALTITGESLKERLKNAKIKDENIIRKVDNAYSKVGGLAILFGNLAKQGCVIKTAGIIG FT ERKFKGKAVCFNSQDEAIKGIIKGKVQKGNVCVIRYEGPKGGPGMQEMLSPTSLLMGMG FT LGADVALITDGRFSGATRGLSVGHISPEAAEGGLIGLLKDGDEIEIDVDAYTIHANVSE FT EEIAKRKKEFALPQKEVSSRWLRMYQKLVSNASKGAVLDME" FT misc_feature 17653..19230 FT /note="HMMPfam hit to PF00920, Dehydratase family, score 0" FT /inference="protein motif:Pfam:PF00920" FT misc_feature 17917..17949 FT /note="PS00886 Dihydroxy-acid and 6-phosphogluconate FT dehydratases signature 1" FT /inference="protein motif:Prosite:PS00886" FT misc_feature 18952..18987 FT /note="PS00887 Dihydroxy-acid and 6-phosphogluconate FT dehydratases signature 2" FT /inference="protein motif:Prosite:PS00887" FT CDS complement(19251..19775) FT /transl_table=11 FT /locus_tag="Cj0014c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0014c, probable integral FT membrane protein, len: 174 aa; similar to YAGU_ECOLI FT hypothetical 23.0 kd protein in intF-eaeH intergenic region FT (204 aa), fasta scores; opt: 402 z-score: 821.6 E(): 0, FT 45.1% identity in 184 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF07274 Protein of FT unknown function (DUF1440) identified within CDS. FT Also,three probable transmembrane helices identified by FT TMHMM2.0. Further support given to product function. No FT specific characterisation has been carried out yet. FT Thus,putative kept within product function. Functional FT classification - Central intermediary metabolism -General" FT /db_xref="InterPro:IPR009898" FT /db_xref="UniProtKB/TrEMBL:Q0PCB1" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF07274" FT /protein_id="CAL34195.1" FT /translation="MKKYFQKRYTLAFFIGILAGIFGAIVKWGWEVPFPPRNPNVFWPA FT DALERVTPPKIFLEQLGLPTDWTYMFSGMQMPLSIFIVHVGFSIIFGVAYCMIAEKWHR FT ITMWQGAVFGFFVYLFAHVIIMPLIAEVPPLSEIPFDEHLSEIFGHIVWLWGMEIVRRD FT IRNRITKEIEE" FT misc_feature complement(19296..19730) FT /note="HMMPfam hit to PF07274, Protein of unknown function FT (DUF1440), score 1.1e-96" FT /inference="protein motif:Pfam:PF07274" FT misc_feature complement(order(19674..19742,19482..19550,19386..19445)) FT /note="3 probable transmembrane helices predicted for FT Cj0014c by TMHMM2.0 at aa 12-34, 76-98 and 111-130" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(19704..19775) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000005_19251_19775 by SignalP 2.0 HMM FT (Signal peptide probability 0.976) with cleavage site FT probability 0.268 between residues 24 and 25" FT CDS complement(19867..21093) FT /transl_table=11 FT /locus_tag="Cj0015c" FT /product="hypothetical protein Cj0015c" FT /note="Original (2000) note: Cj0015c, unknown, len: 408 aa; FT 35.4% identity to HP0711" FT /note="Updated (2006) note: Literature search identified FT paper (PMID:15647906) giving potential clues to product FT functionality. Functional classification - Conserved FT hypothetical proteins" FT /note="PMID:15647906" FT /db_xref="UniProtKB/TrEMBL:Q0PCB0" FT /protein_id="CAL34196.1" FT /translation="MINIKLIEHIFKAASISRWNDYPRMANLVELDKQAHKFIIAYFIA FT KMEKDVDMRVIIEGGIFEFLSRVVVTDIRPDVYHEIVRQKKAEVNAWVLSKIEPMIEDI FT EDGEFLKRFEAYLNGNAYAKERLILKAASYFATRWEFNIVYQTSAFLNDIDEIKNKVEE FT ELEDYYELIGARKIALNQKIAKIIDLSGRLRFQKRWAQTPRIPETAVLGHMLVVAILGY FT FYSLKIKACDKRLENNFYCALFHDLPESLTRDIISPVKYGIDGLHDIINDYEMKLINER FT ILPFVPEGLRAEFSYILGIREGRNGESNFVKNEFENRTYKNAKIELCSGSLSSFNENEF FT GAIDGKALKYCDKIAAYIEAGLSISYGVKSKELESGFLGMHEFFKENPTIDGVNFFEIC FT ESLREYFKI" FT CDS 21159..21833 FT /transl_table=11 FT /locus_tag="Cj0016" FT /product="putative transcriptional regulatory protein" FT /note="Original (2000) note: Cj0016, possible FT transcriptional regulatory protein, len: 224 aa; similar to FT many hypothetical proteins and to TR:Q52925 (EMBL:Z50189) FT Rhizobium meliloti succinoglycan biosynthesis regulator FT exsB (234 aa), fasta scores; opt: 284 z-score: 395.5 E(): FT 9e-15, 33.5% identity in 191 aa overlap. 33.9% identity to FT HP0639 conserved hypothetical protein" FT /note="Updated (2006) note: Pfam domain PF06508 ExsB FT identified within CDS. Further support given to product FT function. Characterisation work carried out within FT Pseudomonas aeruginosa, however, identity scores were not FT acceptable. Thus, putative kept within product function. FT Functional classification - Broad regulatory functions" FT /note="PMID:9045825, PMID:8544814" FT /db_xref="GOA:Q9PJ95" FT /db_xref="InterPro:IPR018317" FT /db_xref="UniProtKB/Swiss-Prot:P0C634" FT /inference="protein motif:Pfam:PF06508" FT /protein_id="CAL34197.1" FT /translation="MSKKALCIISGGMDSTLCAYLAKKEGYEIIALHFDYEQRTQEKEK FT ECFKQICKALKVEKSYILDVSFIKDIGGNALTDKSIDIPKNELCTSDTPPITYVPFRNG FT IFLSIAGSLAEKENCESIFIGVVEEDGSGYPDCTDEFIQKAQEFINEGTSKNFKVCIKT FT PLVRLNKAKIVELALKENVPLELTWSCYESEDEACGECDSCLLRLRGFEKAGFKDKIKY FT KS" FT misc_feature 21369..21593 FT /note="HMMPfam hit to PF06508, ExsB, score 4.4e-41" FT /inference="protein motif:Pfam:PF06508" FT CDS complement(21854..23380) FT /transl_table=11 FT /gene="dsbI" FT /locus_tag="Cj0017c" FT /product="disulphide bond formation protein" FT /note="Original (2000) note: Cj0017c, probable ATP/GTP FT binding protein, len: 508 aa; 37.4% identity to HP0595 FT hypothetical protein. Contains PS00017 ATP/GTP-binding site FT motif A (P-loop)" FT /note="Updated (2006) note: Pfam domain PF02600 Disulfide FT bond formation protein DsbB identified within CDS. Gram FT negative bacterial cells have disulfide bond formation FT occuring in the oxidative environment of the periplasm and FT are catalysed by Dsb (disulfide bond) proteins found in the FT periplasm and in the inner membrane. Supporting paper FT (PMID:15632440) demonstrates via deletion and FT complementation that Cj0017c is part of the DsbB family and FT has been designated as dsbI. There is also strong evidence FT that Cj0017c and upstream ORF Cj0018c are co-transcribed FT (PMID:15632440). This information along with motif FT identification has led to a new product function FT designation. In addition, this coding sequence has 100% FT amino acid identity with DsbI from C. jejuni 81-176 FT (CJJ81-176_0044). Characterisation paper within FT Campylobacter jejuni has led to putative being removed from FT product function. Functional classification -Synthesis and FT modification of macromolecules - Protein translation and FT modification" FT /note="PMID:15632440" FT /db_xref="GOA:Q0PCA8" FT /db_xref="InterPro:IPR003752" FT /db_xref="UniProtKB/TrEMBL:Q0PCA8" FT /inference="protein motif:Pfam:PF02600" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34198.1" FT /translation="MNEINKTKNFYTLMCLAGFLIILLPVGIANLIFGYMLGDSPCTLC FT WGQREAMIFIGVMALFIVRYGMKGKYLAALLIMTAVGLYQSFAHYGNHAHRDLDQGFGL FT AVFGIHTYFWAEVVFWAVVLLLGVIFAFAPKFNAFEAELNGEKFRKYTKFSFAAVLISA FT IIVASNVFQAFVSTGIPPYVGQGDPVRFSLNPKYIIWSKEGWNGLWQNISFLGKRDVKA FT PDYAFAPASEKLGIKFDNDINNAPFAKINDELKITNEQTINFDKAINTLDYINNEFVAS FT SKWDVAFLDNNFSVKEGFELDPYFSASIDPIIGIIPYMNDKFILMGSNKSFLRFAKNPN FT ASEEDIAKQYADFVKGNDKFKGQGESLGRGRLDTVRAKFNHVASMTTDGNYLYLATVPN FT NKDAKTFVISKVSLKDRVLSGEFTPKANLKEGKTLGDLYVTSMTFKDGEIYALSKNHNV FT IAVIDPVKEEVVKTIAFPSSITNARSIFFKDGKINILSYQDGANKLYTLN" FT misc_feature complement(22082..22105) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature complement(order(23276..23344,23180..23233,23108..23167, FT 22982..23050,22853..22921)) FT /note="5 probable transmembrane helices predicted for FT Cj0017c by TMHMM2.0 at aa 13-35, 50-67, 72-91, 111-133 and FT 154-176" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(22862..23365) FT /note="HMMPfam hit to PF02600, Disulfide bond formation FT protein DsbB, score 1.9e-17" FT /inference="protein motif:Pfam:PF02600" FT sig_peptide complement(23288..23380) FT /note="Signal peptide predicted for dsbI by SignalP 2.0 HMM FT (Signal peptide probability 0.820) with cleavage site FT probability 0.405 between residues 31 and 32" FT CDS complement(23392..23559) FT /transl_table=11 FT /gene="dba" FT /locus_tag="Cj0018c" FT /product="disulphide bond formation protein" FT /note="Original (2000) note: Cj0018c, small hydrophobic FT protein, len: 55 aa; similar to TR:E1314390 (EMBL:AL031184) FT small hydrophobic protein SC2A11.18 from Streptomyces FT coelicolor (55 aa), fasta scores; opt: 72 z-score: 141.4 FT E(): 1.3, 32.7% identity in 49 aa overlap. 49.1% identity FT to HP0594 hypothetical protein" FT /note="Updated (2006) note: Gram negative bacterial cells FT have disulfide bond formation occuring in the oxidative FT environment of the periplasm and are catalysed by Dsb FT (disulfide bond) proteins found in the periplasm and in the FT inner membrance. Supporting paper (PMID:15632440) FT speculates Dba has a supportive role as dba is FT co-transcribed with dsbI. This information has led to a new FT product function designation. Dba has 100% amino acid FT identity with Dba from 81-176 (CJJ81176_0045). FT Characterisation paper within Campylobacter jejuni has led FT to putative being removed from product function. Functional FT classification - Synthesis and modification of FT macromolecules - Protein translation and modification" FT /note="PMID:15632440" FT /db_xref="UniProtKB/TrEMBL:Q0PCA7" FT /protein_id="CAL34199.1" FT /translation="MEFLELLLVLIALILIIKKPEKENLAFGLVMVAWLLMVFFYVGHK FT TGALLTIMNL" FT misc_feature complement(23428..23487) FT /note="1 probable transmembrane helix predicted for Cj0018c FT by TMHMM2.0 at aa 25-44" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(23665..25443) FT /transl_table=11 FT /locus_tag="Cj0019c" FT /product="putative MCP-domain signal transduction protein" FT /note="Original (2000) note: Cj0019c, probable MCP-domain FT signal transduction protein, len: 592 aa; similar to other FT proteins containing the MCP domain e.g. HLYB_VIBCH FT hemolysin secretion protein precursor (548 aa), fasta FT scores; opt: 418 z-score: 492.5 E(): 3.5e-20, 22.7% FT identity in 565 aa overlap, and AER_ECOLI aerotaxis FT receptor (506 aa), fasta scores; opt: 299 z-score: 391.2 FT E(): 1.6e-14, 25.5% identity in 357 aa overlap. 27.5% FT identity to HP0103. Contains N-terminal signal sequence and FT transmembrane anchor around aa 250. Also contains Pfam FT match to entry PF00015 MCPsignal, Methyl-accepting FT chemotaxis protein (MCP) signaling domain, score FT 104.90,E-value 1.7e-28" FT /note="Updated (2006) note: Pfam domain PF00672 HAMP domain FT identified within CDS. Two probable transmembrace helices FT identified by TMHMM2.0. Further support given to product FT function. No specific characterisation with acceptable FT identity scores has yet been carried out. Thus,putative FT kept within product function. Functional classification - FT Signal transduction" FT /db_xref="GOA:Q0PCA6" FT /db_xref="InterPro:IPR004090" FT /db_xref="UniProtKB/TrEMBL:Q0PCA6" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00672" FT /inference="protein motif:Pfam:PF00015" FT /protein_id="CAL34200.1" FT /translation="MTNKKSSFLIKFIILSTLVLAFILVLLGIIFNNYSSSKDNKELIN FT IVQQLEISDEKINSVFQNSFNFINYDPSVQAIKKMQENFTKLKTFGIDINKAEEIFNAK FT LIQLNYFKSANSIAVNSKLYLFELAKNYFEELEQNHETNKNNYKTMSSMLSVLSTENIL FT QKTTLNQLNNLMKEIKNDTKSENLQLFLKHYNMIVKQISIMQDNSSIYENNSLMKELKQ FT LNTFTQNTIEQSNLFKFYIALAVFGITLVLFVFFILLTLKKVIMPIHTLEKLSANLASK FT EANLHSRLNIDPKSELGQSAQYINSFISTVQNSIIEAIENAKSSHQNSQKLKNNSMMLE FT NSSNSQHEQIQGVKEITHVLDDHINLAGNLAQESIENMQDMHILMDKVELTLSELVNLI FT NENNEKEQNIVANMDNLTQSADNIIEITNSIKDIADQTNLLALNAAIEAARAGEHGRGF FT AVVADEVGQLADKTSKSLLNINATVNTIVQQINDNKALMDLIHDSMKETSSKTNDLQQE FT LVNSMHKLESSIESTQTMKDKSMEVKDKMLILGTNIDKVNELANSVKDLSCEINNISQN FT VLNGASKLSEKLSSFQ" FT misc_feature complement(23668..24375) FT /note="HMMPfam hit to PF00015, Methyl-accepting chemotaxis FT protein (MCP) s, score 5.5e-10" FT /inference="protein motif:Pfam:PF00015" FT misc_feature complement(24505..24720) FT /note="HMMPfam hit to PF00672, HAMP domain, score 1.8e-06" FT /inference="protein motif:Pfam:PF00672" FT misc_feature complement(order(25348..25416,24661..24729)) FT /note="2 probable transmembrane helices predicted for FT Cj0019c by TMHMM2.0 at aa 10-32 and 239-261" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(25333..25443) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000008_23665_25443 by SignalP 2.0 HMM FT (Signal peptide probability 1.000) with cleavage site FT probability 0.852 between residues 37 and 38" FT CDS complement(25433..26347) FT /transl_table=11 FT /locus_tag="Cj0020c" FT /product="cytochrome C551 peroxidase" FT /EC_number="1.11.1.5" FT /note="Original (2000) note: Cj0020c, probable cytochrome FT C551 peroxidase, len: 304 aa; similar to CCPR_PSEAE FT cytochrome C551 peroxidase precursor (EC 1.11.1.5) (346 FT aa), fasta scores; opt: 775 z-score: 1167.7 E(): 0, 42.3% FT identity in 298 aa overlap. No Hp ortholog. Contains 2x FT PS00190 Cytochrome c family heme-binding site signature and FT probable N-terminal signal sequence" FT /note="Updated (2006) note: Characterisation has been FT carried out within Pseudomonas aeruginosa with acceptable FT identity score. Appropriate motifs also identified. FT Putative not added to product function. Functional FT classification - Cell processes - Detoxification" FT /note="PMID:7781769, PMID:8591033, PMID:1657179" FT /db_xref="GOA:Q0PCA5" FT /db_xref="InterPro:IPR009056" FT /db_xref="UniProtKB/TrEMBL:Q0PCA5" FT /inference="protein motif:Prosite:PS00190" FT /protein_id="CAL34201.1" FT /translation="MKKIIMILCLSYANIVFAVDMITPIPNSISYDKEKAKLGKSLYMD FT KSLSKDGKVSCNTCHRLDQHGVDGLEFSIGVDNQLDKPFNTPTTFNSVFNFVQFWNGRA FT KDLAEQATVPFFNPKEMGLSPELLLQKVNSNENYVKTFKKLYGEVTVENIALAVAEFEK FT TLITPNSPFDRYLSGDQNAISTQAKKGYEDFKANGCISCHQGQNIGGNMFQKIGIFEEY FT PNQEDLGRYEITKREADKMVFKVPSLRNIAKTAPYFHDGSIPTLDACVQFMAYYQLGKF FT LDQETVDNIVAFLESLTGEYHDK" FT misc_feature complement(25454..25786) FT /note="HMMPfam hit to PF00034, Cytochrome c, score 0.0083" FT /inference="protein motif:Pfam:PF00034" FT misc_feature complement(25736..25753) FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT misc_feature complement(25799..26311) FT /note="HMMPfam hit to PF03150, Di-haem cytochrome c FT peroxidase, score 3.8e-69" FT /inference="protein motif:Pfam:PF03150" FT misc_feature complement(26165..26182) FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT sig_peptide complement(26294..26347) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000009_25433_26347 by SignalP 2.0 HMM FT (Signal peptide probability 0.836) with cleavage site FT probability 0.680 between residues 18 and 19" FT CDS complement(26411..27289) FT /transl_table=11 FT /locus_tag="Cj0021c" FT /product="putative fumarylacetoacetate (FAA) hydrolase FT family protein" FT /note="Original (2000) note: Cj0021c, unknown, len: 292 aa; FT similar to hypothetical proteins e.g. TR:O06724 FT (EMBL:Z99109) B. subtilis yisK (301 aa), fasta scores; opt: FT 665 z-score: 1018.0 E(): 0, 43.1% identity in 255 aa FT overlap, and to C-terminal half of HPCE_ECOLI FT 2-hydroxyhepta-2,4-diene-1,7-dioate FT isomeraase/5-carboxymethyl-2-oxo-hex-3-ene-1,7-dioate FT decarboxylase (405 aa), fasta scores; opt: 328 z-score: FT 381.2 E(): 5.6e-14, 31.2% identity in 199 aa overlap. No Hp FT match" FT /note="Updated (2006) note: Pfam domain PF01557 FT Fumarylacetoacetate (FAA) hydrolase family identified FT within CDS. Product modified to more specific family member FT due to motif match. No specific characterisation with FT acceptable identity score has been carried out yet. Thus, FT putative kept within product function. Functional FT classification - Misc" FT /db_xref="GOA:Q0PCA4" FT /db_xref="InterPro:IPR002529" FT /db_xref="UniProtKB/TrEMBL:Q0PCA4" FT /inference="protein motif:Pfam:PF01557" FT /protein_id="CAL34202.1" FT /translation="MKFVNFIQGQKPNLGVLNSSGKIVSFDDLGIETNDMNEFIIHFDK FT FKHKLTDLDSKIAYEIPQENYLAPIIEPRQDIICLGINFLDHAKESAKFKGEKFEEREY FT PVYFGKRCNQATAPFGDIPLHADVTSQLDYECELAFILSKDAYKIKAKDAKDYIFGYTI FT INEISARELQKRHKQFYRAKSLEGSTIMGPYITSVDEISYPPKLQLQSYVNDELRQNSN FT TQLFIFDIAYVLEELSAGMLLKAGSIISMGTPSGVGMGLNPPTFLKSGDKVRCVIENLG FT ELCNKIKNINY" FT misc_feature complement(26504..27007) FT /note="HMMPfam hit to PF01557, Fumarylacetoacetate (FAA) FT hydrolase fam, score 1.4e-44" FT /inference="protein motif:Pfam:PF01557" FT CDS complement(27402..28304) FT /transl_table=11 FT /locus_tag="Cj0022c" FT /product="putative ribosomal pseudouridine synthase" FT /EC_number="4.2.1.70" FT /note="Original (2000) note: Cj0022c, possible ribosomal FT pseudouridine synthase, len: 300 aa; similar to e.g. FT RLUD_ECOLI ribosomal large subunit pseudouridine synthase D FT (EC 4.2.1.70) (326 aa), fasta scores; opt: 344 z-score: FT 412.1 E(): 1.2e-15, 29.6% identity in 243 aa overlap. 41.1% FT identity to HP0347. Contains PS01129 Hypothetical FT yabO/yceC/sfhB family signature and Pfam match to entry FT PF00849 YABO, Hypothetical yabO/yceC/sfhB family, score FT 182.90, E-value 5e-51. Also similar to Cj1280c (31.0% FT identity) and Cj0708 (28.0% identity)" FT /note="Updated (2006) note: Characterisation has been FT carried out within Escherichia coli, however, identity FT score was marginal. Pfam domain PF00849 RNA pseudouridylate FT synthase was identified within CDS. This Pfam motif has FT been updated from the previous designation. Further support FT given to product function. Putative kept within product FT function. Functional classification -Synthesis and FT modification of macromolecules - Ribosome maturation and FT modification" FT /note="PMID:11453071, PMID:11087118, FT PMID:9814761,PMID:14501142" FT /db_xref="GOA:Q0PCA3" FT /db_xref="InterPro:IPR006224" FT /db_xref="UniProtKB/TrEMBL:Q0PCA3" FT /inference="protein motif:Pfam:PF00849" FT /inference="protein motif:Prosite:PS01129" FT /protein_id="CAL34203.1" FT /translation="MAYIKIKLSNNGKKAFQVLMENLKISINEAQKLIDKKRLFCDGIL FT VEEKNKILNGLVELIVYENNPKGVEIVFENEDFAILEKESGILSHPNGRHCKYSLSDEI FT WHLWGKEACVAHRLDKETSGLILIAKNKKAQIDLKSLFEKKLVQKEYLALAHGKIEENF FT IVDKAINLTKNYDDVKTRMQICKEGKQAITEFEILEYFPKINATLLLCKPLTGRQHQIR FT VHLHYKNHTILGDPLYGLSKQQIESILDEKLNPKERLKLTGALRLCLHSYRLKFQYKNQ FT NFDINSKINIKEIFNNSIK" FT misc_feature complement(27624..28076) FT /note="HMMPfam hit to PF00849, RNA pseudouridylate FT synthase, score 7.1e-43" FT /inference="protein motif:Pfam:PF00849" FT misc_feature complement(27918..27962) FT /note="PS01129 Rlu family of pseudouridine synthase FT signature" FT /inference="protein motif:Prosite:PS01129" FT CDS 28382..29710 FT /transl_table=11 FT /gene="purB" FT /locus_tag="Cj0023" FT /product="adenylosuccinate lyase" FT /EC_number="4.3.2.2" FT /note="Original (2000) note: Cj0023, purB, probable FT adenylosuccinate lyase, len: 442 aa; similar to e.g. FT PUR8_BACSU adenylosuccinate lyase (EC 4.3.2.2) (431 FT aa),fasta scores; opt: 1369 z-score: 2264.2 E(): 0, 49.9% FT identity in 439 aa overlap. 67.9% identity to HP1112. FT Contains PS00163 Fumarate lyases signature and Pfam match FT to entry PF00206 lyase_1, Lyases, score 199.60, E-value FT 4.7e-56" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis with acceptable identity scores. Thus, putative FT not added to product function. Functional classification FT -Purine ribonucleotide biosynthesis" FT /note="PMID:1608947, PMID:10926519, PMID:3036807" FT /db_xref="GOA:Q0PCA2" FT /db_xref="InterPro:IPR004769" FT /db_xref="UniProtKB/TrEMBL:Q0PCA2" FT /inference="protein motif:Pfam:PF00206" FT /inference="protein motif:Prosite:PS00163" FT /protein_id="CAL34204.1" FT /translation="MVERYSREIMAKKWDMQAKYDAWLKVELAAVKAWNKLGLIDDTDC FT EKILKNAKFDIARIDEIEKTTKHDVIAFLTSVSESLGEESRFVHYAMTSSDCIDTAVAL FT QIKESLELILEDVSLLLEAIKKRALEHKNTLMVGRSHGIHGEPITFGLVLAIWYDEISH FT AKELLEHAKEVISYGKISGAMGNFAHAPLEFEEEVCKNLGLKAAPVSNQVIQRDRYAQV FT ISAIAILASSCEQIAVAIRHFQRTEVYEAEEYFSVGQKGSSAMPHKRNPVLSENITGLC FT RVLRSFVTPALENVALWHERDISHSSVERFILPDAFITADFMLMRLTNLIDKLLVYPEN FT MMKNLNLTGGLVFSGRVLLELPFKGISREEAYKIVQRNAMKVWADLQNGKAAINEKNES FT LFLLALLSDEDLRKSLSEEDVRKCFDYNYYTKNVDAIFKRTFK" FT misc_feature 28388..29239 FT /note="HMMPfam hit to PF00206, Lyase, score 3.7e-45" FT /inference="protein motif:Pfam:PF00206" FT misc_feature 29048..29080 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 29162..29191 FT /note="PS00163 Fumarate lyases signature" FT /inference="protein motif:Prosite:PS00163" FT CDS 29726..32095 FT /transl_table=11 FT /gene="nrdA" FT /locus_tag="Cj0024" FT /product="ribonucleoside-diphosphate reductase alpha chain" FT /EC_number="1.17.4.1" FT /note="Original (2000) note: Cj0024, FT nrdA,ribonucleoside-diphosphate reductase alpha chain, len: FT 789 aa; similar to e.g. RIR3_YEAST FT ribonucleoside-diphosphate reductase large chain 2 (869 FT aa), fasta scores; opt: 909 z-score: 1663.2 E(): 0, 33.0% FT identity in 813 aa overlap,and RIR1_ECOLI FT ribonucleoside-diphosphate reductase 1 alpha chain (EC FT 1.17.4.1) (761 aa), fasta scores; opt: 795 z-score: 1160.2 FT E(): 0, 28.5% identity in 811 aa overlap. 68.9% identity to FT HP0680. Contains PS00089 Ribonucleotide reductase large FT subunit signature and 3x Pfam match to entry PF00317 FT ribonucleo_red, Ribonucleotide reductase,scores 371.50, FT E-value 5.1e-139, 133.70, E-value 4.5e-50 and 44.10, FT E-value 1.5e-16" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis and Escherichia coli. Identity scores were FT marginal. Appropriate motifs were identified. Putative not FT added to product function. Functional classification FT -2'-deoxyribonucleotide biosynthesis" FT /note="PMID:6087316, PMID:3098730" FT /db_xref="GOA:Q0PCA1" FT /db_xref="InterPro:IPR013509" FT /db_xref="UniProtKB/TrEMBL:Q0PCA1" FT /inference="protein motif:Pfam:PF00317" FT /inference="protein motif:Prosite:PS00089" FT /protein_id="CAL34205.1" FT /translation="MKVIKRNGRTEELDVSKIKKCTSDAVKDLEGVNLSELELDAKIQF FT RDGISTEEIQKTLIKTAVDKIDIDCPNWTFVAARLFLFDLYKKVNGMNRYNHLREYFQK FT GEKEGRILLGLKEKYDLDDLNAYIKPERDMQFTYLGIKTLYDRYLIKDSKGMPIELPQQ FT MFMAIAMFLAQNEFNPQEWAKKFYDLISKFELMLATPTLSNARTTRHQLSSCYIGSTPD FT NIEGIFDSYQEMALLSKFGGGIGWDWSKVRAMGGSIDGHKNAAGGIIPFLKITNDIAVA FT VDQLGTRKGAIAVYIEPWHMDISDFIDLRKNSGEERRRAHELFPALWINDLFMKRVRAN FT DKWTLFDPADTADLCDLYGEAFEKRYEEYEKDESITKEIVEAKELWKKILLNYFETGLP FT FLCFKDSANRANPNAHVGIIRSSNLCTEIFQNTEPNYYQIKVVFENGDELHFDEEQKVV FT IDGGYEKPAKKISTLDSIEGNKVYIVEKYKNDGKTAVCNLASINLSKVYTKEDIERVVP FT TAIRMLDNVIDLNFYPHRKVKDTNLKSRAIGLGVMGEAQMLAEAKIHWGSDEHLNKIDE FT IMEQISFEAINASSNLALEKGSYEDFEGSNWSKGIFPIDVASPKAKALTLREGLFDQSE FT CDWVKLREKVKKDGMRNGYLMAIAPTSSISILVGTTQTIEPVYKRKWFEQNLSGMIPVV FT VPNLSLDTWQYYTPAYELDQKILVKAAAVRGKWIDQGQSLNIFLSLDKASGGYLNEIYQ FT LAWELGVKSTYYLRSESPDSEKVNVADRSIECEGCQ" FT misc_feature 29726..29995 FT /note="HMMPfam hit to PF03477, ATP cone domain, score FT 6.2e-18" FT /inference="protein motif:Pfam:PF03477" FT misc_feature 30125..30355 FT /note="HMMPfam hit to PF00317, Ribonucleotide FT reductase,all-alpha d, score 3.2e-35" FT /inference="protein motif:Pfam:PF00317" FT misc_feature 30359..32035 FT /note="HMMPfam hit to PF02867, Ribonucleotide FT reductase,barrel doma, score 7.5e-129" FT /inference="protein motif:Pfam:PF02867" FT misc_feature 31637..31705 FT /note="PS00089 Ribonucleotide reductase large subunit FT signature" FT /inference="protein motif:Prosite:PS00089" FT CDS complement(32134..33519) FT /transl_table=11 FT /locus_tag="Cj0025c" FT /product="putative sodium:dicarboxylate family FT transmembrane symporter" FT /note="Original (2000) note: Cj0025c, probable FT transmembrane symporter (possibly glutamate), len: 461 aa; FT similar to many e.g. YB54_HAEIN hypothetical symporter FT HI1154 (440 aa), fasta scores; opt: 650 z-score: 890.6 E(): FT 0, 33.7% identity in 454 aa overlap, and TR:Q46202 FT (EMBL:X86516) Clostridium perfringens gluT-R gene FT (fragment) (132 aa), fasta scores; opt: 406 z-score: 569.0 FT E(): 1.9e-24, 49.6% identity in 119 aa overlap. No Hp FT match. Contains Pfam match to entry PF00375 FT SDF,Sodium:dicarboxylate symporter family, score FT 142.20,E-value 9.4e-39" FT /note="Updated (2006) note: Pfam domain PF00375 FT Sodium:dicarboxylate symporter family identified within FT CDS. Eleven probable transmembrane helices predicted by FT TMHMM2.0. Product modified to more specific family member FT due to motif match. No specific characterisation with FT acceptable identity score has been carried out yet. FT Thus,putative kept within product function. Functional FT classification - Transport/binding proteins - Other" FT /db_xref="GOA:Q0PCA0" FT /db_xref="InterPro:IPR001991" FT /db_xref="UniProtKB/TrEMBL:Q0PCA0" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00375" FT /protein_id="CAL34206.1" FT /translation="MDKQFFQDFLMLSQAHTIATLAILCVVFYALKKMRDIKINFSLRM FT LFALLMGLGFGFALQYLANFPDAEEASNILWYSETKHWFAFVSSVFVAFIKMLVVPLVS FT ICIIKVIIEIDKNIKISSLLGISLFWILFSTAIAATLGIFLGYSFDLGSNFAIYEGDKQ FT IREIQTFSNIILGLIPSNIITAINKENIIAIVIFSFFIGISAKKISKKEEYEQAFKSFH FT NFILTFYNIMMNMTATVIRFMPYAVVCMMANVLLSNGFEAIKTAGLFIMLIYIAMFIMF FT GVHFLLLASQGLNPIKYAKKAFPVWLFAFSSRSSLGTLPMTTSTLQNKFGVNSAIANFV FT ASIGTTTGLNGCAGYFPALAAVFVAFATHTHIDFTFALMIVLVAVIGSLGIAGVPGSAT FT MAASIMLAGIGFGNNFVMLSLILAIDPIIDMARTASNVSGAMTSALCTAKNLKALDKEI FT YNS" FT misc_feature complement(32170..33399) FT /note="HMMPfam hit to PF00375, Sodium:dicarboxylate FT symporter family, score 2.4e-40" FT /inference="protein motif:Pfam:PF00375" FT misc_feature complement(order(33433..33492,33331..33399,33205..33273, FT 33076..33144,32908..32976,32779..32847,32653..32721, FT 32548..32616,32437..32505,32332..32400,32251..32319)) FT /note="11 probable transmembrane helices predicted for FT Cj0025c by TMHMM2.0 at aa 10-29, 41-63, 83-105, FT 126-148,182-204, 225-247, 267-289, 302-324, 339-361, FT 374-396 and 401-423" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(33639..34262) FT /transl_table=11 FT /gene="thyX" FT /locus_tag="Cj0026c" FT /product="thymidylate synthase" FT /EC_number="2.1.1.148" FT /note="Original (2000) note: Cj0026c, unknown, len: 207 aa; FT similar to hypothetical proteins e.g. YDAP_BRELA FT hypothetical 28.0 kd protein (250 aa), fasta scores; opt: FT 221 z-score: 388.7 E(): 2.1e-14, 27.4% identity in 190 aa FT overlap. 56.3% identity to HP1533" FT /note="Updated (2006) note: Pfam domain PF02511 Thymidylate FT synthase complementing protein identified within CDS. FT Characterisation work has been carried out within FT Campylobacter jejuni and Helicobacter pylori. Two forms of FT microbial thymidylate synthase are known: ThyA and ThyX . FT This family describes ThyX, a homotetrameric flavoprotein. FT Both enzymes convert dUMP to dTMP. Under oxygen-limiting FT conditions, ThyX can complement a thyA mutation FT (PMID:9665876, PMID:15046578). Functional classification - FT Misc" FT /note="PMID:12423760, PMID:9665876, FT PMID:15046578,PMID:12029065" FT /db_xref="GOA:Q9PJ85" FT /db_xref="HSSP:1O24" FT /db_xref="InterPro:IPR003669" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ85" FT /inference="protein motif:Pfam:PF02511" FT /protein_id="CAL34207.1" FT /translation="MQITLLFHTPLSVCSHATRTCWQSFEKGDCGGEKDKELIDRVGNK FT FKHASTLEHLNYTFYIQGISRACLQEVARHRHTSPSVKSTRYTLKELRNEAEFKIGDFE FT NASRYLVLCGNEEVDNASIKALENLRTILQKSISLDIAKYCLPESYKTELTLTINARSL FT QNFISLRSSKSALWEIRNLANALFEALPQEHKFIFEHCLHKDIE" FT misc_feature complement(33663..34262) FT /note="HMMPfam hit to PF02511, Thymidylate synthase FT complementing protein, score 6.3e-43" FT /inference="protein motif:Pfam:PF02511" FT CDS 34382..36013 FT /transl_table=11 FT /gene="pyrG" FT /locus_tag="Cj0027" FT /product="CTP synthase" FT /EC_number="6.3.4.2" FT /note="Original (2000) note: Cj0027, pyrG, CTP FT synthase,len: 543 aa; highly similar to many e.g. FT PYRG_ECOLI CTP synthase (EC 6.3.4.2) (544 aa), fasta FT scores; opt: 1892 z-score: 2236.1 E(): 0, 52.6% identity in FT 540 aa overlap. 62.6% identity to HP0349. Contains PS00442 FT Glutamine amidotransferases class-I active site" FT /note="Updated (2006) note: Pfam domain PF06418 CTP FT synthase N-terminus and PF00117 Glutamine amidotransferase FT class-I were identified within CDS. Further support given FT to product function. Characterised within Escherichia coli FT with acceptable identity score. Thus, putative not added to FT product function. Functional classification -Pyrimidine FT ribonucleotide biosynthesis" FT /note="PMID:3298209, PMID:8385490, PMID:11336655" FT /db_xref="GOA:Q9PJ84" FT /db_xref="InterPro:IPR000991" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ84" FT /inference="protein motif:Pfam:PF00117" FT /inference="protein motif:Pfam:PF06418" FT /inference="protein motif:Prosite:PS00442" FT /protein_id="CAL34208.1" FT /translation="MKQTKYIFVTGGVLSSLGKGIAAASIATLLKNSGLKVSILKADPY FT INVDPGTMSPFEHGEVFVTDDGAETDLDLGHYERFLDESLSQDNNFTTGRVYQSVIEKE FT RRGEYLGKTIQVIPHIVGEIKDRIKKAGEGKDILIVEIGGTVGDIEGLPFLEAIRALRL FT EVGKNNAMNIHLTLVPFIKAAGELKTKPTQHSVGELRRIGISPDMIICRSEKALDRDLK FT DKIAISCGVEKNCVIESVDAASIYQIPLNFLKQDILSPIAEILDLKNLKPNMENWDSLV FT KRVIAPSNEVKIAFVGKYVDLKESYKSLTEAIIHAGAALDTKVELKWVDSEKLENMESS FT EVFKDVSGILVAGGFGYRGVEGKIKAIQYARENKIPFLGICLGMQLALVEFARNVLKLK FT DVNSSEFNEKCQNPVVYLIDEFMDTNGEKQIRTAKTPLGGTMRLGAYKCDIKEKSLLAK FT VYNEVKSVKERHRHRYEANPKYRADFEKYGLIVSGESKGLIEAVELNCHPFFLAVQFHP FT EFTSRLEHVNPVICSFIKAAINYEDN" FT sig_peptide 34382..34453 FT /note="Signal peptide predicted for pyrG by SignalP 2.0 HMM FT (Signal peptide probability 0.989) with cleavage site FT probability 0.881 between residues 24 and 25" FT misc_feature 34391..35218 FT /note="HMMPfam hit to PF06418, CTP synthase FT N-terminus,score 4.3e-204" FT /inference="protein motif:Pfam:PF06418" FT misc_feature 34400..34468 FT /note="1 probable transmembrane helix predicted for Cj0027 FT by TMHMM2.0 at aa 7-29" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 35282..35989 FT /note="HMMPfam hit to PF00117, Glutamine amidotransferase FT class-I, score 3.5e-57" FT /inference="protein motif:Pfam:PF00117" FT misc_feature 35507..35542 FT /note="PS00442 Glutamine amidotransferases class-I active FT site" FT /inference="protein motif:Prosite:PS00442" FT CDS 36000..37571 FT /transl_table=11 FT /gene="recJ" FT /locus_tag="Cj0028" FT /product="putative single-stranded-DNA-specific FT exonuclease" FT /EC_number="3.1.-.-" FT /note="Original (2000) note: Cj0028, recJ, probable FT single-stranded-DNA-specific exonuclease, len: 523 aa; FT similar to e.g. RECJ_ECOLI single-stranded-DNA-specific FT exonuclease (EC 3.1.-.-) (577 aa), fasta scores; opt: 385 FT z-score: 861.6 E(): 0, 29.8% identity in 526 aa overlap. FT 39.0% identity to HP0348" FT /note="Updated (2006) note: Pfam domain HMMPfam PF01368 DHH FT family and HMMPfam PF02272 DHHA1 domain were identified FT within CDS. Further support given to product function. FT Characterised within Escherichia coli, however,marginal FT identity score was obtained. Putative kept within product FT function. Functional classification - Synthesis and FT modification of macromolecules - DNA FT replication,restriction/modification, recombination and FT repair" FT /note="PMID:2649886" FT /db_xref="GOA:Q0PC97" FT /db_xref="InterPro:IPR004610" FT /db_xref="UniProtKB/TrEMBL:Q0PC97" FT /inference="protein motif:Pfam:PF02272" FT /inference="protein motif:Pfam:PF01368" FT /protein_id="CAL34209.1" FT /translation="MKIINKNEIKKILASRFEKDLHTKLCDLPLPCCLKDAYKAANRIK FT EAVEKNEKVAIVGDYDVDGIISCVIMAEFFDDIGFDYIIRIPNRFKDGYGLNAEIINEL FT DVNLIITVDNGIAALEAAKLCKEKNIDLIITDHHMPQDILPDAFAIINPKQKDCDFPEI FT EICGAQVAWYLIAALKEVCKLKYDMCKFLELLAIAIVADMMELRDLNRALVRRGIDHIN FT KSKRAAFRAIKHYYQKDKFALDNIGFLIAPLINSAGRMDDASISYEFLHTKDFNKALEY FT LEQIVSFNESRKDEEKQLFEDSLNQIDENDSCIVVSGLNWHEGVLGIVASRLAKHFNKP FT AFVFSQNEEHLKGSARSVGKIDILALISKTNSILSNYGGHKGAAGISLNSENFEQFKNK FT IKKECSQISESEFLDTDEILGILEPSEIDFEMLEILESFEPFGHKNPRPFFVLENLCVK FT NKKLLGKDEKHLKLVLTKENKTIEALFFNFDKEPELNQNISLLGSISKNEFRGMVTPQF FT VVKEIL" FT misc_feature 36138..36599 FT /note="HMMPfam hit to PF01368, DHH family, score 1e-48" FT /inference="protein motif:Pfam:PF01368" FT misc_feature 37011..37205 FT /note="HMMPfam hit to PF02272, DHHA1 domain, score 1.5e-16" FT /inference="protein motif:Pfam:PF02272" FT CDS 37667..38662 FT /transl_table=11 FT /gene="ansA" FT /locus_tag="Cj0029" FT /product="cytoplasmic L-asparaginase" FT /EC_number="3.5.1.1" FT /note="Original (2000) note: Cj0029, ansA, probable FT cytoplasmic L-asparaginase, len: 331 aa; similar to many FT e.g. ASG2_ECOLI L-asparaginase II precursor (EC 3.5.1.1) FT (348 aa), fasta scores; opt: 1044 z-score: 1510.6 E(): FT 0,52.0% identity in 327 aa overlap, but with no signal FT sequence. 45.8% identity to HP0723. Contains PS00144 and FT PS00917 Asparaginase/glutaminase active site signatures 1 FT and 2 and Pfam match to entry PF00710 FT Asparaginase,Asparaginase, score 449.90, E-value 2.2e-131" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Thus,putative not added to product function. Functional FT classification - Degradation - Amino acids" FT /note="PMID:2407723, PMID:1287659, PMID:8706862" FT /db_xref="GOA:Q0PC96" FT /db_xref="InterPro:IPR006034" FT /db_xref="UniProtKB/TrEMBL:Q0PC96" FT /inference="protein motif:Pfam:PF00710" FT /inference="protein motif:Prosite:PS00917" FT /inference="protein motif:Prosite:PS00144" FT /protein_id="CAL34210.1" FT /translation="MKKAKSRIAILGTGGTIAGFIDSTIATTGYAAGAIDIDVLIKAVP FT QIRDLADISWEQIANIDSSNMCDEIWLRLAKKIAKLFAEGIDGVVITHGTDTMEETAYF FT LNLTIKSDKPVVLVGAMRPSTAISADGPKNLYNAVALVVNKEAKNKGVMVAINDKILSA FT RGVVKTHSLNVDAFSSPDFGDLGYIVDGKVFFYNNVIKAHTKNAPFDVSKLTSLPKVDI FT LYSYSNDGSGVAAKALFEHGTKGIVVAGSGAGSIHKNQKDVLKELLKKGLKVVVSSRVV FT AGCVAVSDSDEKLGFISAEDLNPQKARVLLMLALTKTSDPKKIQEYFLKY" FT sig_peptide 37667..37759 FT /note="Signal peptide predicted for ansA by SignalP 2.0 HMM FT (Signal peptide probability 0.999) with cleavage site FT probability 0.939 between residues 31 and 32" FT misc_feature 37694..37720 FT /note="PS00144 Asparaginase / glutaminase active site FT signature 1" FT /inference="protein motif:Prosite:PS00144" FT misc_feature 37712..38644 FT /note="HMMPfam hit to PF00710, Asparaginase, score FT 1.5e-132" FT /inference="protein motif:Pfam:PF00710" FT misc_feature 37928..37960 FT /note="PS00917 Asparaginase / glutaminase active site FT signature 2" FT /inference="protein motif:Prosite:PS00917" FT rRNA 39249..40761 FT /note="16S rRNA" FT tRNA 40866..40941 FT /gene="tRNA-Ala" FT /note="tRNA Ala anticodon TGC, Cove score 92.14" FT tRNA 40950..41026 FT /gene="tRNA-Ile" FT /note="tRNA Ile anticodon GAT, Cove score 93.24" FT rRNA 41568..44457 FT /note="23S rRNA" FT rRNA 44741..44860 FT /note="5S rRNA" FT CDS 44966..46363 FT /transl_table=11 FT /locus_tag="Cj0030" FT /product="hypothetical protein Cj0030" FT /note="Original (2000) note: Cj0030, unknown, len: 465 aa. FT No Hp match" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Functional classification FT -Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PC95" FT /protein_id="CAL34211.1" FT /translation="MEKFIERLLEEDIKFEKDVNNGLSDINIFDALNIETKENYHSKFI FT AYLIDINKDHYQKNFAKVFLEKLGKSLVNTKFENLNIEDIKSVETEACIKDNRRIDILI FT TLSDKRYIIIENKIYAKDQKNQLKDYINFVRKNIKNIKDCYKNILTIYLHQDECASPSD FT YSLGNFTIKTNLIKDKNENNVSYYLKMDYMWIKEWIDECIKIYEEKSTKDQKFILDIQN FT IIFTLNQYKSILQWYIADEYTQRDDVLEFIFQDIIKMQNLKNAMILYRYNKNKSELKNL FT NEEKYKKAKDIIQHKWSNICEYIIEEFFDSFEHKEIKIGDITFIGNKIEENRVNHGVFI FT FYPVDYKNESIYPCIYIYFKKKYYDIIGLTFEISNDDEEDIENEKYKECLKLFKDVKEE FT NVRKYQNHYYCDKLINNEKLEGEYAFIYWLIENQNSKKDFIQILNDFFIKKPIQEAYKG FT INDILNS" FT CDS join(46424..49000,49002..50156) FT /transl_table=11 FT /locus_tag="Cj0031" FT /product="putative type IIS restriction/modification FT enzyme" FT /note="Original (2000) note: Cj0031, probable DNA FT restriction/modification enzyme, N-terminal half, len: 867 FT aa; similar to N-terminus of T257_ECOLI type IIS FT restriction enzyme Eco57I (which contains an FT adenine-specific methyltransferase activity) (997 aa),fasta FT scores; opt: 126 z-score: 218.0 E(): 6.9e-05, 24.0% FT identity in 516 aa overlap. 40.9% identity to N-terminus of FT HP1517. Some similarity to N-terminus of Cj0690c (24.8% FT identity in 858 aa overlap). Contains PS00092 N-6 FT Adenine-specific DNA methylases signature. Note that there FT is a polymorphic poly-G tract at the C-terminus of this ORF FT with 8, 9, or 10 bases. G10 (the most common in our FT shotgun) causes a termination here, G9 causes a termination FT 6 aa earlier. G8 allows translation to continue into FT Cj0032" FT /note="Original (2000) note: Cj0032, probable DNA FT restriction/modification enzyme, C-terminal half, len: 867 FT aa; similar to C-terminus of MTB3_BACAR modification FT methylase BanIII (580 aa), fasta scores; opt: 132 z-score: FT 220.8 E(): 4.9e-05, 24.6% identity in 402 aa overlap. 47.4% FT identity to C-terminus of HP1517. Note that there is a FT polymorphic poly-G tract at the N-terminus of this ORF with FT 8, 9, or 10 bases. G10 (the most common in our shotgun) or FT G9 will not allow translation into this ORF,G8 allows FT translation to continue from Cj0031. Alternative downstram FT start at 49059" FT /note="Updated (2006) note: Coding sequences have been FT merged to reflect the complete amino acid sequence for this FT gene regardless of phase. Previous annotation gave FT N-terminal and C-terminal portions as seperate CDS. Merging FT of these CDSs has lead to loss of the downstream CDS. FT Functional classification - Synthesis and modification of FT macromolecules - DNA replication,restriction/modification, FT recombination and repair" FT /db_xref="GOA:Q0PC94" FT /db_xref="InterPro:IPR002296" FT /db_xref="UniProtKB/TrEMBL:Q0PC94" FT /inference="protein motif:Prosite:PS00092" FT /protein_id="CAL34212.1" FT /translation="MHFTLLNEKDFFNPYYRKKQIMQNEFDIFSKALMQYLERLESSQS FT ENEDYLVANALSPFLTMLNFKTHIKTKQKGKSEIDLSISKDEFSKDLEVLIEAKKPNSK FT EFITHTKVNSKALHETILYYFRNREYSFSLKFIIITDFYKFYIFKISEFEELFYKNPSF FT KKLFEEFCNPNSLFKGNTEEFYKEVAKLIENSKENLKGFLIDLTFLKDKQKSNFKNLAS FT IYKTFHRDFLLSEFNPNDANSLNNAFYKELLYILGLYESKQNSKLIIAKSEESKEEQGT FT FYTAINSKLKEENFETILKLLILWLNRILFLKLIESNLVRFNDDKNLKFLNFKKIPDFD FT KLSELFFEVLAKEKSTRKKSEFTYLPYLNSSLFEKQSIENTLEISSLSNDLKLFYYKNT FT VLKDDKCKAKKGQVGLLEYLFEFLDSFDFGSDDEQSEILSQKELISSSVLGNVFEKLNG FT YKEGSFYTPSFITSYMCKESITKVVLDKFNAQFDLDAKDISELRKSLRKEDKKAQKELL FT NSIKICDPAVGSGHFLVSALNVMLSIYDELNLFDEEFYLEVQNDEILITGRKGEFIEYK FT RPSTPKDKTHLIQQELFHTKKDIIENNLFGVDINPNSCEITKLRLWIELLKHSFYQSFD FT DGNYHDLKTLPNIDINIKCGNSLVSYFETGKSLNHYPNIKERMGKYKRIVKDYKEGFYT FT DKSHINQEIKNLKISFKNFCFADKFKKEMKSFNDKCEKYSKKYGNFLAVDDENLKFFVS FT ANLTLFDFDEKEAIKEFANLKKEYDNIFNLESNHPFEWRFEFPEILDDDGNFKGFDLII FT GNPPYIRQEELKELKPHLAKNYKVYKGTSDIYTYFYELGFNVLKDRGGVLSYITSNKYT FT RAGYGEALREFLLKNVKFLEYTDLNGIKVFDSATVDTSILCFEKSKSKDNKFKYLALSN FT EILKTCAYDIGLYKDFAEFSQNSLSKESFTFSDENTSALKAKIERIGTPLKEWYGLNIN FT YGIKTGLNEAFIITTEKRNEILANCKDEAEKERTAKLIRKMLRGRDIKRYSYEWAGLWV FT IGTFPSLKIDIEQYPALKQYLSQFLPHIEQSGEKGCRKKTSNKWFETQDNIAYYEEFEK FT EKIVWAEMTKEACFVYDNSNFFTNQTCYFFTHCDYKYLLAILNSRLIVYYMQYISSHLG FT QGAFRWIRQYIEKLPIPKINSKNEKLADELINLVDEILKAKEQDKNANTQELENKINSL FT VYKLYNLTEEEIKIIEGK" FT CDS 50156..51937 FT /transl_table=11 FT /locus_tag="Cj0033" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0033, probable integral FT membrane protein, len: 593 aa; contains 6 possible FT transmembrane domains in C-terminal half. No Hp match. FT Functional classification - Membranes, lipoproteins and FT porins" FT /db_xref="UniProtKB/TrEMBL:Q0PC93" FT /protein_id="CAL34213.1" FT /translation="MEELTKEQRQIIEEEIKKEIKKANTFLKPELINKIIQDIIGDIKG FT KINNKFKCPKNLEEILSSIPQKVYVSLGKEEIKQILKLDFCCFVDNVFYIDSAPKIEPY FT EHNQNKTAIEEQRIIQCSYDDLLYLFKTYPLIFNHCIFDYKIDKKTPIEQIKKLSFLNC FT NFKKEVYLNFQECLDSFQMDNCVFEDRVTIKGKFNDNVYFNNSIFKNYADFHECEFEKT FT ANFYGVRFNKTPNFSQAIFRGNLNAVNANLNFTFDDLQERIKQEYEDFNKNIENKKSLD FT KFANDFRDSFRTFKNALIKDNNLLDASNFHKYELYCKEIELKQNWDKRGENVKNTTDLE FT KNVSRIRDFMDFLLLGFYRKLCDHHTDFLKVFNNLILLIALYALFVFGFTWLHDDKLED FT TRAILTLFGFFDKFRLYFDIISTIFVVFGCGFFVCKLDSYEKKNNVSKKQNINFIYIIG FT DFLNLIKSLLFASFIPCVFYVLFSLFGFFLNLGKDFGYSLLINTLFVSLYICLVYTKSL FT FFGRYVVLIFSYIVFIIMLIKQPNVIHPLIGKIANESDKFFNYPSLIVLNILYTILLAL FT VLFSLQKTARKNSIVPS" FT misc_feature order(51266..51334,51398..51457,51554..51622,51635..51694, FT 51707..51766,51824..51892) FT /note="6 probable transmembrane helices predicted for FT Cj0033 by TMHMM2.0 at aa 371-393, 415-434, 467-489,494-513, FT 518-537 and 557-579" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 51410..51442 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(51967..52668) FT /transl_table=11 FT /locus_tag="Cj0034c" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0034c, probable periplasmic FT protein, len: 233 aa; similar to e.g. TR:O50817 FT (EMBL:AE000788) Borrelia burgdorferi conserved hypothetical FT protein BBK13 (238 aa), fasta scores; opt: 306 z-score: FT 257.5 E(): 4.4e-07, 28.1% identity in 231 aa overlap. No Hp FT match. Contains possible N-terminal signal sequence. FT Functional classification - Miscellaneous periplasmic FT proteins" FT /db_xref="GOA:Q0PC92" FT /db_xref="InterPro:IPR007497" FT /db_xref="UniProtKB/TrEMBL:Q0PC92" FT /protein_id="CAL34214.1" FT /translation="MKTNNIFMALAIVLASLILAFGFNKALSDFKTLERSVSVKGLSQK FT EVEADTLILPIKFTRSNNNLTNLYEELEQDKENIIKFLEKQGIKEDEISYNSPNIIDRL FT SDPYSNDTQAAYRYIGTANLLIYTQNVKLGKSILENISSLAKFGIVTKIDDYDIEYLYT FT KLNDIKPQMIEEATLNARNAAIKFAQDSNSHLGKIKKASQGQFSISNRDKNTPYIKTIR FT VVSTIEYYLKD" FT misc_feature complement(51973..52572) FT /note="HMMPfam hit to PF04402, Protein of unknown function FT (DUF541), score 2.4e-60" FT /inference="protein motif:Pfam:PF04402" FT misc_feature complement(52600..52656) FT /note="1 probable transmembrane helix predicted for Cj0034c FT by TMHMM2.0 at aa 5-23" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(52603..52668) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000015_51967_52668 by SignalP 2.0 HMM FT (Signal peptide probability 0.999) with cleavage site FT probability 0.425 between residues 22 and 23" FT CDS complement(52665..53867) FT /transl_table=11 FT /locus_tag="Cj0035c" FT /product="putative efflux protein" FT /note="Original (2000) note: Cj0035c, possible efflux FT protein, len: 400 aa; similar to many members of the FT bcr/cmlA subfamily of the major facilitator family e.g. FT BCR_ECOLI bicyclomycin resistance protein (396 aa), fasta FT scores; opt: 717 z-score: 1046.3 E(): 0, 28.1% identity in FT 398 aa overlap. No Hp ortholog. Contains 12 possible FT transmembrane domains. Also similar to Cj1375 (25.5% FT identity in 373 aa overlap)" FT /note="Updated (2006) note: Pfam domain PF07690 Major FT Facilitator Superfamily was identified within CDS. Further FT support given to product function. Some characterisation FT work within different bacteria, however, identity scores FT were marginal. Thus, putative kept within product function. FT Functional classification - Antibiotic resistance" FT /note="PMID:2694948, PMID:8486276" FT /db_xref="GOA:Q0PC91" FT /db_xref="InterPro:IPR011701" FT /db_xref="UniProtKB/TrEMBL:Q0PC91" FT /inference="protein motif:Pfam:PF07690" FT /protein_id="CAL34215.1" FT /translation="MQKHTKIHGFAKFKLIVILALMSSIAPLSTDMYLPALSHVEQSFQ FT TNSFLTQLSIASFFIAFALGQLIYGPLSDIFGRKIPALVGIFFFIVSSLFCVIIDDIYA FT FIALRFFEALGGCAGVVIARAIVNDLFEIKEAAGIFALMMVFSSLAPMLSPTFGGILLE FT YFSWHSIFATLFALGILLFLMILFGLKESAPHLKNKKFSHHEAMKSYKFVLSDKRFLVY FT ILCASFALAAMFAYITGSSFVFTQFFSLSEQKFALLFGANALGFVICANINARLVLKYE FT SEKILAKALMIMFISTVILLVNAFFHPNFLLFELSIFTSIAMLGFIAPNTTTLAMARFK FT EHSGTASAVLGTVQFGFAGLISFVVGAINANTPIILAFVMCACVLVANMIYFLIKIKEK FT K" FT misc_feature complement(order(53763..53831,53652..53720,53550..53618, FT 53487..53540,53382..53450,53301..53369,53145..53213, FT 53034..53102,52947..53015,52851..52919,52764..52832, FT 52686..52754)) FT /note="12 probable transmembrane helices predicted for FT Cj0035c by TMHMM2.0 at aa 13-35, 50-72, 84-106, FT 110-127,140-162, 167-189, 219-241, 256-278, 285-307, FT 317-339,346-368 and 372-394" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(52719..52751) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature complement(52758..53813) FT /note="HMMPfam hit to PF07690, Major Facilitator FT Superfamily, score 4.8e-52" FT /inference="protein motif:Pfam:PF07690" FT sig_peptide complement(53748..53867) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000016_52665_53867 by SignalP 2.0 HMM FT (Signal peptide probability 0.901) with cleavage site FT probability 0.388 between residues 40 and 41" FT CDS 53970..55319 FT /transl_table=11 FT /locus_tag="Cj0036" FT /product="hypothetical protein Cj0036" FT /note="Original (2000) note: Cj0036, unknown, len: 449 aa; FT 37.8% identity to HP1143 hypothetical protein. Functional FT classification - Conserved hypothetical proteins" FT /db_xref="InterPro:IPR019219" FT /db_xref="UniProtKB/TrEMBL:Q0PC90" FT /protein_id="CAL34216.1" FT /translation="MQNLNQNEQIKCPSCGSFIDISTALYAQILDKAKQEMLKQKKEFD FT DEVNAKRAEYTKALNDLKTQKIEQEKLINEQVSQKLLLEKQKFEQELLIQKQNFQKEFS FT EKFNKEHENEMKIMQEELEKKSKELSEFLSIKAENERLKREQKENEERLKFQAKEEAFK FT EFKEQESKNLEFEREKMRLEFQKSTQEQDLKYKELETNFKSVAQKLEDAQRRIEQGSQQ FT LQGEAAELLIEEYIQSEYLSDEVKEVPKGVNGADCLHIVKDNFGNICGSILYESKRTKE FT FNKEWLDKLKLDSIAAKSDIAVLITKTMPKDKEKTHFKEGILICTFNEFKGVLAVLRES FT IINAYKLKNALQNKDEKNHILYEYLNSKEFNTQITFILKTYQNMKEELEVEKRALQNIW FT KKRERAIENLSFNSTAIVSSLNAIFSDLQGGNLIGEEGIKSLENLAKDED" FT CDS complement(55343..56386) FT /transl_table=11 FT /locus_tag="Cj0037c" FT /product="putative cytochrome C" FT /note="Original (2000) note: Cj0037c, possible cytochrome FT C, len: 347 aa; weak simlarity to e.g. TR:O69780 FT (EMBL:U76906) di-heme cytochrome c (fixP) from Rhizobium FT etli (287 aa), fasta scores; opt: 97 z-score: 205.7 E(): FT 0.00034, 27.2% identity in 151 aa overlap. No Hp match. FT Contains 2x PS00190 Cytochrome c family heme-binding site FT signature and Pfam match to entry PF00034 FT cytochrome_c,Cytochrome c, score 5.90, E-value 0.11" FT /note="Updated (2006) note: No specific characterisation FT with acceptable identity scores has been carried out yet. FT Thus, putative kept within product function. Functional FT classification - Energy metabolism - Respiration -Electron FT transport" FT /db_xref="GOA:Q0PC89" FT /db_xref="InterPro:IPR011031" FT /db_xref="UniProtKB/TrEMBL:Q0PC89" FT /inference="protein motif:Pfam:PF00034" FT /inference="protein motif:Prosite:PS00190" FT /protein_id="CAL34217.1" FT /translation="MKKHILLLGLCLSLSLSAKSVSDYKVGEELSDKEGVEYFKELSKR FT PVQEWPNKNLSINDVPKGKQGDLIRYGIELLSKTESTLGPYSKLKKTSNEVNCISCHMD FT NDGNGLPGTKKYVIPFLNILNNYPRLDIETMKIISVEDRIRGMGGTDSHRFPNDSKEMK FT AILAYFKWLKEAYGIKDGVKLEGDFFAKMNFPNRPADPVRGKKLFEENCVACHGERGLG FT VKNDNYEQGSGHLYPSLLIYPDGGHMAMIPFLARFLKSAMPFGASADNPILSDEDALDI FT AAYVNTGFVRMPITTTENRAGLDTAYSKSPSLKPEYFASPQQNLDPKEYIKVKYGPWKN FT PNHFPGE" FT misc_feature complement(55520..55783) FT /note="HMMPfam hit to PF00034, Cytochrome c, score 0.0012" FT /inference="protein motif:Pfam:PF00034" FT misc_feature complement(55736..55753) FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT misc_feature complement(56078..56095) FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT sig_peptide complement(56327..56386) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000018_55343_56386 by SignalP 2.0 HMM FT (Signal peptide probability 0.999) with cleavage site FT probability 0.378 between residues 20 and 21" FT CDS complement(56564..57211) FT /transl_table=11 FT /locus_tag="Cj0038c" FT /product="putative poly(A) polymerase family protein" FT /EC_number="2.7.7.-" FT /note="Original (2000) note: Cj0038c, possible membrane FT protein, len: 215 aa; no HP match. Contains two possible FT transmembrane domains at the N-terminus" FT /note="Updated (2006) note: Pfam domain PF01743 Poly A FT polymerase family identified within CDS by carrying out own FT Pfam search. This family includes nucleic acid independent FT RNA polymerases, such as Poly(A) polymerase,which adds the FT poly(A) tail to mRNA (EC:2.7.7.19). This family also FT includes the tRNA nucleotidyltransferase that adds the CCA FT to the 3' of the tRNA (EC:2.7.7.25). Product modified to FT more specific family member due to motif match. No specific FT characterisation has been carried out yet. Thus, putative FT kept within product function. Functional classification - FT Synthesis and modification of macromolecules - DNA FT replication,restriction/modification, recombination and FT repair" FT /db_xref="GOA:Q0PC88" FT /db_xref="UniProtKB/TrEMBL:Q0PC88" FT /inference="protein motif:Pfam:PF01743" FT /protein_id="CAL34218.1" FT /translation="MDLKSLENNRLYILKRLGILKFLSIIEALLVGFLAFVFIRDALIA FT VILAVFVGVFFFRFTAKKLKLAQKELQINALNLFLRRFGAKFKKQSLSQKDFLKLGLTK FT DLKEFKSQNCFEFKDFKIYDIQFLDENKRFFCGILLEISKANKNPSFENEEQIYIKLTD FT KNFTLNHIFSKENHYLITTLSNPFFIDIKKDLESNFKDLEENLNSIKNKLFK" FT misc_feature complement(order(57095..57163,57032..57085)) FT /note="2 probable transmembrane helices predicted for FT Cj0038c by TMHMM2.0 at aa 17-39 and 43-60" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(57211..59019) FT /transl_table=11 FT /gene="typA" FT /locus_tag="Cj0039c" FT /product="GTP-binding protein TypA homolog" FT /note="Original (2000) note: Cj0039c, typA, GTP-binding FT protein typA homolog, len: 602 aa; similar to TYPA_ECOLI FT GTP-binding protein typA/bipA (591 aa), fasta scores; opt: FT 2145 z-score: 2659.1 E(): 0, 54.2% identity in 592 aa FT overlap, and to many EF-G proteins e.g. EFG_AGRTU FT elongation factor G (EF-G) (699 aa), fasta scores; opt: 344 FT z-score: 797.3 E(): 0, 26.2% identity in 715 aa overlap. FT 77.3% identity to HP0480. Contains PS00017 ATP/GTP-binding FT site motif A (P-loop), PS00301 GTP-binding elongation FT factors signature and Pfam match to entry PF00009 GTP_EFTU, FT Elongation factor Tu family (contains ATP/GTP binding FT P-loop), score 282.90, E-value 4e-81" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Thus,putative not added to product function. Homolog FT designation kept within product function. Functional FT classification - Synthesis and modification of FT macromolecules - Protein translation and modification" FT /note="PMID:7783627, PMID:9642082, PMID:14560797" FT /db_xref="GOA:Q0PC87" FT /db_xref="InterPro:IPR000640" FT /db_xref="UniProtKB/TrEMBL:Q0PC87" FT /inference="protein motif:Pfam:PF00009" FT /inference="protein motif:Prosite:PS00301" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34219.1" FT /translation="MENIRNIAVIAHVDHGKTTMVDELLKQSGTFSEREQISERVMDSN FT DIEKERGITILSKNTAINYKGTKINIIDTPGHADFGGEVERVLKMIDGVLLLVDAQEGV FT MPQTKFVVKKALSLGLKPIVVINKIDKPAADPERVINEIFDLFVALDANDEQLDFAIVY FT AAAKNGYAKLDLNDESDNMEPLFKTILERVPAPSGSDENPLQLQVFTLGYDNFVGKIGI FT ARIFNGVVKKNQSVMLAKADGTKVNGRISKLIGFMGLEKMDIEEAGSGDIVAIAGFEAL FT DVGDSVVDPNNPMPLDPLHIEEPTLSIVFSVNDGPLAGTEGKHVTSNKIAERLEAEMKT FT NIAMKYESTGEGKFKVSGRGELQITILAENMRREGFEFCMGRPEVIVKVEDGVKTEPFE FT HLVIDVPEEFSGAVIEKLGKRKAEMKTMAPTGDGQTRLEFEIPARGLIGFRSQFLTDTK FT GEGVMNHSFLEFRPFSGAVEKRNNGALISMENGVALGYSLFNLQERGVLFIEPQTKVYT FT GMIIGEHSRPNDLDVNPIKGKNLTNVRASGSDDAIKLVPPRKLSLERALEWIEEDELVE FT VTPVNVRVRKRYLDPTQRKRMEKAKS" FT misc_feature complement(57580..57843) FT /note="HMMPfam hit to PF00679, Elongation factor G FT C-terminus, score 7.8e-30" FT /inference="protein motif:Pfam:PF00679" FT misc_feature complement(58156..58368) FT /note="HMMPfam hit to PF03144, Elongation factor Tu domain, FT score 6.7e-12" FT /inference="protein motif:Pfam:PF03144" FT misc_feature complement(58429..59016) FT /note="HMMPfam hit to PF00009, Elongation factor Tu GTP FT binding domain, score 6.7e-70" FT /inference="protein motif:Pfam:PF00009" FT misc_feature complement(58846..58893) FT /note="PS00301 GTP-binding elongation factors signature" FT /inference="protein motif:Prosite:PS00301" FT misc_feature complement(58966..58989) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 59154..59477 FT /transl_table=11 FT /locus_tag="Cj0040" FT /product="hypothetical protein Cj0040" FT /note="Original (2000) note: Cj0040, unknown, len: 107 aa; FT no Hp match" FT /note="Updated (2006) note: Literature search identified FT paper giving clues to product function. Functional FT classification - Unknown" FT /note="PMID:14985343" FT /db_xref="UniProtKB/TrEMBL:Q0PC86" FT /protein_id="CAL34220.1" FT /translation="MSKPLNEEIFVEFKSDLAERKNEVLLQVLELLETFRSDENEKMAR FT ISSELTEILENEENLEKILNAKNLEELLNILTALNEDKMIKVYEDSYLKEKFPNVMVDK FT FLK" FT CDS 59493..61289 FT /transl_table=11 FT /gene="fliK" FT /locus_tag="Cj0041" FT /product="putative flagellar hook-length control protein" FT /note="Original (2000) note: Cj0041, unknown, len: 598 aa; FT 25.2% identity to HP0906, but shorter at N-term" FT /note="Updated (2006) note: Literature search identified FT papers linking product function to be involved in motility FT and invasion. Unpublished observation by N.Kamal & C. Penn FT have predicted this CDS to be fliK. Literature search FT identified work carried out in Campylobacter FT jejuni,Helicobacter pylori and Escherichia coli. Product FT function modified to more specific family member. Putative FT was kept in product function as not fully characterised. FT Functional classification - Surface structures" FT /note="PMID:12379703, PMID:14985343, FT PMID:15812042,PMID:11895937, PMID:16077121, PMID:15276839" FT /db_xref="GOA:Q0PC85" FT /db_xref="UniProtKB/TrEMBL:Q0PC85" FT /protein_id="CAL34221.1" FT /translation="MMSNLAPQNDVLNLTPSKTSTTSSSFSKTSKNKEHESSDSKNSTQ FT DDTESFLNSLLNSINETNEFLPDHMKISQKEVVNEAMSRLQKGAFDESDKISIFESASF FT MQILSLLDKLKTDTADVKLANLSTQLSSLIKTEANFNALKGASNLSELLDIAKDLGLNV FT KNIKVDRLLDLKATFPNLDKADFFKGAVDNVFKEIINNKISNVSKNLNHNLENTTHTTS FT THSMQKTNSKDSGSLLSQTLKNLDSILSSKESKHEKNDKVKSKIEEDTTDAKNTLKNIK FT NDEFAKNLTEELNIKDKKNQDNLNKESKDLNKDFNKELNKNQEKNNLNQENIQDQNKNL FT KNNDQNLNLDKNLNKEIVKDTQKLVSNLTQKDFNLNKEPKNNNKENKDIKQNFFDQKLN FT FENLNKTQVVQNKENNANFNNNNTNNKETFTQEQTKTHSENVDKNSLDELNSLVKDLNK FT VTQNNARNITPKETLQYFSQDLKEAVDQYKAPITKLSITLNPNNLGEVEVTLIQRGNNL FT HINFNSNANAMNLFIQNQAEFKNSLVNMGFTGLEMNFSDQGKREQNQNQGKNRSGYGFK FT DALDGKNESEKVNLELVLAKYF" FT CDS 61343..62227 FT /transl_table=11 FT /gene="flgD" FT /locus_tag="Cj0042" FT /product="putative flagellar hook assembly protein" FT /note="Original (2000) note: Cj0042, flgD, possible FT flagellar hook assembly protein, len: 294 aa; similar in FT part to flgD from e.g. TR:Q44920 (EMBL:L76303) flagellar FT hook assembly protein flgD, Borrelia burgdorferi (147 FT aa),fasta scores; opt: 170 z-score: 215.7 E(): 9.3e-05, FT 38.8% identity in 67 aa overlap, and TR:O07893 FT (EMBL:U42012) flgD, Treponema pallidum (153 aa), fasta FT scores; opt: 165 z-score: 208.0 E(): 0.00025, 42.0% FT identity in 88 aa overlap. 28.9% identity to HP0907" FT /note="Updated (2006) note: Pfam domain PF03963 Flagellar FT hook capping protein was identified within CDS. Further FT support given to product function. Alignment does not cover FT full sequence length. No specific characterisation with FT acceptable identity score has been carried out yet. Thus, FT putative not added to product function. Functional FT classification - Surface structures" FT /note="PMID:8049271" FT /db_xref="GOA:Q0PC84" FT /db_xref="InterPro:IPR005648" FT /db_xref="UniProtKB/TrEMBL:Q0PC84" FT /inference="protein motif:Pfam:PF03963" FT /protein_id="CAL34222.1" FT /translation="MISSSDWNLNTTATTSGTTSSGSTSGTTRTDSSSSSGIVSNPNAT FT LDKDAFLKLLLIELQHQDPTDPMDSDKMLTQTSQLSALEMQQNTNTTMQKMVETMQKLS FT DSFSTSMSTSALGAIGKMATVSDNKIKLTGADELIALKMYLPEDSDENGVTLEIYDSNN FT KLVFSEKSDAKSISQGLFTMEWPGRNNDGVYAGDGEYTVKMVYNNKNGEKITANYGTYP FT IEGVVFKDGVAYAKMAGQEVPFDAIQEITDYKLGSSSSTGGSGSSGDSSGGSSDGDSSG FT SGSTEDGDKEEKA" FT misc_feature 61382..61852 FT /note="HMMPfam hit to PF03963, Flagellar hook capping FT protein, score 1.4e-60" FT /inference="protein motif:Pfam:PF03963" FT CDS 62231..63868 FT /transl_table=11 FT /gene="flgE" FT /locus_tag="Cj0043" FT /product="flagellar hook protein" FT /note="Original (2000) note: Cj0043, flgE, probable FT flagellar hook protein, len: 545 aa; similar to e.g. FT FLGE_BORBU flagellar hook protein flgE (442 aa), fasta FT scores; opt: 350 z-score: 665.8 E(): 7.9e-30, 27.5% FT identity in 553 aa overlap. 24.5% identity to HP0908. FT Contains PS00588 Flagella basal body rod proteins signature FT and Pfam match to entry PF00460 flg_bb_rod,Flagella basal FT body rod proteins, score 37.00, E-value 6.7e-08" FT /note="Updated (2006) note: Characterised within Borrilia FT burgdorferi and also some work within Campylobacter jejuni. FT Identity scores were marginal. Appropriate motifs were FT present and alignments covered full length of sequence. FT Thus, putative not added to product function. Functional FT classification - Surface structures" FT /note="PMID:9658019, PMID:9244248, PMID:9079915" FT /db_xref="GOA:Q0PC83" FT /db_xref="InterPro:IPR010930" FT /db_xref="UniProtKB/TrEMBL:Q0PC83" FT /inference="protein motif:Pfam:PF00460" FT /inference="protein motif:Prosite:PS00588" FT /protein_id="CAL34223.1" FT /translation="MMNSFYNGISGVKSNSFGIDITANNIANVNTTGFKYSDAQFKDIF FT YTTITTQSTNPAQGGYGSGAASSQVVFEQGSPVASDGEFDVALQGKGFFGVLGADGNAY FT YTRNGSFRRDANGYLVDSYGNFVLGTMNPAFTGINYSDRVAGLMGDYLNTGTPVNNGFT FT VNSNNSFSIGTTASQGAIKVPVNMYLPPQVTQNVKWSGSLNTNTTTEVVKVDLDPSKFN FT ITKTEDGKYVVSGSVSKEDVFSAKAGDRIILNFTDDNGVKTSFEATLDENLNFKSNELD FT LKGLDENSIKLDTAQISTEQQKANKDILESPIYNADGSKSTLRVTLERVLPQEGDNIQY FT KAIAQIYDSNGNAVGNPTEGNMVFDKNGALLQNNITSIANPNGGTINIDLGSPYDANKP FT GSGYSGIYIKQGVEKNVVTQQDGVAEGFFEQYNISDDGSIVAQFSNGKNAIVGKLALYN FT FINEQGLVAMGDNIFAATANSGDASFIMKDGQVVNTAKFKGGFLEQSNVDLSAELSNLI FT VTQKAFDASSKSITTSDQMIQKAINMKR" FT misc_feature 62243..62335 FT /note="HMMPfam hit to PF00460, Flagella basal body rod FT protein, score 1.4e-08" FT /inference="protein motif:Pfam:PF00460" FT misc_feature 62261..62323 FT /note="PS00588 Flagella basal body rod proteins signature" FT /inference="protein motif:Prosite:PS00588" FT misc_feature 63140..63439 FT /note="HMMPfam hit to PF07559, Flagellar basal body protein FT FlaE, score 1.9e-29" FT /inference="protein motif:Pfam:PF07559" FT misc_feature 63743..63859 FT /note="HMMPfam hit to PF06429, Domain of unknown function FT (DUF1078), score 8.8e-18" FT /inference="protein motif:Pfam:PF06429" FT CDS complement(63872..65743) FT /transl_table=11 FT /locus_tag="Cj0044c" FT /product="hypothetical protein Cj0044c" FT /note="Original (2000) note: Cj0044c, unknown, len: 623 aa; FT no Hp ortholog, Also similar to Cj0800c (28.5% identity in FT 625 aa overlap). Preceeded by a C(9-11) polymorphic region; FT C11 would allow the translation of Cj0045c to extend by FT another 15aa, overlapping the start of this CDS; C9 and C10 FT (consensus) have no effect" FT /note="Updated (2006) note: Literature search identified FT paper giving further clues to product function. Functional FT classification - Conserved hypothetical proteins" FT /note="PMID:14985343" FT /db_xref="InterPro:IPR005646" FT /db_xref="UniProtKB/TrEMBL:Q0PC82" FT /protein_id="CAL34224.1" FT /translation="MNFQVKTLETFNPFESLNHEQANTEQILDFRVIDFKLLCSSVKPA FT KTKTYERKDFDLFYADDFFVKNYNTIVQKFLIEIYPKTQSFPFTVKLRSNSNLTHLKAS FT INLTENFKYYPNLKFDILQNIYKIMIKQKFLILRLDKNLFDKIDDFILSIQKSPSIKEI FT ELEIAKGVDKIEHKSDEIIYHRDVNEECFDENINYDEGNYCKPIEKNELLFEYIYRILG FT KEGRNLRGEILHLNPIAFLDNPFIIKDESIYTEELEDRIKYFSANYGFLNKDHTGYCIA FT NNLKLSQIGLKTTGSIKTNTDENINLEITNFDISDDAIKSGIVNVQASNIKVNGNVGAT FT KLYGKNISIKGLTHAKSEIFAQDIFITTHKGTLQADTVYIKNLENGTIIAKNVFVENCM FT GGKIEAENIYICNLLTDNTLYPRKNLIITNNIKFKNNIVVSPLVSIENNSDTECENLKN FT LSLKIKSKLDDTISKMQNYYDYLIKNQIKIIKLQKTKNPSAIEMKFSNLYHDIIKKYNH FT LSISYKKLVKLKYQIDAKLNFLNEMVYNVKIYIKAENIGEDNFLKFYPNTNTNLELKHH FT INLKDYEKVLYLEKGQQVSYIKSSHNYSESDIEEIKIIFKKLEKDNS" FT CDS complement(65744..66466) FT /transl_table=11 FT /locus_tag="Cj0045c" FT /product="putative iron-binding protein" FT /note="Original (2000) note: Cj0045c, possible iron-binding FT protein, len: 240 aa; weak similarity to members of the FT eukaryotic iron-binding hemerythrin family,e.g. HEMT_LINUN FT hemerythrin alpha chain (117 aa), fasta scores; opt: 105 FT z-score: 137.1 E(): 2.5, 23.8% identity in 122 aa overlap. FT Note that all of the iron-binding residues are conserved. FT No Hp match, similar to Cj0072c (pseudogene), Cj0241c FT (30.9% identity in 123 aa overlap) and Cj1224 (27.7% FT identity in 202 aa overlap). Contains a C(9-11) polymorphic FT region at the N-terminus; C11 would allow the translation FT of this CDS to extend by another 15aa, overlapping the FT start of Cj0044c; C9 and C10 (consensus) have little FT effect" FT /note="Updated (2006) note: Pfam domain PF01814 Hemerythrin FT HHE cation binding domain identified within CDS. No FT specific characterisation with acceptable identity score FT has been carried out yet. Thus, putative kept within FT product function. Literature search identified paper giving FT further clues to product function. Functional FT classification - Transport/binding proteins - Cations" FT /note="PMID:14985343" FT /db_xref="GOA:Q0PC81" FT /db_xref="InterPro:IPR016131" FT /db_xref="UniProtKB/TrEMBL:Q0PC81" FT /inference="protein motif:Pfam:PF01814" FT /protein_id="CAL34225.1" FT /translation="MKVKWSRDFSIKNMQLDKQHELIFEITNLANDLALNIQDNNTQHK FT NDLKQILVKLFQYIKIHFKDEEKFMESIDFPLIEEHKKSHQILVEKTKELLEHSNDIVK FT MSQELSILTKDWILDHFANEDLWIANFTKKTLHLQEIHYTLEQYIKLKSIKQDLRAEKT FT YDYICNCSLRIHAVPQTIHQELVSKENTLKCEKCGQILVHLDYFDLNQNFEKFNAIFED FT ALQNHHFTTQENDMRGGG" FT misc_feature complement(66074..66238) FT /note="HMMPfam hit to PF01814, Hemerythrin HHE cation FT binding domain, score 0.0046" FT /inference="protein motif:Pfam:PF01814" FT misc_feature complement(66248..66433) FT /note="HMMPfam hit to PF01814, Hemerythrin HHE cation FT binding domain, score 0.0029" FT /inference="protein motif:Pfam:PF01814" FT misc_RNA 66646..66744 FT /note="Bacterial signal recognition particle RNA" FT /note="Updated (2006) note: Running Rfam search revealed FT new non-coding RNA families within Campylobacter jejuni. FT Rfam RF00169, Bacterial signal recognition particle RNA was FT identified within CDS. This SRP is a univerally conserved FT ribonucleoprotein involved in the co-translational FT targeting of proteins to membranes" FT CDS join(66985..67113,67229..67411,67411..67602,67602..67940, FT 67942..68203,68205..68278,68277..68504) FT /pseudo FT /transl_table=11 FT /locus_tag="Cj0046" FT /product="pseudogene (putative sodium:sulfate transmembrane FT transport protein)" FT /note="Original (2000) note: Cj0046, probable transmembrane FT transport protein pseudogene, len: 1559 bp; fragmentary FT similarity in all three reading frames to members of the FT SODIT1 subfamily of the NADC/P/PHO87 family of transporters FT e.g. SOT1_SPIOL 2-oxoglutarate/malate translocator FT precursor (spinach) (569 aa), fasta scores; opt: 278 FT z-score: 498.4 E(): 1.7e-20, 45.0% identity in 80 aa FT overlap, and YBHI_ECOLI (477 aa) fasta scores; opt: 196 FT z-score: 361.3 E(): 7.2e-13, 34.6% identity in 78 aa FT overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF00939 FT Sodium:sulfate symporter transmembrane identified within FT CDS. Also, ten probable transmembrane helices predicted by FT TMHMM2.0. Further support given to product function. No FT specific characterisation with acceptable identity scores FT yet. Thus, putative added to product function. Coding FT sequence has been updated to reflect the complete amino FT acid sequence for the encoded protein regardless of its FT expression. This will cause differences from the amino acid FT sequence of the previous annotation. Functional FT classification - Transport/binding proteins - Other" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00939" FT misc_feature order(66985..67113,67229..67411,67411..67602,67602..67940, FT 67942..68203,68205..68277,68278..68492) FT /note="HMMPfam hit to PF00939, Sodium:sulfate symporter FT transmembrane, score 8.5e-118" FT /inference="protein motif:Pfam:PF00939" FT misc_feature order(67012..67080,67289..67357,67719..67787,67875..67940, FT 67942..67944,67957..68025,68050..68118,68161..68203, FT 68205..68230,68249..68277,68278..68315,68328..68396, FT 68415..68483) FT /note="10 probable transmembrane helices predicted for FT Cj0046 by TMHMM2.0 at aa 10-32, 64-86, 208-230, FT 260-282,287-309, 318-340, 355-377, 384-406, 411-433 and FT 440-462" FT /inference="protein motif:TMHMM:2.0" FT stem_loop 68496..68544 FT CDS complement(68532..69548) FT /transl_table=11 FT /gene="trmU" FT /locus_tag="Cj0053c" FT /product="tRNA FT (5-methylaminomethyl-2-thiouridylate)-methyltransferase" FT /EC_number="2.1.1.61" FT /note="Original (2000) note: Cj0053c, trmU, probable tRNA FT (5-methylaminomethyl-2-thiouridylate)-methyltransferase,len: FT 338 aa; similar to many e.g. TRMU_ECOLI tRNA FT (5-methylaminomethyl-2-thiouridylate)-methyltransferase (EC FT 2.1.1.61) (383 aa), fasta scores; opt: 249 z-score: 751.3 FT E(): 0, 32.7% identity in 358 aa overlap. 45.8% identity to FT HP1335 conserved hypothetical protein" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Thus,putative not added to product function. Functional FT classification - Aminoacyl tRNA synthetases and their FT modification" FT /note="PMID:4703553, PMID:3298234" FT /db_xref="GOA:Q9PJ66" FT /db_xref="InterPro:IPR018318" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ66" FT /protein_id="CAL34227.1" FT /translation="MKILVAMSGGVDSTVTAYKLKNLGHEVIGCYMKLHGKPNYHEENI FT KKVEKVANFLQIPYHILDLQEDFKNKVYMPFVDTYKEGKTPNPCALCNRFIKLGKLLEF FT AKSLGCEKLATGHYARLENNLIKTAVDESKDQSYFLASADKEALKYLIFPLGEMKKEDV FT KKFASTIEVLKSFATQKESSEICFVEDTYVQVLDQFMDTKIPGEVLDSSGKVVGKHEGY FT MHYTIGKRRGFEVRGAHEPHFVLKINPKQNQIIVGTKEELKISEFNLKNINLFIDAKEL FT DCEVKIRYRSKSTPCKVEIYEDKSAKIILKDPVYGLASGQMAVFYDHDKVIASGFIE" FT misc_feature complement(68538..69548) FT /note="HMMPfam hit to PF03054, tRNA methyl FT transferase,score 1.3e-132" FT /inference="protein motif:Pfam:PF03054" FT CDS complement(69548..70153) FT /transl_table=11 FT /locus_tag="Cj0054c" FT /product="putative lysine decarboxylase family protein" FT /note="Original (2000) note: Cj0054c, unknown, len: 201 aa; FT similar to hypothetical proteins e.g. TR:Q46063 FT (EMBL:X81379) Corynebacterium glutamicum hypothetucal FT protein (211 aa), fasta scores; opt: 426 z-score: 696.2 FT E(): 1.6e-31, 44.2% identity in 156 aa overlap. No Hp FT match" FT /note="Updated (2006) note: Pfam domain PF03641 possible FT lysine decarboxylase family identified within CDS. Product FT modified to more specific family member due to motif match. FT No specific characterisation with acceptable identity score FT has been carried out yet. Thus, putative kept within FT product function. Functional classification -Misc" FT /db_xref="InterPro:IPR005269" FT /db_xref="UniProtKB/TrEMBL:Q0PC79" FT /inference="protein motif:Pfam:PF03641" FT /protein_id="CAL34228.1" FT /translation="MNEKISQDLEKFANIPNLKNAVTFFGSARLKEDNFYYQQAKILAQ FT KCVQNGFCVISGGGGGIMRAANEGAFSQNNNTNSMSSVGFNIFLPHEQKLNDFVEYNIT FT FESLAIRKMALIEKSLAFVIFPGGFGTLDELCEILTLKQLEFKKDVPIILFGSEFWRGF FT DEFVRNSLLKLEVISKGDELKYKITDDLDFIINTLKEI" FT misc_feature complement(69551..69967) FT /note="HMMPfam hit to PF03641, Possible lysine FT decarboxylase, score 2.2e-53" FT /inference="protein motif:Pfam:PF03641" FT CDS complement(70274..71098) FT /transl_table=11 FT /locus_tag="Cj0055c" FT /product="conserved hypothetical protein Cj0055c" FT /note="Original (2000) note: Cj0055c, unknown, len: 274 aa; FT no Hp match, similar in C-terminus to Cj0122 (46.6% FT identity in 148 aa overlap)" FT /note="Updated (2006) note: Contains Prosite match PS01164 FT COPPER_AMINE_OXID, Copper amine oxidase. Amine oxidases are FT enzymes that catalyze the oxidation of different biogenic FT amines e.g. neurotransmitters. Copper-containing amine FT oxidases are found in bacteria. This particular form binds FT one copper ion per subunit as well as a FT 2,4,5-trihydroxyphenylalanine quinone (or topaquinone) FT (TPQ) cofactor (PMID:8591028). Functional classification FT -Unknown" FT /note="PMID:8591028" FT /db_xref="InterPro:IPR000269" FT /db_xref="UniProtKB/TrEMBL:Q0PC78" FT /inference="protein motif:Prosite:PS01164" FT /protein_id="CAL34229.1" FT /translation="MVGILSSKEEKLMINSLNSNLNYDYNTSNFKQDKNIDFKINKHGV FT AVITGEGALPYRGKKFEYNPKIFGLDESISKKDMQEFNNFMKSNALKDPNKIEKSPLKD FT FNPAYTKWDPTTEKMMLGFFVSYSKMFHLGYDIIKKADEFYKEFDALISKDLSLNEFKT FT KYIDFKQRYDEFVKEYEMAMGDKMLLSSDDEIITQQSEKPFKAIQGESKNKETYKDDST FT RNELVKKLLEGKFSTSKELELLFGMKFSDDDAGEFNKILSLNSTPKSIDIKA" FT misc_feature complement(71024..71065) FT /note="PS01164 Copper amine oxidase topaquinone signature" FT /inference="protein motif:Prosite:PS01164" FT CDS complement(71155..71571) FT /transl_table=11 FT /locus_tag="Cj0056c" FT /product="hypothetical protein Cj0056c" FT /note="Original (2000) note: Cj0056c, unknown, len: 138 aa. FT No Hp match" FT /note="Updated (2006) note: Literature search identified FT paper giving clues to product function. Functional FT classification - Unknown" FT /note="PMID:14702320" FT /db_xref="UniProtKB/TrEMBL:Q0PC77" FT /protein_id="CAL34230.1" FT /translation="MKEVKGGYITYLKRLSDNEVIAFAKPDWNLELTLFQDSNGDQYYW FT NREGLVRFGGMCGIETTNCLVNSKHSYINQKRLWETMSIVGDDPYRNFLGYTVKRNIGI FT SNLGKRFVYFSYGVAVINEQSGSWYRVKSSPVFE" FT CDS 72005..72859 FT /transl_table=11 FT /locus_tag="Cj0057" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0057, possible periplasmic FT protein, len: 284 aa; no Hp match. Contains possible FT N-terminal signal sequence. Functional classification FT -Miscellaneous periplasmic proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PC76" FT /protein_id="CAL34231.1" FT /translation="MKKIFLTFMVLVNCVFASDELNIDSLFKKQIGLRSITSFSLLSTG FT NANSYSLYPNITIGGDPTIWNDTKQVFLTQTFIYTLTPKFDILISGGGSYARQEYTNFF FT TNAYSHKDRIGFDNLWLGFIYTGDSIADLIPQITFQTAVVQREKAINQTKNFYLKSQSL FT QASLRGYSDPVVYSIYTGFGYNQSRKFKTLKIEYGNSIYVGGDLSIILSPKITLDLGAE FT QRFQMKQKINGYQNSEVRSIPTLSLGSTYSINSDTAVSVNASFGGSSASPDSIFGISLW FT KKF" FT sig_peptide 72005..72055 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000026_72005_72859 by SignalP 2.0 HMM FT (Signal peptide probability 0.783) with cleavage site FT probability 0.723 between residues 17 and 18" FT CDS 72844..73443 FT /transl_table=11 FT /locus_tag="Cj0058" FT /product="putative peptidase C39 family protein" FT /note="Original (2000) note: Cj0058, possible periplasmic FT protein, len: 199 aa; no Hp match. Contains possible FT N-terminal signal sequence" FT /note="Updated (2006) note: Pfam domain PF03412 Peptidase FT C39 family identified within CDS. Product modified to more FT specific family member based on motif match. No specific FT characterisation with acceptable identity scores carried FT out yet. Thus, putative kept within product function. FT Functional classification - Degradation of macromolecules - FT Proteins, peptides and glycopeptides" FT /db_xref="GOA:Q0PC75" FT /db_xref="InterPro:IPR005074" FT /db_xref="UniProtKB/TrEMBL:Q0PC75" FT /inference="protein motif:Pfam:PF03412" FT /protein_id="CAL34232.1" FT /translation="MEKILKILLFLPILALSTKAEWVVKSYQEIKNERVIRQTYEQSCG FT ASSLATLLNILDDQKKFDELELLKIMSGQELYTDMVSFADLNDAVKKLGFQSNSYQINR FT ENLDKLVNIPMLVKIEDDPRFPHFVIIINHKGNYLQVLDPSHGEYISSKSQFFSIWDRY FT NKGGYALIVAPKKELKPFKLNTPKSLHFDFSPFSLF" FT misc_feature 72949..73374 FT /note="HMMPfam hit to PF03412, Peptidase C39 family, score FT 4.5e-11" FT /inference="protein motif:Pfam:PF03412" FT CDS complement(73492..74334) FT /transl_table=11 FT /gene="fliY" FT /locus_tag="Cj0059c" FT /product="putative flagellar motor switch protein" FT /note="Original (2000) note: Cj0059c, fliY, probable FT flagellar motor switch protein, len: 280 aa; similar to FT e.g. TR:P74928 (EMBL:U36839) Treponema pallidum flagellar FT motor switch protein fliY (348 aa), fasta scores; opt: 277 FT z-score: 496.5 E(): 2.1e-20, 26.2% identity in 309 aa FT overlap. Also similar in C-terminus to FLIN_BORBU flagellar FT motor switch protein fliN (113 aa), fasta scores; opt: 231 FT z-score: 362.5 E(): 6.2e-13, 44.2% identity in 77 aa FT overlap. 39.7% identity to HP1030. Contains Pfam match to FT entry PF01052 SPOA_protein, Surface presentation of FT antigens (SPOA) protein, score 52.80,E-value 7.5e-12" FT /note="Updated (2006) note: Chararcterisation has been FT carried out within Escherichia coli and Bacillus FT subtilis,however, only partial sequence alignment was FT achieved. Thus, putative kept within product function. FT Functional classification - Cell envelope - Surface FT structures" FT /note="PMID:1447979, PMID:1898932, PMID:14749334" FT /db_xref="GOA:Q0PC74" FT /db_xref="InterPro:IPR001543" FT /db_xref="UniProtKB/TrEMBL:Q0PC74" FT /inference="protein motif:Pfam:PF01052" FT /protein_id="CAL34233.1" FT /translation="MINDFLKMFTNECISTIEGLTGKSAEFSEYKEFDVNTSDTLKAPL FT VYAIFNIANGGKIGILAGAILMSAIGEWMMGEEEITKNDKLGPDEMDAAKEAIQNIISA FT FSTTLGAQKDIPKMDFSIESCEFVPESVDFKDFKKLFLYDVKIGDLEEQVSLAMDQTLH FT NILSGKPAETGNTSTDSNHNTEEKAIMLSEELKNINLIMDVRLPVRVRIGNKKMLLKDV FT LTMDIGSVVELNQLANDPLEILIGDKRIAYGEVVIVDGNFGVQITEIGSKKERLEQLR" FT misc_feature complement(73516..73746) FT /note="HMMPfam hit to PF01052, Surface presentation of FT antigens (SPOA) prot, score 6.1e-24" FT /inference="protein motif:Pfam:PF01052" FT CDS complement(74331..75410) FT /transl_table=11 FT /gene="fliM" FT /locus_tag="Cj0060c" FT /product="flagellar motor switch protein" FT /note="Original (2000) note: Cj0060c, fliM, probable FT flagellar motor switch protein, len: 359 aa; simlar to e.g. FT FLIM_BACSU flagellar motor switch protein fliM (332 aa), FT fasta scores; opt: 728 z-score: 1046.5 E(): 0, 35.6% FT identity in 329 aa overlap. 61.1% identity to HP1031" FT /note="Updated (2006) note: Pfam domain PF01052 Surface FT presentation of antigens (SPOA) protein and PF02154 FT Flagellar motor switch protein FliM were identified within FT CDS. Further support given to product function. FT Characterised within Bacillus subtilis with acceptable FT identity score. Thus, putative not added to product FT function. Functional classification - Cell envelope FT -Surface structures" FT /note="PMID:1898932, PMID:8169223" FT /db_xref="GOA:Q0PC73" FT /db_xref="InterPro:IPR001543" FT /db_xref="UniProtKB/TrEMBL:Q0PC73" FT /inference="protein motif:Pfam:PF02154" FT /inference="protein motif:Pfam:PF01052" FT /protein_id="CAL34234.1" FT /translation="MAEILSQEEIDALLEVVDDNTDTPIASNSKDEKDERNIVVYDFKR FT PNRVSKEQLRTIKGIHDKLARNLASQISSMMRSIVETKLHSVDQMTYGEFLMSLPSPTS FT FNVFSIKPLDGNCVLEINPSIAFPMIDRLLGGQGDSYEASRELTDIELNLLDSILRIIM FT QRLKESWATVTEIYPSIEAKESSPNVVQIVSQNEIVIMVVMEIIIGNSSGMVNICYPVV FT HLESILSRLANRDIMMGETSAKKSRNKELKTLIGRAEVVYEAILGKTLINVHEFLELKQ FT GDILRLDREADDKAIVSIDKKDVFLAQIGLHRFRKSIKILELIRTDKDEIKEILEKYEE FT ERKAKASVYDEPEEEDEEI" FT misc_feature complement(74430..74660) FT /note="HMMPfam hit to PF01052, Surface presentation of FT antigens (SPOA) prot, score 0.00022" FT /inference="protein motif:Pfam:PF01052" FT misc_feature complement(74718..75290) FT /note="HMMPfam hit to PF02154, Flagellar motor switch FT protein FliM, score 8.3e-105" FT /inference="protein motif:Pfam:PF02154" FT CDS complement(75410..76126) FT /transl_table=11 FT /gene="fliA" FT /locus_tag="Cj0061c" FT /product="RNA polymerase sigma factor for flagellar operon" FT /note="Original (2000) note: Cj0061c, fliA, probable RNA FT polymerase sigma factor for flagellar operon, len: 238 aa; FT similar to many e.g. FLIA_ECOLI RNA polymerase sigma factor FT for flagellar operon (sigma-F factor) (239 aa),fasta FT scores; opt: 235 z-score: 539.0 E(): 9.1e-23, 31.6% FT identity in 225 aa overlap. 54.9% identity to HP1032. FT Contains PS00716 Sigma-70 factors family signature 2, Pfam FT match to entry PF00140 sigma70, Sigma-70 factors, score FT 91.20, E-value 2e-23 and helix-turn-helix motif (Score FT 1846, +5.47 SD)" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni, Escherichia coli and Helicobacter FT pylori. Thus, putative removed from product function. FT Functional classification - Cell envelope - Surface FT structures" FT /note="PMID:11292815, PMID:7590326, PMID:11985711" FT /db_xref="GOA:Q0PC72" FT /db_xref="InterPro:IPR011991" FT /db_xref="UniProtKB/TrEMBL:Q0PC72" FT /inference="protein motif:Pfam:PF00140" FT /inference="protein motif:Prosite:PS00716" FT /protein_id="CAL34235.1" FT /translation="MNSKKDEEMLKEPPKAYAQMLKKEQDELVLSYMPALRAMAFRLKE FT RLPSSIDVNDLISIGVEEMIKLSRRYDKEQNDNFWGFARKRVNGSMLDYLRSLDVMSRN FT NRKIIKDIDAIMDEYFLEHECEPDDEYLAKKLDLDVEKIKEVRTAHAISYTLPIDEQIE FT LYNEDNTLEKIEKEELLEKIHEVLDDLKERDQLIIQLYYYEELSLKEISEILQISESRI FT SQIHKKLLKKLRERLV" FT misc_feature complement(75422..75571) FT /note="HMMPfam hit to PF04545, Sigma-70, region, score FT 5.8e-19" FT /inference="protein motif:Pfam:PF04545" FT misc_feature complement(75428..75508) FT /note="PS00716 Sigma-70 factors family signature 2" FT /inference="protein motif:Prosite:PS00716" FT misc_feature complement(75827..76045) FT /note="HMMPfam hit to PF04542, Sigma-70 region, score FT 3.3e-12" FT /inference="protein motif:Pfam:PF04542" FT CDS complement(76083..76439) FT /transl_table=11 FT /locus_tag="Cj0062c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0062c, probable integral FT membrane protein, len: 118 aa; no Hp match. Contains two FT possible transmembrane domains. Functional classification - FT Cell envelope - Membranes, lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PC71" FT /protein_id="CAL34236.1" FT /translation="MRPENYVAFFTVCGFFIGLAFSIISIDEAFDILIFTCFITFMFYV FT FVHIAIMNFIDVKKISGRIFNKHDYEKTSNNIINDLVIREKKMDIILEKLNEEREELKK FT NEFKERRRNAKRAA" FT misc_feature complement(order(76362..76421,76278..76346)) FT /note="2 probable transmembrane helices predicted for FT Cj0062c by TMHMM2.0 at aa 7-26 and 32-54" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(76458..77324) FT /transl_table=11 FT /locus_tag="Cj0063c" FT /product="putative ATP-binding protein" FT /note="Original (2000) note: Cj0063c, probable ATP-binding FT protein, len: 288 aa; similar to hypothetical proteins in FT other flagellar operons e.g. YLXH_BACSU hypothetical 33.2 FT kd protein in flhF-cheB intergenic region (298 aa), fasta FT scores; opt: 390 z-score: 493.5 E(): 3.1e-20, 29.0% FT identity in 293 aa overlap, and to cell division proteins FT e.g. MIND_BACSU septum site-determining protein minD (268 FT aa), fasta scores; opt: 323 z-score: 417.6 E(): FT 5.3e-16,32.9% identity in 249 aa overlap. 45.7% identity to FT HP1034. Contains PS00017 ATP/GTP-binding site motif A FT (P-loop) and Pfam match to entry PF00991 ParA, ParA family FT ATPase, score 34.80, E-value 1.3e-06" FT /note="Updated (2006) note: No specific characterisation FT with acceptable identity score carried out yet. FT Thus,putative kept within product function. Functional FT classification - Cell envelope - Surface structures" FT /db_xref="GOA:Q0PC70" FT /db_xref="InterPro:IPR002586" FT /db_xref="UniProtKB/TrEMBL:Q0PC70" FT /inference="protein motif:Pfam:PF00991" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34237.1" FT /translation="MNNQANKLRNLMSQNGTKKSQNTHFIAITSGKGGVGKSTISANLA FT NVLANNGYKVGLFDADIGLANLDVILNVRIQKNLLHVLRGECSLEDILIEVKPNLWLIP FT GESGDEILKYNDKNIYERFLNQASILDELDFLIIDTGAGIGGNILNFLEMADEVIVVTV FT PDPAAITDAYATIKTTSKTKENLLMLFNVVKNENEALKVFENIKKVADANIKNPLNLEF FT LGHLSASKDVSGSIKKRTLFSDENTASSDEIKALASKLLYRLERKVLDNVSNRSFSSFF FT RKIIERF" FT misc_feature complement(76623..77249) FT /note="HMMPfam hit to PF01656, CobQ/CobB/MinD/ParA FT nucleotide binding domai, score 5.8e-21" FT /inference="protein motif:Pfam:PF01656" FT misc_feature complement(77211..77234) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(77317..78771) FT /transl_table=11 FT /gene="flhF" FT /locus_tag="Cj0064c" FT /product="flagellar biosynthesis protein" FT /note="Original (2000) note: Cj0064c, flhF, flagellar FT biosynthesis protein, len: 484 aa; similar to e.g. FT FLHF_BACSU flagellar biosynthesis protein flhF (366 FT aa),fasta scores; opt: 406 z-score: 483.3 E(): 1.2e-19, FT 32.0% identity in 256 aa overlap. 99.0% identity to FT TR:O52908 (EMBL:AJ000857) C. jejuni flhF protein (fragment) FT (104 aa). 40.9% identity to HP1035. Contains PS00017 FT ATP/GTP-binding site motif A (P-loop) and Pfam match to FT entry PF00448 SRP54, SRP54-type protein, score FT -25.00,E-value 1.8e-09" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni and Bacillus subtilis. Thus, putative FT not added to product function. Functional classification FT -Cell envelope - Surface structures" FT /note="PMID:10792727, PMID:14617189, PMID:15317803" FT /db_xref="GOA:O52908" FT /db_xref="HSSP:1J8Y" FT /db_xref="InterPro:IPR020006" FT /db_xref="UniProtKB/Swiss-Prot:O52908" FT /inference="protein motif:Pfam:PF00448" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34238.1" FT /translation="MGQLIHTFTVEDTEQIIPKVKEDYGDKALIITNKQIRPKTLNRSA FT LYEVMVAIEESDYEEHLKKQGKSLPAKKSSPKPSSTSLAEEKIRSQIPQEDEDVVLDFS FT NTRLNTNLNTVKNNDLAKKTYQDFPQNKINPHQNKTLGFDDFKEKLSEVSNEISKVTNT FT PLENYTPNPNYNKKIENFEKQFEKQINKLNDKIDLLADMMWDDKAEARKNLMIPPEFAS FT IYKQAKESGMLENHLEAIMKATIENMPAAMKTNKDAVQRYFHSLLRNILPCRVESDIKK FT QKIMMLVGPTGVGKTTTLAKLAFRYAYGDKRYKTGIITLDTYRIGAVEQLFQYAKMMKL FT PIIDSIEPKDLDEAIKSLNNCEVILVDTIGNSQYDQSKLAKTKEFLMHSNAEIDVNLVV FT SANTKHEDLMEIYKNFSFLNIDTLIITKFDETKVFGNIFSLVYETNIPLSFFSIGQEVP FT DDLEVANSDFLVHCILEGFNKGKNNE" FT misc_feature complement(77347..77931) FT /note="HMMPfam hit to PF00448, SRP54-type protein, GTPase FT domain, score 1.9e-40" FT /inference="protein motif:Pfam:PF00448" FT misc_feature complement(77884..77907) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(78781..79254) FT /transl_table=11 FT /gene="folK" FT /locus_tag="Cj0065c" FT /product="putative FT 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine FT pyrophosphokinase" FT /EC_number="2.7.6.3" FT /note="Original (2000) note: Cj0065c, folK, possible FT 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine FT pyrophosphokinase, len: 157 aa, similar to e.g. HPPK_BACSU FT 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine FT pyrophosphokinase (EC 2.7.6.3) (167 aa), fasta scores; opt: FT 194 z-score: 370.0 E(): 2.4e-13, 28.7% identity in 129 aa FT overlap. 35.6% identity to HP1036. Contains Pfam match to FT entry PF01288 FT HPPK,7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase FT (HPPK), score 4.10, E-value 1.1e-06" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis and Escherichia coli, however, identity scores FT were marginal. Thus, putative kept within product function. FT Functional classification - Biosynthesis of cofactors, FT prosthetic groups and carriers - Folic acid" FT /note="PMID:1325970" FT /db_xref="GOA:Q9PJ54" FT /db_xref="InterPro:IPR000550" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ54" FT /inference="protein motif:Pfam:PF01288" FT /protein_id="CAL34239.1" FT /translation="MLKIQGVKHFEKSRFFPFFSQNIRSFKYLALIGLGSNIEPEKKRF FT DMLFRVMMDDKRFKILSTSPMLINEAFGFKEQKDFTNAVMLIQTNLHARALLKVLLYYE FT VKFKRKRTFKNAPRTLDLDLLYFSQKVKRDKWCEVPHKGAKERVSVILPLGMI" FT misc_feature complement(78784..79164) FT /note="HMMPfam hit to FT PF01288,7,8-dihydro-6-hydroxymethylpterin-pyrophosph, score FT 3.1e-25" FT /inference="protein motif:Pfam:PF01288" FT misc_feature complement(78880..78915) FT /note="PS00794 FT 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase FT signature" FT /inference="protein motif:Prosite:PS00794" FT CDS complement(79257..79736) FT /transl_table=11 FT /gene="aroQ" FT /locus_tag="Cj0066c" FT /product="3-dehydroquinate dehydratase" FT /EC_number="4.2.1.10" FT /note="Original (2000) note: Cj0066c, aroQ, probable FT 3-dehydroquinate dehydratase, len: 159 aa; similar to type FT II enzymes e.g. AROD_ACTPL 3-dehydroquinate dehydratase (EC FT 4.2.1.10) (154 aa), fasta scores; opt: 419 z-score: 765.6 FT E(): 0, 44.8% identity in 145 aa overlap. 50.9% identity to FT HP1038. Contains Pfam match to entry PF01220 DHquinase_II, FT Dehydroquinase class II , score 261.60,E-value 1e-74" FT /note="Updated (2006) note: Characterised within FT Helicobacter pylori with acceptable identity scores. FT Thus,putative removed from product function. Functional FT classification - Amino acid biosynthesis - Aromatic amino FT acid family" FT /note="PMID:8912695, PMID:12784220" FT /db_xref="GOA:Q9PJ53" FT /db_xref="HSSP:1J2Y" FT /db_xref="InterPro:IPR018509" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ53" FT /inference="protein motif:Pfam:PF01220" FT /protein_id="CAL34240.1" FT /translation="MKIMIIQGPNVNMLGVREVGIYGAMKMEEIHEQMKLAASQNNVEL FT DFFQSNFEGEIVDKIQECLGTVDGIIINAAGYTHTSVAIRDAIAAVALPTIEVHISNVY FT RREEFRQKSLIAPVCSGTIVGFGPFGYHLALMGIIQICEQIKNLRAMQQAQQTNK" FT misc_feature complement(79305..79730) FT /note="HMMPfam hit to PF01220, Dehydroquinase class FT II,score 1.4e-74" FT /inference="protein motif:Pfam:PF01220" FT CDS 79827..81056 FT /transl_table=11 FT /locus_tag="Cj0067" FT /product="putative amidohydrolase family protein" FT /note="Original (2000) note: Cj0067, unknown, len: 409 aa; FT identical to, but shorter than, C. jejuni hypothetical FT protein TR:P71126 (EMBL:U38524) upstream of pspA (518 aa) FT (99.5% identity in 409 aa overlap), and to many FT hypothetical proteins e.g. YF41_METJA hypothetical protein FT MJ1541 (420 aa), fasta scores; opt: 226 z-score: 413.4 E(): FT 9.2e-16, 26.9% identity in 383 aa overlap. 42.0% identity FT to HP0267 chlorohydrolase" FT /note="Updated (2006) note: Pfam domain PF01979 FT Amidohydrolase family identified within CDS. Product FT modified to more specific family member due to motif match. FT No specific characterisation with acceptable identity score FT has yet been carried out. Thus, putative kept within FT product function. Functional classification -Misc" FT /note="PMID:8793884" FT /db_xref="GOA:Q0PC66" FT /db_xref="InterPro:IPR006680" FT /db_xref="UniProtKB/TrEMBL:Q0PC66" FT /inference="protein motif:Pfam:PF01979" FT /protein_id="CAL34241.1" FT /translation="MFIVAARYLFLCDEDFTILENQAFVFEDKILELGELDNLKKKYPK FT AKIIKTPKNSVILPAFINPHTHLEFSANSTTLHFGEFLIWLKSVINSRSILNAQAKEEL FT ILQSIKKMQKSGIGTIGEISSFGSDLDPCLKASHKGMRIVFFNEILGTNENQVEDKKQE FT FLKRFENSLKFKNDFFIPAISIHSPYSTHPSLAHFALDLAKKQNLLASTHFLESKAENI FT WLRESKGGFKKWLENFTLHPKPLYTPKDFVKLFKGVRTLFTHCVYLKEYEWLDKNLHSI FT THCAFSNRLLSQKSLDLKTALKSGLNIHLGTDGLSSNISLSLLDEMRANLLIHKNFDLL FT ELASKLLQMVTLYPARALNLNLGELKKGKIADFNVFELGECDKKQAPLQFILNAKEVDK FT LFIKGKECKF" FT misc_feature 79992..80957 FT /note="HMMPfam hit to PF01979, Amidohydrolase family,score FT 1.8e-68" FT /inference="protein motif:Pfam:PF01979" FT CDS 81044..81940 FT /transl_table=11 FT /gene="pspA" FT /locus_tag="Cj0068" FT /product="protease" FT /note="Original (2000) note: Cj0068, pspA, probable FT protease required for pilus-like appendage formation, len: FT 298 aa; almost identical to TR:P71127 (EMBL:U38524) pspA FT (298 aa) (99.0% identity in 298 aa overlap) and similar to FT the C-terminus of e.g. SPPA_ECOLI protease IV (618 FT aa),fasta scores; opt: 285 z-score: 266.8 E(): 1.3e-07, FT 24.7% identity in 251 aa overlap. 42.0% identity to HP1435" FT /note="Updated (2006) note: Pfam domain PF01343 Peptidase FT family S49 identified within CDS. Product function based on FT direct submission with paper (PMID:8793884). Putative not FT added to product function due to characterisation work FT within Campylobacter jejuni. Functional classification FT -Degradation of macromolecules - Surface structures" FT /note="PMID:8793884, PMID:3522590" FT /db_xref="GOA:Q0PC65" FT /db_xref="InterPro:IPR004635" FT /db_xref="UniProtKB/TrEMBL:Q0PC65" FT /inference="protein motif:Pfam:PF01343" FT /protein_id="CAL34242.1" FT /translation="MQILKSFFKALGCGIKFINTYFKTFVLLLIVIWILIPSANSSSNL FT ANLERIDLKGEIFDSSAVLEKIINAKNDSNIKGVLFVIDSPGGAFAPSMELALAIKDLK FT IKKPVLVYASGTMASGSYLAGVGANKILANPASFIGSIGVIMQGADLSGLANKLGIKEQ FT TIQAGEFKSAGTFARAWNENERNFLQGLIDQSYDLFTGFVAKERALDLNKKDQWANARV FT FLAAKAKELGLIDELSNYENAKKELEKLANVSNPVWKEEDKIDKFLNRLEGQTSSLISK FT SLIEIAYKTNSSFINAR" FT sig_peptide 81044..81166 FT /note="Signal peptide predicted for pspA by SignalP 2.0 HMM FT (Signal peptide probability 0.973) with cleavage site FT probability 0.320 between residues 41 and 42" FT misc_feature 81080..81148 FT /note="1 probable transmembrane helix predicted for Cj0068 FT by TMHMM2.0 at aa 13-35" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 81344..81805 FT /note="HMMPfam hit to PF01343, Peptidase family S49, score FT 1.4e-74" FT /inference="protein motif:Pfam:PF01343" FT CDS 82019..83050 FT /transl_table=11 FT /locus_tag="Cj0069" FT /product="hypothetical protein Cj0069" FT /note="Original (2000) note: Cj0069, unknown, len: 343 aa; FT no Hp match" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Literature search identified FT paper giving further clues to product function. Functional FT classification - Unknown" FT /note="PMID:14702320" FT /db_xref="UniProtKB/TrEMBL:Q0PC64" FT /protein_id="CAL34243.1" FT /translation="MKKNIVFFEVKGGSDKGEDGYRKDTMPMVNALKAKGWNAEVIFFE FT VGKKDEIYKYVKENFDGYVSRINPGNLKEENEYFDMLRKLCADKLVGMPHPDAMIGYGA FT KDALTKLADTDLVPSDTYAYYDIKTFKENFPKSLAKGERVLKQNRGSTGEGIWRVSVEG FT NVSGDSLPLNTKIKCTEAKDNHVEHRELGEFMDFCEQYIIGDNGMLVDMTFLPRIKEGE FT IRLLMLYNTPVNVVHKKPAEDADAFSATLFSGAKYRYDKPEDWKTLVDMFLGELPKVRE FT KLGNYDLPLIWTADFILDTDEKGNDKYVLGEINCSCVGFTSHLELADEVASNIINIVSK FT TKA" FT CDS complement(83047..83205) FT /transl_table=11 FT /locus_tag="Cj0070c" FT /product="hypothetical protein Cj0070c" FT /note="Original (2000) note: Cj0070c, questionable CDS,len: FT 52 aa; no Hp match" FT /note="Updated (2006) note: Similar to proteins in other FT bacteria. Functional classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PC63" FT /protein_id="CAL34244.1" FT /translation="MDKFDYSYPILTKDTKCSFCENFFSIEYSSNLKTIEKECPFYNNK FT MDIKLKD" FT CDS complement(join(83292..83654,83654..83893)) FT /pseudo FT /transl_table=11 FT /locus_tag="Cj0072c" FT /product="pseudogene (putative iron-binding protein)" FT /note="Original (2000) note: Cj0072c, possible iron-binding FT protein pseudogene, len: 98 aa; Weak similarity to members FT of the eukaryotic iron-binding hemerythrin family, e.g. FT HEMM_THEZO myohemerythrin (118 aa). Note that all of the FT iron-binding residues are conserved. No Hp match. Also FT similar to N-terminus of Cj1224 (50.5% identity in 91 aa FT overlap), Cj0241c (40.5% identity in 79 aa overlap) and FT Cj0045c (32.5% identity in 83 aa overlap). Contains one FT frameshift" FT /note="Updated (2006) note: Pfam domains x2 PF01814 FT Hemerythrin HHE cation binding domain identified within FT CDS. Further support given to product function. Similar to FT many Campylobacter species designated as putative FT methy-accepting chemotaxis protein and also iron-binding FT proteins. No specific characterisation with acceptable FT identity score has been carried out yet. Thus, putative FT kept within product function. Coding sequence has been FT updated to reflect the complete amino acid sequence for the FT encoded protein regardless of its expression. This will FT cause differences from the amino acid sequence of the FT previous annotation. Functional classification FT -Transport/binding proteins - Cations" FT /inference="protein motif:Pfam:PF01814" FT misc_feature complement(order(83654..83686,83523..83654)) FT /note="HMMPfam hit to PF01814, Hemerythrin HHE cation FT binding domain, score 2.9" FT /inference="protein motif:Pfam:PF01814" FT misc_feature complement(83696..83866) FT /note="HMMPfam hit to PF01814, Hemerythrin HHE cation FT binding domain, score 0.007" FT /inference="protein motif:Pfam:PF01814" FT CDS complement(84087..84743) FT /transl_table=11 FT /locus_tag="Cj0073c" FT /product="conserved hypothetical protein Cj0073c" FT /note="Original (2000) note: Cj0073c, unknown, len: 218 aa; FT similar to hypothetical proteins e.g. YKGG_ECOLI (282 aa), FT fasta scores; opt: 215 z-score: 231.0 E(): 1.3e-05,32.2% FT identity in 146 aa overlap. 41.8% identity to HP0137" FT /note="Updated (2006) note: Pfam domain PF02589 FT Uncharacterized ACR, YkgG family COG1556 identified within FT CDS. Conserved added to product function. Literature search FT identified paper giving further clues to product function. FT Functional classification - Conserved hypothetical FT proteins" FT /note="PMID:15773975" FT /db_xref="InterPro:IPR003741" FT /db_xref="UniProtKB/TrEMBL:Q0PC62" FT /inference="protein motif:Pfam:PF02589" FT /protein_id="CAL34246.1" FT /translation="MSKIDEISSKSKANILEHLKKAYKETTFTRIESIDPVEHIQTTQD FT MLTEMKQKMSDNKYIVENATKDTLEEKINEIVAKYSFKSMIYGADLNLNLEQIKAEKKI FT CFDKEIENLRSEVFHSDFSIIHARAGVSSHGVALIPSSKTQPRMLSLAPKLCIVLLKKE FT NVVKSLSEALNLVKKENEILPTNILFIAGPSRTADIELITVFGVHGPQIAHIIIY" FT misc_feature complement(84090..84470) FT /note="HMMPfam hit to PF02589, Uncharacterized ACR, YkgG FT family COG1556, score 1.2e-29" FT /inference="protein motif:Pfam:PF02589" FT CDS complement(84736..86175) FT /transl_table=11 FT /locus_tag="Cj0074c" FT /product="putative iron-sulfur protein" FT /note="Original (2000) note: Cj0074c, probable iron-sulfur FT protein, len: 479 aa; similar to hypothetical proteins e.g. FT YKGF_ECOLI (475 aa), fasta scores; opt: 1142 z-score: FT 1335.9 E(): 0, 38.3% identity in 462 aa overlap. 58.1% FT identity to HP0138. Contains 2x PS00198 4Fe-4S ferredoxins, FT iron-sulfur binding region signature and 2x Pfam match to FT entry PF00037 fer4, 4Fe-4S ferredoxins and related FT iron-sulfur cluster binding domains., scores 13.80, E-value FT 0.0095, and 12.30, E-value 0.026" FT /note="Updated (2006) note: No specific characterisation FT with acceptable identity scores. Thus, putative kept within FT product function. Functional classification -Energy FT metabolism - Electron transport" FT /note="PMID:15773975" FT /db_xref="GOA:Q0PC61" FT /db_xref="InterPro:IPR012285" FT /db_xref="UniProtKB/TrEMBL:Q0PC61" FT /inference="protein motif:Pfam:PF00037" FT /inference="protein motif:Prosite:PS00198" FT /protein_id="CAL34247.1" FT /translation="MSQKIPHEQIVQIKLNDKQMQENLMTAMHTLQKNRLNVIDARFKD FT WQGLRAKAKQAKNNALMSLEERLLEFEKNATKNGIKVHWASSDEDACEIVYEIMKEKNI FT TKLLKGKSMASEEIGLNHYLEKKGLKAIETDLGELILQLNEEPPLHIVVPAIHRNRHEI FT GEIFKEKLGANLENDEPESLNAVAREHLRKDFEGLKLGLSGVNFAMSREGAFWLIENEG FT NGRMCTTAPDIHIALCGIEKIMESFEDAATMVSLLTPSATGQFIPTYNNIITGPRKNGD FT LDGPKEVHVILFDHNRSKMLAHEDYYEALRCIRCGACMNFCPVYDQIGGHAYQTTYPGP FT IGEVISPNIFGIDHTGDILNFCSLCGRCSEVCPVQIPLADLIRKLRCDKIGQGKNPPLG FT ANNVHHNALEAFAFKQFKNIATNGDKWRFSLSKAHYFNWTVQNFASILPVIKKWYAFKE FT LPQIKMDLYKEVQKLEGVSYE" FT misc_feature complement(85042..85113) FT /note="HMMPfam hit to PF00037, 4Fe-4S binding domain,score FT 0.00065" FT /inference="protein motif:Pfam:PF00037" FT misc_feature complement(85057..85092) FT /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding FT region signature" FT /inference="protein motif:Prosite:PS00198" FT misc_feature complement(85192..85263) FT /note="HMMPfam hit to PF00037, 4Fe-4S binding domain,score FT 0.0015" FT /inference="protein motif:Pfam:PF00037" FT misc_feature complement(85207..85242) FT /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding FT region signature" FT /inference="protein motif:Prosite:PS00198" FT misc_feature complement(85258..85296) FT /note="PS00018 EF-hand calcium-binding domain" FT /inference="protein motif:Prosite:PS00018" FT CDS complement(86172..86912) FT /transl_table=11 FT /locus_tag="Cj0075c" FT /product="putative oxidoreductase iron-sulfur subunit" FT /note="Original (2000) note: Cj0075c, possible FT oxidoreductase iron-sulfur subunit, len: 246 aa; similar to FT hypothetical proteins and to the C-terminus of e.g. FT TR:O53142 (EMBL:AJ000942) Methanobacterium FT thermoautotrophicum strain Marburg, Thiol:fumarate FT reductase subunit B (488 aa), fasta scores; opt: 217 FT z-score: 476.0 E(): 3e-1, 24.3% identity in 235 aa overlap. FT 60.7% identity to HP0139" FT /note="Updated (2006) note: Pfam domain x2 PF02754 FT Cysteine-rich domain identified within CDS. Further support FT given to product function. No specific characterisation FT with acceptable identity score. Thus,putative kept within FT product function. Functional classification - Energy FT metabolism - Electron transport" FT /note="PMID:15773975" FT /db_xref="InterPro:IPR004017" FT /db_xref="UniProtKB/TrEMBL:Q0PC60" FT /inference="protein motif:Pfam:PF02754" FT /protein_id="CAL34248.1" FT /translation="MMKKVYFYATCLGSTAMQQSVLNAIKLLRREGIEVIFKKNQTCCA FT QPSFNSGYFDESREIALYNVDLFDKDYPIVVPSGSCAGMMSHDYKELFKNRPEFSKIKT FT FSSRVIELSQYLDEVLKVDYEDKGVPIKVTWHSNCHALRVQKSIQASKNLIKKLKNVEL FT VELQYEEECCGFGGTFSVKEPEISNAMVRSKIKDIQNSGAKYLISGDGGCLLNIDGTMK FT RMGLDIKGIHLYDFLLKRLEGGRL" FT misc_feature complement(86259..86447) FT /note="HMMPfam hit to PF02754, Cysteine-rich domain, score FT 7.2e-19" FT /inference="protein motif:Pfam:PF02754" FT misc_feature complement(86655..86831) FT /note="HMMPfam hit to PF02754, Cysteine-rich domain, score FT 5.1e-12" FT /inference="protein motif:Pfam:PF02754" FT CDS complement(87036..88718) FT /transl_table=11 FT /gene="lctP" FT /locus_tag="Cj0076c" FT /product="L-lactate permease" FT /note="Original (2000) note: Cj0076c, lctP, probable FT L-lactate permease, len: 560 aa; highly similar to many FT e.g. LLDP_ECOLI L-lactate permease (551 aa), fasta scores; FT opt: 1957 z-score: 2614.5 E(): 0, 54.0% identity in 556 aa FT overlap. 61.2% identity to HP0141 and 60.6% identity to FT HP0140" FT /note="Updated (2006) note: Pfam domain PF02652 L-lactate FT permease identified within CDS. Thirteen probable FT transmembrane helices predicted by TMHMM2.0. Further FT support given to product function. Characterised within FT Escherichia coli with acceptable identity score. FT Thus,putative not added to product function. Functional FT classification - Transport/binding proteins -Carbohydrates, FT organic acids and alcohols" FT /note="PMID:8407843, PMID:11283302, PMID:11785976" FT /db_xref="GOA:Q0PC59" FT /db_xref="InterPro:IPR003804" FT /db_xref="UniProtKB/TrEMBL:Q0PC59" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF02652" FT /protein_id="CAL34249.1" FT /translation="MEQILTWQQIYDPFSNIWLSALVAFLPILCFLVCLVVLKLKGYQA FT GFLTVILATLVALFAYKMPWNLVGASFIQGFTNGMWPIAWIIIAAIFLYKLSIKSGSFE FT IIKKSVMSITPDHRIQVILIGFCFGSFLEGAIGFGGPVAITAALLVGLGLRPLQAAGLC FT LIANTAPVAFGAVGIPIIAMANLVGIEQHSVSAMVGRMLVPLSLTIPFFIVFLMDGFKG FT IKETFPAILVAALSFTTTQFLSSNHLGAELPDIISAVVSLAVTTVFLKFWKPKNIFRFD FT NESNFTQDNTLSFNQILKAWSPFILLIVCIIIWTQPWFKALFDKDGILSYTSITLQFSN FT ITTGILSPSITGIGEAKPLSLALGVDLINGKTVAQAGTAILLAAFLTIAILKIKAEDAA FT ECFWVTLKEMAIPCITIGLVVAFAFISKNSGMSTTLGLAFAHTGDAFSFFSPIIGWIGV FT FLTGSDTSANLLFGTLQQVSAQKLGISEALFLAANSVGGVVGKMISPQSIAIACAAVGL FT VGKESDLFKFTLKYSVAFIILIGIWTCIIAFFLQGIIPEVIVK" FT misc_feature complement(order(88608..88676,88536..88595,88425..88493, FT 88269..88364,88158..88226,88071..88139,87903..87956, FT 87762..87830,87546..87605,87444..87512,87297..87365, FT 87168..87236,87057..87125)) FT /note="13 probable transmembrane helices predicted for FT Cj0076c by TMHMM2.0 at aa 15-37, 42-61, 76-98, FT 119-150,165-187, 194-216, 255-272, 297-319, 372-391, FT 403-425,452-474, 495-517 and 532-554" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(87081..88664) FT /note="HMMPfam hit to PF02652, L-lactate permease, score FT 1.2e-268" FT /inference="protein motif:Pfam:PF02652" FT misc_feature complement(87183..87215) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(88890..89459) FT /transl_table=11 FT /gene="cdtC" FT /locus_tag="Cj0077c" FT /product="cytolethal distending toxin C" FT /note="Original (2000) note: Cj0077c, cdtC, cytolethal FT distending toxin, len: 189 aa, identical to TR:Q46102 FT (EMBL:U51121) cdtC (189 aa). No Hp match. Contains FT N-terminal signal sequence" FT /note="Updated (2006) note: Pfam domain PF03499 Cytolethal FT distending toxin C identified within CDS. Product modified FT to more specific family member due to motif match. FT Characterised within Campylobacter jejuni, so putative not FT added to product function. Functional classification FT -Pathogenicity" FT /note="PMID:10688204, PMID:8675309, PMID:11083762" FT /db_xref="GOA:Q46102" FT /db_xref="InterPro:IPR003558" FT /db_xref="UniProtKB/TrEMBL:Q46102" FT /inference="protein motif:Pfam:PF03499" FT /protein_id="CAL34250.1" FT /translation="MKKIITLFFMFITLAFATPTGDLKDFTEMVSIRSLETGIFLSAFR FT DTSKDPIDQNWNIKEIVLSDELKQKDKLADELPFGYVQFTNPKESDLCLAILEDGTFGA FT KSCQDDLKDGKLETVFSIMPTTTSAVQIRSLVLESDECIVTFFNPNIPIQKRFGIAPCT FT LDPIFFAEVNELMIITPPLTAATPLE" FT misc_feature complement(89040..89438) FT /note="HMMPfam hit to PF03499, Cytolethal distending toxin FT C, score 3.6e-81" FT /inference="protein motif:Pfam:PF03499" FT sig_peptide complement(89409..89459) FT /note="Signal peptide predicted for cdtC by SignalP 2.0 HMM FT (Signal peptide probability 0.983) with cleavage site FT probability 0.852 between residues 17 and 18" FT CDS complement(89470..90267) FT /transl_table=11 FT /gene="cdtB" FT /locus_tag="Cj0078c" FT /product="cytolethal distending toxin B" FT /note="Original (2000) note: Cj0078c, cdtB, cytolethal FT distending toxin, len: 265 aa; identical toTR:Q46101 FT (EMBL:U51121) cdtB (265 aa) and similar to e.g. TR:Q47089 FT (EMBL:U03293) Escherichia coli cdtB (273 aa), fasta scores; FT opt: 946 z-score: 1533.6 E(): 0, 55.2% identity in 268 aa FT overlap. No Hp match. Contains N-terminal signal sequence" FT /note="Updated (2006) note: Prosite domain PRO1388 FT CDTOXINB, Cytolethal distending toxin B signature FT identified within CDS. Product modified to more specific FT family member due to motif match. Characterised within FT Campylobacter jejuni, so putative not added to product FT function. Functional classification - Pathogenicity" FT /note="PMID:10688204, PMID:8675309, PMID:11083762" FT /db_xref="GOA:Q46101" FT /db_xref="InterPro:IPR005135" FT /db_xref="UniProtKB/TrEMBL:Q46101" FT /protein_id="CAL34251.1" FT /translation="MKKIICLFLSFNLAFANLENFNVGTWNLQGSSAATESKWSVSVRQ FT LVSGANPLDILMIQEAGTLPRTATPTGRHVQQGGTPIDEYEWNLGTLSRPDRVFIYYSR FT VDVGANRVNLAIVSRMQAEEVIVLPPPTTVSRPIIGIRNGNDAFFNIHALANGGTDVGA FT IITAVDAHFANMPQVNWMIAGDFNRDPSTITSTVDRELANRIRVVFPTSATQASGGTLD FT YAITGNSNRQQTYTPPLLAAILMLASLRSHIVSDHFPVNFRKF" FT misc_feature complement(89476..90207) FT /note="HMMPfam hit to FT PF03372,Endonuclease/Exonuclease/phosphatase fa, score FT 7.8e-23" FT /inference="protein motif:Pfam:PF03372" FT sig_peptide complement(90169..90267) FT /note="Signal peptide predicted for cdtB by SignalP 2.0 HMM FT (Signal peptide probability 0.926) with cleavage site FT probability 0.740 between residues 33 and 34" FT CDS complement(90264..91070) FT /transl_table=11 FT /gene="cdtA" FT /locus_tag="Cj0079c" FT /product="cytolethal distending toxin A" FT /note="Original (2000) note: Cj0079c, cdtA, cytolethal FT distending toxin, len: 268 aa; identical to TR:Q46100 FT (EMBL:U51121) cdtB (268 aa) and similar to e.g. TR:Q47088 FT (EMBL:U03293) Escherichia coli cdtA (237 aa), fasta scores; FT opt: 310 z-score: 408.0 E(): 1.8e-15, 32.7% identity in 159 FT aa overlap. No Hp match. Contains N-terminal signal FT sequence and appropriately positioned PS00013 Prokaryotic FT membrane lipoprotein lipid attachment site" FT /note="Updated (2006) note: Pfam domain PF03498 Cytolethal FT distending toxin A identified within CDS. Product modified FT to more specific family member due to motif match. FT Characterised within Campylobacter jejuni, so putative not FT added to product function. Functional classification FT -Pathogenicity" FT /note="PMID:10688204, PMID:8675309, PMID:11083762" FT /db_xref="GOA:Q0PC56" FT /db_xref="InterPro:IPR000772" FT /db_xref="UniProtKB/Swiss-Prot:Q0PC56" FT /inference="protein motif:Pfam:PF03498" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34252.1" FT /translation="MQKIIVFILCCFMTFFLYACSSKFENVNPLGRSFGEFEDTDPLKL FT GLEPTFPTNQEIPSLISGADLVPITPITPPLTRTSNSANNNAANGINPRFKDEAFNDVL FT IFENRPAVSDFLTILGPSGAALTVWALAQGNWIWGYTLIDSKGFGDARVWQLLLYPNDF FT AMIKNAKTNTCLNAYGNGIVHYPCDASNHAQMWKLIPMSNTAVQIKNLGNGKCIQAPIT FT NLYGDFHKVFKIFTVECAKKDNFDQQWFLTTPPFTAKPLYRQGEVR" FT misc_feature complement(90420..90704) FT /note="HMMPfam hit to PF03498, Cytolethal distending toxin FT A, score 1.6e-33" FT /inference="protein motif:Pfam:PF03498" FT sig_peptide complement(90990..91070) FT /note="Signal peptide predicted for cdtA by SignalP 2.0 HMM FT (Signal peptide probability 0.852) with cleavage site FT probability 0.451 between residues 27 and 28" FT misc_feature complement(91005..91058) FT /note="1 probable transmembrane helix predicted for Cj0079c FT by TMHMM2.0 at aa 5-22" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(91011..91043) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 91147..91416 FT /transl_table=11 FT /locus_tag="Cj0080" FT /product="putative membrane protein. Functional FT classification-Membranes, lipoproteins and porins" FT /note="Original (2000) note: Cj0080, possible membrane FT protein, len: 267 aa; no Hp match; Contains one possible FT transmembrane domain" FT /note="Updated (2006) note: Two probable transmembrane FT helices predicted by TMHMM2.0" FT /db_xref="GOA:Q0PC55" FT /db_xref="UniProtKB/TrEMBL:Q0PC55" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34253.1" FT /translation="MFYFVVFKGRIYMYLKHLYFSISQIFNFYKEGFKNLTLGKTLWKI FT IFIKLFVMFVILKLFVFDVNFNSIFKSDKEKSTFVLKNLTLEGK" FT misc_feature order(91174..91233,91270..91338) FT /note="2 probable transmembrane helices predicted for FT Cj0080 by TMHMM2.0 at aa 10-29 and 42-64" FT /inference="protein motif:TMHMM:2.0" FT CDS 91417..92979 FT /transl_table=11 FT /gene="cydA" FT /locus_tag="Cj0081" FT /product="cytochrome bd oxidase subunit I" FT /EC_number="1.10.3.-" FT /note="Original (2000) note: Cj0081, cydA, probable FT cytochrome bd oxidase subunit I, len: 520 aa;similar to FT many e.g. APPC_ECOLI cytochrome bd-ii oxidase subunit I (EC FT 1.10.3.-) (514 aa), fasta scores; opt: 1412 z-score: 1888.2 FT E(): 0, 45.7% identity in 530 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF01654 Bacterial FT Cytochrome Ubiquinol Oxidase identified within CDS. FT Also,nine probable transmembrane helices predicted by FT TMHMM2.0. Further support given to product function. FT Characterised within Escherichia coli with acceptable FT identity score. Thus, putative not added to product FT function. Functional classification - Energy metabolism - FT Electron transport" FT /note="PMID:8626304, PMID:9068659, PMID:9852001" FT /db_xref="GOA:Q0PC54" FT /db_xref="InterPro:IPR002585" FT /db_xref="UniProtKB/TrEMBL:Q0PC54" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF01654" FT /protein_id="CAL34254.1" FT /translation="MNELSSVDWSRAQFALTALYHFLFVPLTLGLSFMIAIMETIYVKT FT KNERWKKITKFWLSLFAINFAIGVATGIIMEFEFGTNWANYSWFVGDIFGAPLAVEGIM FT AFFLEATFFAVMFFGWDKVSKGFHLLSTWCVAIGSNLSAFWILVANGWMQYPVGMSFNP FT DTARNEMQSFFEVALSPVAISKFLHTIGSGYVISALFVMGISAWFMLKGRHIIEAKKSL FT VVGASFGLVCSIFLFFSGDESAYRVTQTQPMKLAAMEGVYQGEHRAGLVPFGILNPKKT FT IDNNESVFLFDITIPYALSILGNRDPNSFVPGIEDLIYGNESKGIEPMQNRIDRGKIAI FT QTLKDYKLAKENNDTIAMANHKSILETHFKDFGYGYLEKPSDTIPPVALTFYSFHIMVA FT LGSFFFLLFIVTLYLTMANDIEKFRKVLWVCLLSIPLGYIAAEAGWIVAEVGRQPWAIQ FT DLLPVHIAATQLGKVNVQISFWIFAVLFTALLIAEVKIMLTQIKKGFDAHAGHTPLMGK FT GEK" FT misc_feature 91441..92952 FT /note="HMMPfam hit to PF01654, Bacterial Cytochrome FT Ubiquinol Oxidase, score 3.3e-191" FT /inference="protein motif:Pfam:PF01654" FT misc_feature order(91459..91527,91582..91650,91708..91776,91795..91863, FT 91972..92040,92077..92136,92587..92655,92692..92760, FT 92845..92913) FT /note="9 probable transmembrane helices predicted for FT Cj0081 by TMHMM2.0 at aa 15-37, 56-78, 98-120, FT 127-149,186-208, 221-240, 391-413, 426-448 and 477-499" FT /inference="protein motif:TMHMM:2.0" FT CDS 92979..94103 FT /transl_table=11 FT /gene="cydB" FT /locus_tag="Cj0082" FT /product="cytochrome bd oxidase subunit II" FT /EC_number="1.10.3.-" FT /note="Original (2000) note: Cj0082, cydB, probable FT cytochrome bd oxidase subunit II, len: 520 aa;similar to FT many e.g. CYDB_ECOLI cytochrome d ubiquinol oxidase subunit FT II (EC 1.10.3.-) (379 aa), fasta scores; opt: 466 z-score: FT 449.6 E(): 8.7e-18, 27.7% identity in 386 aa overlap. No Hp FT match" FT /note="Updated (2006) note: Pfam domain PF02322 Cytochrome FT oxidase subunit II identified within CDS. Also, nine FT probable transmembrane helices predicted by TMHMM2.0. FT Further support given to product function. Characterised FT within Escherichia coli with marginal identity score. FT Putative not added to product function. Functional FT classification - Energy metabolism - Electron transport" FT /note="PMID:8626304, PMID:9068659, FT PMID:9852001,PMID:15470119" FT /db_xref="GOA:Q0PC53" FT /db_xref="InterPro:IPR003317" FT /db_xref="UniProtKB/TrEMBL:Q0PC53" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF02322" FT /protein_id="CAL34255.1" FT /translation="MFFGLELEGLQIYWWLILSLLGGLLVFMFFVQGGQTLIDELSKDE FT LEKTMLVNSLGRKWELGFTTLVLFGGAAFAAFPLFYSTSFGGAYWAWLCILFCFILQAV FT AYEYRKKENNVYGSKTYEIFLKINGYLGVFLIGVAVSSFFSGSEFILNEHNFVSWQNPL FT HGLELLLNPFNYLLGLALVFLARLLGAAYFMNNINDENIKIRAMKKLMINSILFLPFFL FT GFLAWIFLKDGFSVDTNGVVSMSANLYLYNFLNQMIFAVLLVIGVILVLLGMVQGTKGC FT SKAIFTLGLGTVLTVFALLSSIGLGQSAFYPSLSDLQSSLTLKNASSSYYTLSVMAYVS FT LLVPFVLAYIIYVWNAMDKVKITREEIANDDHAY" FT misc_feature 93000..94061 FT /note="HMMPfam hit to PF02322, Cytochrome oxidase subunit FT II, score 3.5e-13" FT /inference="protein motif:Pfam:PF02322" FT misc_feature order(93006..93071,93153..93221,93234..93302,93363..93431, FT 93501..93569,93606..93665,93723..93791,93828..93896, FT 93972..94040) FT /note="9 probable transmembrane helices predicted for FT Cj0082 by TMHMM2.0 at aa 10-31, 59-81, 86-108, FT 129-151,175-197, 210-229, 249-271, 284-306 and 332-354" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(94297..94992) FT /transl_table=11 FT /locus_tag="Cj0085c" FT /product="putative amino acid recemase" FT /note="Original (2000) note: Cj0085c, probable amino acid FT recemase, len: 231 aa; similar to members of the FT aspartate/glutamate racemases family e.g. YGEA_ECOLI (230 FT aa), fasta scores; opt: 667 z-score: 1155.6 E(): 0, 46.7% FT identity in 225 aa overlap, and RACD_STRTR aspartate FT racemase (243 aa), fasta scores; opt: 254 z-score: 230.9 FT E(): 1.3e-05, 25.4% identity in 232 aa overlap. No Hp FT match. Contains PS00924 Aspartate and glutamate racemases FT signature 2 andPfam match to entry PF01177 FT Asp_Glu_race,Aspartate / glutamate racemase, score 108.40, FT E-value 1.3e-28" FT /note="Updated (2006) note: Pfam domain PF01177 FT Asp/Glu/Hydantoin racemase identified within CDS. No FT specific characterisation with acceptable identity score FT identified. Thus, putative kept within product function. FT Functional classification - Misc" FT /db_xref="GOA:Q0PC52" FT /db_xref="InterPro:IPR004380" FT /db_xref="UniProtKB/TrEMBL:Q0PC52" FT /inference="protein motif:Pfam:PF01177" FT /inference="protein motif:Prosite:PS00924" FT /protein_id="CAL34256.1" FT /translation="MKTIGIIGGMSFESTITYYKTINQAINDKLKSLNSAKILLYSVNF FT EEIENLQSQDKWQEAAQILTQCAKKLELAGANFIIIATNTMHKVFDEIQQNINIPILHI FT AKSSAKALKQENIQKIGLLGTKYTMTQDFYKKMLIEENISVITPSDEDIKIVNDIIFNE FT LCKGEIKQDSKEKYLNIIKKLQEKGAKGVLLACTEIGLLISKNDTNIKIFDTSLIHALD FT AANEALKDL" FT misc_feature complement(94309..94986) FT /note="HMMPfam hit to PF01177, Asp/Glu/Hydantoin FT racemase,score 4.8e-67" FT /inference="protein motif:Pfam:PF01177" FT misc_feature complement(94387..94419) FT /note="PS00924 Aspartate and glutamate racemases signature FT 2" FT /inference="protein motif:Prosite:PS00924" FT CDS complement(95108..95803) FT /transl_table=11 FT /gene="ung" FT /locus_tag="Cj0086c" FT /product="uracil-DNA glycosylase" FT /EC_number="3.2.2.-" FT /note="Original (2000) note: Cj0086c, ung, probable FT uracil-DNA glycosylase, len: 231 aa; similar to mnay FT e.g.UNG_BORBU uracil-DNA glycosylase (EC 3.2.2.-) (223 aa), FT fasta scores; opt: 765 z-score: 1221.9 E(): 0, 51.8% FT identity in 222 aa overlap. 47.8% identity to HP1347. FT Contains PS00130 Uracil-DNA glycosylase signature and Pfam FT match to entry PF00315 UNG, Uracil-DNA glycosylase, score FT 334.90, E-value 9e-97" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Appropriate motifs present. Thus, putative not added to FT product function. Functional classification - DNA FT replication, restriction/modification, recombination and FT repair" FT /note="PMID:2836397, PMID:1429601" FT /db_xref="GOA:Q9PJ40" FT /db_xref="HSSP:1AKZ" FT /db_xref="InterPro:IPR005122" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ40" FT /inference="protein motif:Pfam:PF00315" FT /inference="protein motif:Prosite:PS00130" FT /protein_id="CAL34257.1" FT /translation="MEEITINIDKIKINDDWKEFLRDEFQKKYFLEIKKQYLNAINQNI FT IIYPPANLIFNAFNLCPLKEIKIIILGQDPYHQPNQAMGLSFSVPKNVKIPPSLNNIFK FT ELQNDLNITPAKSGDLSSWAKQGVLLLNSILSVEANKAASHSSWGWQEFSDAIIHKLSN FT EKSGLVFMLWGNYAKNKEILIDNTKHLILKAAHPSPLARTGFLGCKHFSKANEFLKKVG FT KIPIDWKIV" FT misc_feature complement(95147..95623) FT /note="HMMPfam hit to PF03167, Uracil DNA glycosylase FT superfamily, score 1.6e-73" FT /inference="protein motif:Pfam:PF03167" FT misc_feature complement(95576..95605) FT /note="PS00130 Uracil-DNA glycosylase signature" FT /inference="protein motif:Prosite:PS00130" FT CDS 96074..97480 FT /transl_table=11 FT /gene="aspA" FT /locus_tag="Cj0087" FT /product="aspartate ammonia-lyase" FT /EC_number="4.3.1.1" FT /note="Original (2000) note: Cj0087, aspA, aspartate FT ammonia-lyase, len: 468 aa; similar to many e.g.ASPA_ECOLI FT aspartate ammonia-lyase (EC 4.3.1.1) (ASPAR (478 aa),fasta FT scores; opt: 1853 z-score: 2526.1 E(): 0, 58.2% identity in FT 466 aa overlap, 67.5% identity to HP0649. Contains PS00163 FT Fumarate lyases signature and Pfam match to entry PF00206 FT lyase_1, Lyases, score 615.50, E-value 3.1e-181" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Thus,putative not added to product function. Functional FT classification - Central intermediary metabolism -General" FT /note="PMID:2699932" FT /db_xref="GOA:Q0PC50" FT /db_xref="InterPro:IPR000362" FT /db_xref="UniProtKB/TrEMBL:Q0PC50" FT /inference="protein motif:Pfam:PF00206" FT /inference="protein motif:Prosite:PS00163" FT /protein_id="CAL34258.1" FT /translation="MGTRKEHDFIGELEISDEVYYGVQTFRAVENFDISHDRLKDFPRF FT VRALARVKKAAAMANHELGLLDKNIQDAIIKACDKILEGGYYDQFVVDMIQGGAGTSTN FT MNANEVIANIGLELMGHKKGEYQYLHPNDHVNLSQSTNDAYPTALHLALHDYLSDLAKA FT MEHLKKAYERKAEEFKDVLKMGRTQLQDAVPMTLGREFKTFAVMIGEDIQRVLEARKLI FT LEINLGGTAIGTGINSHPDYPKVVERKIREVTGFEYTVAEDLIEATQDTGAYVQISGVL FT KRVATKLSKVCNDLRLLSSGPKCGLNEINLPKMQPGSSIMPGKVNPVIPEVVNQVCYFV FT IGADVTVTFACEGGQLQLNVFEPVVAYSLFNSVVMLEKAMYTLADKCIDGITANEKICS FT DFVYNSVGIVTALNPYIGYENSASIAKEAMNTGKRVADIALERGLLSKEQIDEILTPSN FT MLNPHMEAKK" FT misc_feature 96104..97099 FT /note="HMMPfam hit to PF00206, Lyase, score 1.2e-151" FT /inference="protein motif:Pfam:PF00206" FT misc_feature 97022..97051 FT /note="PS00163 Fumarate lyases signature" FT /inference="protein motif:Prosite:PS00163" FT CDS 97496..98833 FT /transl_table=11 FT /gene="dcuA" FT /locus_tag="Cj0088" FT /product="anaerobic C4-dicarboxylate transporter" FT /note="Original (2000) note: Cj0088, dcuA, probable FT anaerobic C4-dicarboxylate transporter, len: 445 aa; highly FT similar to many e.g. DCUA_ECOLI anaerobic C4-dicarboxylate FT transporter dcuA (433 aa), fasta scores; opt: 1484 z-score: FT 1900.4 E(): 0, 53.6% identity in 442 aa overlap. 61.0% FT identity to HP0724" FT /note="Updated (2006) note: Pfam domain PF03605 Anaerobic FT c4-dicarboxylate membrane transport protein identified FT within CDS. Twelve probable transmembrane helices predicted FT by TMHMM2.0. Characterised within Wolinella succinogenes FT (PMID:11004174) and Escherichia coli with acceptable FT identity score. Thus, putative removed from product FT function. Functional classification -Transport/binding FT proteins - Carbohydrates, organic acids and alcohols" FT /note="PMID:11004174" FT /db_xref="GOA:Q0PC49" FT /db_xref="InterPro:IPR004668" FT /db_xref="UniProtKB/TrEMBL:Q0PC49" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF03605" FT /protein_id="CAL34259.1" FT /translation="MDIMIILQVIVLLGAIFIGIRLGGIAIGYAGGLGVVILGLVLGMK FT PGNIPWDVILIIAAAIAAISAMQQAGGLDYMVRVTEKILRSSPKFINYLAPACGWLLTI FT LAGTGNAVFSLMPVVVDVAKSQNIKPSVPLSLMVVSSQIGITASPVSAAVVYMSGVLEP FT LGWNYPTLIGIWISTTFVACMLAAFIVSLITPMDLSKDSVYQERLKAGLVKDAGAVLHG FT EDKPGAKLSVVIFLITVLAVVLYATAISSNIKWIDPVVVSRDAAIMSFLLTAATLITWL FT CKVEPGKILDTSVFKSGMTACVCVFGVAWLGNTFVAGHEASIKEVAGDWVKQTPAMLAV FT AFFFASMLLYSQAATAKAIVPVIITALGISAANPHDSYMLVACFAAVSALFVLPTYPTL FT LGAVQMDDTGTTRIGKFIFNHSFFIPGVLAIAIAVALGFVLAPMLI" FT misc_feature order(97502..97555,97568..97621,97640..97708,97766..97834, FT 97895..97963,98006..98074,98183..98242,98270..98338, FT 98396..98464,98507..98575,98633..98701,98759..98827) FT /note="12 probable transmembrane helices predicted for FT Cj0088 by TMHMM2.0 at aa 3-20, 25-42, 49-71, FT 91-113,134-156, 171-193, 230-249, 259-281, 301-323, FT 338-360,380-402 and 422-444" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 97517..98608 FT /note="HMMPfam hit to PF03605, Anaerobic c4-dicarboxylate FT membrane transpo, score 3.9e-245" FT /inference="protein motif:Pfam:PF03605" FT misc_feature 98012..98044 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 98941..100302 FT /transl_table=11 FT /locus_tag="Cj0089" FT /product="putative lipoprotein" FT /note="Original (2000) note: Cj0089, probable FT lipoprotein,len: 453 aa; 27.4% identity to HP0018. Contains FT N-terminal signal sequence and appropriately positioned FT PS00013 Prokaryotic membrane lipoprotein lipid attachment FT site. Functional classification - Membranes, lipoproteins FT and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PC48" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34260.1" FT /translation="MKIKVGLIFSGIACLFLTACVNQVKQNTTFENTLTQKYCGDDFFN FT QNLEKIKKNDDVIYTGLNAGLIARNCGDFNKSNVFFDAVEESYKYDVDLENVSPKAAKF FT IGTTLLNDNIVDYDGSLYERIMVNIYKALNYMEEDDYENARVEFNRVLMRQDKAKEYFA FT KEIEKNRADLDKAKEDKNYDKNMNENSKVIEAQYDNLFKEFDTTKNFINPYATYLASIF FT FFMDKDYRKAADLFREVAIIYPKNKTIKKEAKIFKEYATKIKVKKAKKYVFVVYENGFG FT VVKDEFALTLPFIVDKKIISTNIALQTLKKREASFANLNINGQNTNDFVDLDNIVATEF FT KINMPAMIAKALAQTIIKTTLNVAVANNDSTGGWLSLATAVATAATNKADVRSWRGLPK FT SIAIATIENDGNLEIKDPQGNILFQKSLDKNKNALVIVRSFAPYLPASVAIMEK" FT sig_peptide 98941..99018 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000038_98941_100302 by SignalP 2.0 HMM FT (Signal peptide probability 0.998) with cleavage site FT probability 0.724 between residues 26 and 27" FT misc_feature 98968..99000 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 99313..99414 FT /note="HMMPfam hit to PF07719, Tetratricopeptide FT repeat,score 1.4" FT /inference="protein motif:Pfam:PF07719" FT misc_feature 99577..99678 FT /note="HMMPfam hit to PF07719, Tetratricopeptide FT repeat,score 0.12" FT /inference="protein motif:Pfam:PF07719" FT CDS 100312..100680 FT /transl_table=11 FT /locus_tag="Cj0090" FT /product="putative lipoprotein" FT /note="Original (2000) note: Cj0090, probable FT lipoprotein,len: 122 aa; no Hp match. Contains N-terminal FT signal sequence and appropriately positioned PS00013 FT Prokaryotic membrane lipoprotein lipid attachment site. FT Functional classification - Membranes, lipoproteins and FT porins" FT /db_xref="UniProtKB/TrEMBL:Q0PC47" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34261.1" FT /translation="MKKNILFILMFLLSACAPSYQINSNQNTVILGSNLPKSLVKQFQK FT RINSNGYLEFEVILRSTFAKDVIYKVDWLDKDGFVLRDVLNEDYQALRIPAGQEVILRK FT LASDTRANDFRLEIKAKN" FT sig_peptide 100312..100383 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000039_100312_100680 by SignalP 2.0 FT HMM (Signal peptide probability 0.997) with cleavage site FT probability 0.247 between residues 24 and 25" FT misc_feature 100327..100359 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 100704..101327 FT /transl_table=11 FT /locus_tag="Cj0091" FT /product="putative lipoprotein" FT /note="Original (2000) note: Cj0091, probable FT lipoprotein,len: 207 aa; 33.5% identity to HP1457. Contains FT N-terminal signal sequence and appropriately positioned FT PS00013 Prokaryotic membrane lipoprotein lipid attachment FT site. Functional classification - Membranes, lipoproteins FT and porins" FT /db_xref="GOA:Q0PC46" FT /db_xref="InterPro:IPR014094" FT /db_xref="UniProtKB/TrEMBL:Q0PC46" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34262.1" FT /translation="MKKTKILGTALIGALLFSGCAQTAYTDGKASQVKKGDALTLGLDR FT QDFESAAETMINSMLSDPAFANIKPGTRKVIAIGRVVNDTPQRIDTEKLTAKITSALRK FT SGKFVLTSAVAAGGALDSMSEDVRELRDNDEFNQKTIAKKGTLVSPDFSLAGKIRQDNV FT KLSNGKTQVEYFFLLRLTDLTSGLVYWEDEQTIDKTGSSKSVTW" FT sig_peptide 100704..100781 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000040_100704_101327 by SignalP 2.0 FT HMM (Signal peptide probability 1.000) with cleavage site FT probability 0.579 between residues 26 and 27" FT misc_feature 100722..100781 FT /note="1 probable transmembrane helix predicted for Cj0091 FT by TMHMM2.0 at aa 7-26" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 100731..100763 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 101410..102747 FT /transl_table=11 FT /locus_tag="Cj0092" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0092, probable periplasmic FT protein, len: 445 aa; no Hp match. Contains probable FT N-terminal signal sequence and PS00017 ATP/GTP-binding site FT motif A (P-loop). Functional classification -Miscellaneous FT periplasmic proteins" FT /db_xref="GOA:Q0PC45" FT /db_xref="UniProtKB/TrEMBL:Q0PC45" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34263.1" FT /translation="MKKILFIGSLVMASLLYAQGSQPVEITQQDINTQNEMSDASTKDI FT TPKSIEDFFEEFADNFGIEYGITKDGKTFYTGKSTVAVNDTDPQFAQALQNAYQKAMLN FT LQSEFIRDAFGRIATSKIQNYEADNSTNAKEFDELPKGDKVDQILNKLTQLAGAQLDKA FT LKDLGIDTNSLSEDRKKTLLKQEFLNKTMTNAIGSMSGLVPVQTIVTQRRGEYDVGVVA FT VISNKTRQLAKDMALARQSAIKGKGKAISEYLPKDTKGFLNEYGIRLVYDENGAPIILS FT YGNWGYVADPSNAKKTNILEDRAKETALTMADAAIIEFINTNLSLKDERTTGDTYEEII FT KQSINVNDSSTQEQTQNITNIIDKVNSKIKASASGKIRGIRTLKKWSYTSENGIEHVGA FT VRFYSYENLANTNEALNSKSNATKNEAKKSSSIQRSSNVVNSMDDF" FT sig_peptide 101410..101469 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000041_101410_102747 by SignalP 2.0 FT HMM (Signal peptide probability 0.988) with cleavage site FT probability 0.408 between residues 20 and 21" FT misc_feature 101605..101628 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 102757..103959 FT /transl_table=11 FT /locus_tag="Cj0093" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0093, probable periplasmic FT protein, len: 400 aa; no Hp match. Contains probable FT N-terminal signal sequence. Functional classification FT -Miscellaneous periplasmic proteins" FT /db_xref="GOA:Q0PC44" FT /db_xref="UniProtKB/TrEMBL:Q0PC44" FT /protein_id="CAL34264.1" FT /translation="MKIIKILFLGLFLSLSLNAKVITTTSTKSSTGEGTGLTREDAINN FT AIIEAIGKMSGVSINSLKKSNTSVSTDNSGSNIQDNYSEQISKATKGRADTYEINSVEQ FT DANGKYTANVTIFKTTTTKKYQAPGLSADNRRSITVFDSTPDAAKRGIGSALQQKIISD FT LLQSRKFNVLDRDSSGYYEMEKALIKSGDAASDEVYKLKNMLATDYILLFSISGLEGKQ FT KTSNLTGKSKTEIEVIVDYRVLLFATRQIKFSNTLSMKVNLKDNSLSANETALKQIANR FT IAGDILNAIYPLKVASVENNEVIFSQSLNQGDVYECFALGKVIKDTYTKENTGRVESKT FT GSIEITRTSPKFSYAKITEGSVKVGDICRPLSNTGSGNGYTIGRDANYQTQEGGGVNLG FT F" FT sig_peptide 102757..102819 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000042_102757_103959 by SignalP 2.0 FT HMM (Signal peptide probability 0.992) with cleavage site FT probability 0.294 between residues 21 and 22" FT CDS 104118..104426 FT /transl_table=11 FT /gene="rplU" FT /locus_tag="Cj0094" FT /product="50S ribosomal protein L21" FT /note="Original (2000) note: Cj0094, rplU, 50S ribosomal FT protein L21, len: 102 aa; similar to many e.g. RL21_ECOLI FT 50S ribosomal protein L21 (103 aa), fasta scores; opt: 268 FT z-score: 457.7 E(): 3.1e-18, 40.8% identity in 103 aa FT overlap. 58.8% identity to HP0296. Contains PS01169 FT Ribosomal protein L21 signature and Pfam match to entry FT PF00829 Ribosomal_L21p, Ribosomal prokaryotic L21 FT protein,score 152.80, E-value 5.7e-42" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Thus,putative not added to product function. Functional FT classification - Ribosomal protein synthesis and FT modification" FT /note="PMID:378941, 8312607" FT /db_xref="GOA:Q0PC43" FT /db_xref="InterPro:IPR018258" FT /db_xref="UniProtKB/Swiss-Prot:Q0PC43" FT /inference="protein motif:Pfam:PF00829" FT /inference="protein motif:Prosite:PS01169" FT /protein_id="CAL34265.1" FT /translation="MYAIIKHSGKQYKVSVGDELKLDHFEAESKASIEVSEVLAINDKE FT LKVGAPFVAGAKVVLEVINHGKDKKVVIYKKRRRKDSKLKRGFRRQFTRVVVKDIKA" FT misc_feature 104118..104402 FT /note="HMMPfam hit to PF00829, Ribosomal prokaryotic L21 FT protein, score 3.6e-48" FT /inference="protein motif:Pfam:PF00829" FT misc_feature 104328..104396 FT /note="PS01169 Ribosomal protein L21 signature" FT /inference="protein motif:Prosite:PS01169" FT CDS 104437..104691 FT /transl_table=11 FT /gene="rpmA" FT /locus_tag="Cj0095" FT /product="50S ribosomal protein L27" FT /note="Original (2000) note: Cj0095, rpmA, 50S ribosomal FT protein L27, len: 84 aa; highly similar to meny e.g. FT RL27_ECOLI 50S ribosomal protein L27 (84 aa), fasta scores; FT opt: 334 z-score: 627.0 E(): 1.1e-27, 65.4% identity in 81 FT aa overlap. 85.2% identity to HP0297. Contains PS00831 FT Ribosomal protein L27 signature and Pfam match to entry FT PF01016 Ribosomal_L27, Ribosomal L27 protein, score 189.40, FT E-value 5.5e-53" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Thus,putative not added to product function. Functional FT classification - Ribosomal protein synthesis and FT modification" FT /note="PMID:8312607" FT /db_xref="GOA:Q9PJ31" FT /db_xref="InterPro:IPR018261" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ31" FT /inference="protein motif:Pfam:PF01016" FT /inference="protein motif:Prosite:PS00831" FT /protein_id="CAL34266.1" FT /translation="MAHKKGQGSTQNNRDSIGRRLGVKKFGGEFVRAGNIIIRQRGTAT FT HAGNNVGMGKDHTIFALIDGFVKFERKDKDRKKVSVYPA" FT misc_feature 104440..104682 FT /note="HMMPfam hit to PF01016, Ribosomal L27 protein,score FT 3.7e-54" FT /inference="protein motif:Pfam:PF01016" FT misc_feature 104536..104580 FT /note="PS00831 Ribosomal protein L27 signature" FT /inference="protein motif:Prosite:PS00831" FT stem_loop 104722..104783 FT CDS 104798..105850 FT /transl_table=11 FT /locus_tag="Cj0096" FT /product="GTP-binding protein" FT /note="Original (2000) note: Cj0096, probable GTP-binding FT protein, len: 350 aa; simlar to many members of the FT GTP1/OBG family e.g. OBG_BACSU spo0B-associated GTP-binding FT protein (428 aa), fasta scores; opt: 920 z-score: 1171.0 FT E(): 0, 43.0% identity in 342 aa overlap. 55.4% identity to FT HP0303. Also similar in part to Cj0930 (27.1% identity in FT 210 aa overlap). Contains PS00017 ATP/GTP-binding site FT motif A (P-loop), PS00905 GTP1/OBG family signature and FT Pfam match to entry PF01018 GTP1_OBG,GTP1/OBG family, score FT 281.40, E-value 1.2e-80" FT /note="Updated (2006) note: Charactersation work carried FT out within Bacillus subtilis with acceptable identity FT scores. Putative kept within product function. Functional FT classification - Conserved hypothetical proteins" FT /note="PMID:2537815" FT /db_xref="GOA:Q0PC41" FT /db_xref="InterPro:IPR002917" FT /db_xref="UniProtKB/TrEMBL:Q0PC41" FT /inference="protein motif:Pfam:PF01018" FT /inference="protein motif:Prosite:PS00905" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34267.1" FT /translation="MFIDSVKITLASGDGGKGAVSFRREKHVPLGGPDGGDGGNGGDII FT FVCDNNTHTLVNFKGKRELRAQNGAGGMGRNKNGKKGENLELIVPEGTQVIDAQTNEIL FT LDLTKEGQRELFLKGGKGGLGNTHFKHATNQRPDYAQPGIKGESRLVRLELKLIADVGL FT VGFPNVGKSTLISVVSNAKPEIANYEFTTLTPKLGLVDVNEYNSFVMADIPGIIEGASG FT GKGLGLAFLKHIERTSFLLFVLDPMRQMPLKEQFIVLRKELEKFSNELFGRKFGIMISK FT SDSVRLGEEFAEQIALNINELDNYLKEINNPQSFLIKVSSLEKTGLKELKFMLLEEIKT FT LRNNKKNLTI" FT misc_feature 104801..105268 FT /note="HMMPfam hit to PF01018, GTP1/OBG, score 2.7e-75" FT /inference="protein motif:Pfam:PF01018" FT misc_feature 105272..105646 FT /note="HMMPfam hit to PF01926, GTPase of unknown FT function,score 2.7e-33" FT /inference="protein motif:Pfam:PF01926" FT misc_feature 105290..105313 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 105431..105472 FT /note="PS00905 GTP1/OBG family signature" FT /inference="protein motif:Prosite:PS00905" FT CDS 105955..106710 FT /transl_table=11 FT /gene="proB" FT /locus_tag="Cj0097" FT /product="glutamate 5-kinase" FT /EC_number="2.7.2.11" FT /note="Original (2000) note: Cj0097, proB, possible FT glutamate 5-kinase, len: 251 aa; similar to, but shorter FT than, many e.g. PROB_BACSU glutamate 5-kinase (EC 2.7.2.11) FT (365 aa), fasta scores; opt: 502 z-score: 752.8 E(): 0, FT 37.1% identity in 232 aa overlap" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis and Escherichia coli with acceptable identity FT scores. Appropriate motifs were also identified. FT Thus,putative removed from product function. Functional FT classification - Amino acid biosynthesis - Glutamate FT family" FT /note="PMID:8083159, PMID:2841193, PMID:15502337" FT /db_xref="GOA:Q9PJ29" FT /db_xref="InterPro:IPR005715" FT /db_xref="PDB:2AKO" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ29" FT /protein_id="CAL34268.1" FT /translation="MKRIVVKVGSHVISEENTLSFERLKNLVAFLAKLMEKYEVILVTS FT AAISAGHTKLDIDRKNLINKQVLAAIGQPFLISVYNELLAKFNKLGGQILLTGKDFDSR FT KATKHAKNAIDMMINLGILPIINENDATAIEEIVFGDNDSLSAYATHFFDADLLVILSD FT IDGFYDKNPSEFSDAKRLEKITHIKEEWLQATIKTGSEHGTGGIVTKLKAAKFLLEHNK FT KMFLASGFDLSVAKTFLLEDKQIGGTLFE" FT misc_feature 105958..106638 FT /note="HMMPfam hit to PF00696, Amino acid kinase FT family,score 1e-41" FT /inference="protein motif:Pfam:PF00696" FT CDS 106784..107701 FT /transl_table=11 FT /gene="fmt" FT /locus_tag="Cj0098" FT /product="methionyl-tRNA formyltransferase" FT /EC_number="2.1.2.9" FT /note="Original (2000) note: Cj0098, fmt, probable FT methionyl-tRNA formyltransferase, len: 305 aa; similar to FT many e.g.FMT_ECOLI methionyl-tRNA formyltransferase (EC FT 2.1.2.9) (314 aa), fasta scores; opt: 628 z-score: 634.5 FT E(): 4.4e-28, 37.5% identity in 304 aa overlap. Contains FT Pfam match to entry PF00551 formyl_transf, Formyl FT transferase, score 133.00, E-value 3.7e-37. 51.7% identity FT to HP1141" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Thus,putative not added to product function. Functional FT classification - Aminoacyl tRNA synthetases and their FT modification" FT /note="PMID:1624424" FT /db_xref="GOA:Q9PJ28" FT /db_xref="HSSP:1FMT" FT /db_xref="InterPro:IPR015518" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ28" FT /inference="protein motif:Pfam:PF00551" FT /protein_id="CAL34269.1" FT /translation="MKKIIFMGTPSYATCILKALVENENFKLVALFTQPDKAVGRKQIL FT TPSDTKAFLSQNYPSIPIFTPSSLKDKNIIREIKDLNPDFIVVAAYGKILPKAILDLAP FT CVNLHASLLPKYRGASPIQSAILNKDEKSGVCTMLMEEGLDTGAILESLECDIKDKNSS FT EVFELLANLAAKIILSTLLNFDKITPKKQEESLATLCRKIKKEDGLINLQNARELYQKY FT LAFTPWPGVFLENGLKFLELELVDELKQNAKMGEILELEKESFLLACKQGVLRIKKLQE FT SGKKALDGRTYLNGKRLKSEDSLC" FT misc_feature 106787..107326 FT /note="HMMPfam hit to PF00551, Formyl transferase, score FT 4.4e-36" FT /inference="protein motif:Pfam:PF00551" FT misc_feature 107393..107674 FT /note="HMMPfam hit to PF02911, Formyl FT transferase,C-terminal domain, score 8e-24" FT /inference="protein motif:Pfam:PF02911" FT CDS 107664..108317 FT /transl_table=11 FT /gene="birA" FT /locus_tag="Cj0099" FT /product="putative biotin--[acetyl-CoA-carboxylase] FT synthetase" FT /EC_number="6.3.4.15" FT /note="Original (2000) note: Cj0099, birA, possible FT biotin--[acetyl-CoA-carboxylase] synthetase, len: 217 aa; FT weak similarity to e.g. SW:BIRA_BACSU P42975 birA FT bifunctional protein (biotin operon repressor) FT (biotin--[acetyl-CoA-carboxylase] synthetase) (EC FT 6.3.4.15)(325 aa), blastp scores; E= 0.00011, 21% identity FT in 163 aa overlap; similarity does not include DNA-binding FT domain. 39.0% identity to HP1140" FT /note="Updated (2006) note: Pfam domain PF03099 FT Biotin/lipoate A/B protein ligase family identified within FT CDS. Further support given to product function. Specific FT characterisation with acceptable identity scores not yet FT carried out. Thus, putative kept within product function. FT Functional classification - Biosynthesis of FT cofactors,prosthetic groups and carriers - Biotin" FT /db_xref="GOA:Q0PC38" FT /db_xref="InterPro:IPR004143" FT /db_xref="UniProtKB/TrEMBL:Q0PC38" FT /inference="protein motif:Pfam:PF03099" FT /protein_id="CAL34270.1" FT /translation="MEKGLKVKIVCVESIDSTHLFLCKQIRNGKIDENFAIYALEQING FT VGSRENSWQSSKGNLHLSFCIKEEDLPKDLPLASVSIYFAYLLKEVLQEKGSKIWLKWP FT NDLYLDDKKAGGVISAKISNFIIGGMGLNLKFAPQNTALCDIEISLKDLVSEFLQKVEK FT KILWKNIFSKYMLEFEKSRKFSVHHEGKVFSLENSFLYEDGSILLGDKRVYSLR" FT misc_feature 107694..108083 FT /note="HMMPfam hit to PF03099, Biotin/lipoate A/B protein FT ligase famil, score 2e-13" FT /inference="protein motif:Pfam:PF03099" FT CDS 108314..109099 FT /transl_table=11 FT /locus_tag="Cj0100" FT /product="parA family protein" FT /note="Original (2000) note: Cj0100, putative parA family FT protein, len: 261 aa; similar to members of the parA family FT e.g. SOJ_BACSU soj protein (253 aa) fasta scores; opt: 762 FT z-score: 1251.6 E(): 0, 46.3% identity in 259 aa overlap. FT 61.1% identity to HP1139. Contains Pfam match to entry FT PF00991 ParA, ParA family ATPase, score 118.40,E-value FT 1.3e-31" FT /note="Updated (2006) note: Pfam domain PF01656 FT CobQ/CobB/MinD/ParA nucleotide binding domain identified FT within CDS. This family consists of putative cobyrinic acid FT a,c-diamide synthases family protein. Some characterisation FT work within Bacillus subtilis with acceptable identity FT score. Putative not added to product function. Functional FT classification - Cell division" FT /note="PMID:8071208" FT /db_xref="GOA:Q0PC37" FT /db_xref="InterPro:IPR002586" FT /db_xref="UniProtKB/TrEMBL:Q0PC37" FT /inference="protein motif:Pfam:PF01656" FT /inference="protein motif:Pfam:PF00991" FT /protein_id="CAL34271.1" FT /translation="MSEIITIANQKGGVGKTTTAVNLAASLAVAEKKVLLIDVDPQANA FT TTGLGFNRNNYEYNIYHVFIGRKKLSDIILKTELPQLHLAPSNIGLVGIEQELAKGENN FT EKKMLLKNQIQEVIDEYDFIIIDSPPALGSITINAFAASDSVIIPIQCEFYALEGVAMV FT LNTIKIIKKTINSKLRVRGFLPTMYSSQNNLSKDVVDDLKQNFKKQLFTINGNEDDFIV FT IPRNVKLAESPSFGKPIILYDIKSPGSVAYQNLAYSILG" FT misc_feature 108326..109006 FT /note="HMMPfam hit to PF01656, CobQ/CobB/MinD/ParA FT nucleotide binding domai, score 9.4e-53" FT /inference="protein motif:Pfam:PF01656" FT CDS 109105..109941 FT /transl_table=11 FT /locus_tag="Cj0101" FT /product="parB family protein" FT /note="Original (2000) note: Cj0101, putative parB family FT protein, len: 278 aa; similar to members of the parB family FT e.g.SP0J_BACSU stage 0 sporulation protein J (282 aa), FT fasta scores; opt: 563 z-score: 842.8 E(): 0, 36.1% FT identity in 288 aa overlap. 41.7% identity to HP1138 FT plasmid replication-partition related protein. Contains FT helix-turn-helix motif (Score 1486, +4.25 SD)" FT /note="Updated (2006) note: Pfam domain PF02195 ParB-like FT nuclease domain identified within CDS. Some FT characterisation within Bacillus subtilis with acceptable FT identity score. Putative not added to product function. FT Functional classification - Cell division" FT /note="PMID:1900505, PMID:8071208" FT /db_xref="GOA:Q9PJ25" FT /db_xref="InterPro:IPR003115" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ25" FT /inference="protein motif:Pfam:PF02195" FT /protein_id="CAL34272.1" FT /translation="MGLNKDRGLSSLISDMDTVYSKELGFDKNQSTMIEIDQISPNPFQ FT PRKNFDQEALDELANSIKEFGLIQPIIVFKKNNKFILIAGERRLRAVKALGKKEILAFI FT ADIDENKLRELALIENIQRENLNPIELANSYKDLMQVHKITQENLAELIHKSRTQITNT FT LRLLNLDIRTQELIASGKISQGHAKVLVGLDQKDEKMLVDSIIGQKLNVRDTEKIVKKI FT KNNESLPNQEFEDEIKKLKQILNRFGFDCKNKNNDFVIHLENIDKIKKLIKMLEKL" FT misc_feature 109198..109467 FT /note="HMMPfam hit to PF02195, ParB-like nuclease FT domain,score 2.7e-34" FT /inference="protein motif:Pfam:PF02195" FT CDS 110002..110427 FT /transl_table=11 FT /gene="atpF" FT /locus_tag="Cj0102" FT /product="ATP synthase F0 sector B' subunit" FT /EC_number="3.6.3.14" FT /note="Original (2000) note: Cj0102, atpF', probable ATP FT synthase F0 sector B' subunit, len: 141 aa; some similarity FT to e.g. ATPF_BACP3 ATP synthase B chain precursor (EC FT 3.6.1.34) (163 aa), fasta scores; opt: 160 z-score: 227.5 FT E(): 2e-05, 20.9% identity in 129 aa overlap. 25.4% FT identity to HP1137. Contains Pfam match to entry PF00430 FT ATP-synt_B, ATP synthase B/B' CF(0), score 42.80, E-value FT 6.3e-11" FT /note="Updated (2006) note: Characterised within FT Escherichia coli, however identity scores were marginal. FT Appropriate motifs were identified. Putative not added to FT product function. Functional classification - Energy FT metabolism - ATP-proton motive force" FT /note="PMID:6278247, PMID:8276830, FT PMID:9614129,PMID:11768298, PMID:7961438" FT /db_xref="GOA:Q0PC35" FT /db_xref="InterPro:IPR002146" FT /db_xref="UniProtKB/TrEMBL:Q0PC35" FT /inference="protein motif:Pfam:PF00430" FT /protein_id="CAL34273.1" FT /translation="MFEDMHPSIMLATMAIFLAMIVILNSMLYKPLLKFMDERNDSIKN FT DENKVKENSQEVLGVNDELEAIHINTREEIQKIKQSAIAAAKEEAEQILRSKKEELERK FT MASFYADLAVQKKELQEHLNIHLSELKQALQNNIKKI" FT misc_feature 110026..110418 FT /note="HMMPfam hit to PF00430, ATP synthase B/B' FT CF(0),score 1.5e-06" FT /inference="protein motif:Pfam:PF00430" FT misc_feature 110029..110088 FT /note="1 probable transmembrane helix predicted for Cj0102 FT by TMHMM2.0 at aa 10-29" FT /inference="protein motif:TMHMM:2.0" FT CDS 110438..110950 FT /transl_table=11 FT /gene="atpF" FT /locus_tag="Cj0103" FT /product="ATP synthase F0 sector B subunit" FT /EC_number="3.6.3.14" FT /note="Original (2000) note: Cj0103, atpF, probable ATP FT synthase F0 sector B subunit, len: 170 aa; some similarity FT to e.g. ATPF_ENTHR ATP synthase B chain (EC 3.6.1.34) (174 FT aa), fasta scores; opt: 165 z-score: 246.4 E(): FT 1.8e-06,27.5% identity in 131 aa overlap. 31.9% identity to FT HP1136" FT /note="Updated (2006) note: Characterised within FT Escherichia coli, however identity scores were marginal. FT Appropriate motifs were identified. Putative not added to FT product function. Functional classification - Energy FT metabolism - ATP-proton motive force" FT /note="PMID:6278247, PMID:8276830, FT PMID:9614129,PMID:11768298, PMID:7961438" FT /db_xref="GOA:Q0PC34" FT /db_xref="InterPro:IPR002146" FT /db_xref="UniProtKB/TrEMBL:Q0PC34" FT /protein_id="CAL34274.1" FT /translation="MSKLFFIIFLLPLYAFGASNGSGEYDIIPRTINFLIFVAILYYFV FT ATPFKNFYKNRIVKISSKLDEIQKKLLESKAKKLDTMKKLEEAKASAAAALITAKKEAE FT ILVQNIKKETQDELDLLQKHFEEQKDYEFRKMEKELVSNTLNEIFSDPNMTLKQSEIIE FT LMMKKVS" FT sig_peptide 110438..110488 FT /note="Signal peptide predicted for atpF by SignalP 2.0 HMM FT (Signal peptide probability 0.903) with cleavage site FT probability 0.564 between residues 17 and 18" FT misc_feature order(110450..110503,110516..110584) FT /note="2 probable transmembrane helices predicted for FT Cj0103 by TMHMM2.0 at aa 5-22 and 27-49" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 110513..110923 FT /note="HMMPfam hit to PF00430, ATP synthase B/B' FT CF(0),score 0.00034" FT /inference="protein motif:Pfam:PF00430" FT CDS 110953..111474 FT /transl_table=11 FT /gene="atpH" FT /locus_tag="Cj0104" FT /product="ATP synthase F1 sector delta subunit" FT /EC_number="3.6.3.14" FT /note="Original (2000) note: Cj0104, atpH, probable ATP FT synthase F1 sector delta subunit, len: 173 aa; similar to FT e.g. ATPD_ECOLI ATP synthase delta chain (EC 3.6.1.34) (177 FT aa), fasta scores; opt: 135 z-score: 234.1 E(): 8.8e-06, FT 27.6% identity in 145 aa overlap. No Hp match. Contains FT Pfam match to entry PF00213 OSCP, ATP synthase delta (OSCP) FT subunit, score 53.70, E-value 8.2e-15" FT /note="Updated (2006) note: Characterised within FT Escherichia coli, however identity scores were marginal. FT Appropriate motifs were identified. Putative not added to FT product function. Functional classification - Energy FT metabolism - ATP-proton motive force" FT /note="PMID:6278247, PMID:8276830, FT PMID:7957212,PMID:11768298, PMID:7961438" FT /db_xref="GOA:Q0PC33" FT /db_xref="InterPro:IPR000711" FT /db_xref="UniProtKB/Swiss-Prot:Q0PC33" FT /inference="protein motif:Pfam:PF00213" FT /protein_id="CAL34275.1" FT /translation="MENIIARRYAKAIASRADINDFYQNLCILNSAFVLPKFKNIIESN FT EIKKERKMEFLDSFFDIKNSSFQNFLRLLIENSRLECIPQIVKELERQKAFKENIFVGI FT VYSKEKLSQENLKDLEVKLNKKFDANIKLNNKISQDDSVKIELEELGYELSFSMKALQN FT KLNEYILKII" FT misc_feature 110965..111414 FT /note="HMMPfam hit to PF00213, ATP synthase delta (OSCP) FT subunit, score 1.1e-07" FT /inference="protein motif:Pfam:PF00213" FT CDS 111488..112993 FT /transl_table=11 FT /gene="atpA" FT /locus_tag="Cj0105" FT /product="ATP synthase F1 sector alpha subunit" FT /EC_number="3.6.3.14" FT /note="Original (2000) note: Cj0105, atpA, probable ATP FT synthase F1 sector alpha subunit, len: 501 aa; similar to FT e.g. ATPA_ENTHR ATP synthase alpha chain (EC 3.6.1.34) (518 FT aa), fasta scores; opt: 2114 z-score: 2501.4 E(): 0,64.4% FT identity in 497 aa overlap. 75.0% identity to HP1134. FT Contains PS00017 ATP/GTP-binding site motif A (P-loop), FT PS00152 ATP synthase alpha and beta subunits signature and FT Pfam matches to entry PF00006 ATP-synt_ab,ATP synthase FT alpha and beta subunits, score 643.10,E-value 1.5e-189 and FT to entry PF00422 ATP-synt_A-c, ATP synthase Alpha chain, C FT terminal, score 277.50, E-value 7.6e-94" FT /note="Updated (2006) note: Characterised within FT Escherichia coli, however identity score was marginal. FT Also, characterised within Enterococcus hirae with FT acceptable identity score. Appropriate motifs were FT identified. Putative not added to product function. FT Functional classification - Energy metabolism - ATP-proton FT motive force" FT /note="PMID:6278247, PMID:8276830, FT PMID:11768298,PMID:1328152, PMID:7961438" FT /db_xref="GOA:Q9PJ21" FT /db_xref="HSSP:1SKY" FT /db_xref="InterPro:IPR000194" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ21" FT /inference="protein motif:Pfam:PF00422" FT /inference="protein motif:Pfam:PF00006" FT /inference="protein motif:Prosite:PS00152" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34276.1" FT /translation="MKFKADEISSIIKERIENFDLNLEIEETGKIISVADGVAKVYGLK FT NIMAGEMVEFENGDKGMALNLEESSVGIVILGKGEGLKEGASVKRLKKLLKVPVGEALI FT GRVVNALGEPIDAKGVINANEYRFVEEKAKGIMARKSVHEPLHTGIKAIDALVPIGRGQ FT RELIIGDRQTGKTTVAVDTIISQRGQGVICIYVAIGQKQSTVAQVVKRLEEHGAMEYTI FT VVNAGASDPAALQYLAPYTGVTMGEFFRDNAKHALIVYDDLSKHAVAYREMSLILRRPP FT GREAYPGDVFYLHSRLLERASKLNDELGAGSLTALPIIETQAGDVSAYIPTNVISITDG FT QIFLETDLFNSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFAQFA FT SDLDEASRKQLERGQRMVELLKQPPYSPLSVEKQVVLIFAGTKGFLDDIAVSRIKEFED FT GIYPFIEAKHPDIFEQIRSKKALDSDLEEKLAKAINEFKANHL" FT misc_feature 111557..111763 FT /note="HMMPfam hit to PF02874, ATP synthase alpha/beta FT family, beta-ba, score 7.9e-19" FT /inference="protein motif:Pfam:PF02874" FT misc_feature 111929..112579 FT /note="HMMPfam hit to PF00006, ATP synthase alpha/beta FT family, nucleot, score 3.4e-115" FT /inference="protein motif:Pfam:PF00006" FT misc_feature 111992..112015 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 112550..112579 FT /note="PS00152 ATP synthase alpha and beta subunits FT signature" FT /inference="protein motif:Prosite:PS00152" FT misc_feature 112613..112927 FT /note="HMMPfam hit to PF00306, ATP synthase alpha/beta FT chain, C termin, score 2.5e-36" FT /inference="protein motif:Pfam:PF00306" FT CDS 113002..113886 FT /transl_table=11 FT /gene="atpG" FT /locus_tag="Cj0106" FT /product="ATP synthase F1 sector gamma subunit" FT /EC_number="3.6.3.14" FT /note="Original (2000) note: Cj0106, atpG, probable ATP FT synthase F1 sector gamma subunit, len: 294 aa; similar to FT e.g. ATPG_BACSU ATP synthase gamma chain (EC 3.6.1.34) (290 FT aa), fasta scores; opt: 537 z-score: 747.6 E(): 0,33.6% FT identity in 295 aa overlap. 52.8% identity to HP1133. FT Contains Pfam match to entry PF00231 ATP-synt, ATP FT synthase, score 282.80, E-value 4.3e-81" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis with acceptable identity scores. Appropriate FT motifs were identified. Putative not added to product FT function. Functional classification - Energy metabolism FT -ATP-proton motive force" FT /note="PMID:6278247, PMID:8276830, FT PMID:11768298,PMID:7961438" FT /db_xref="GOA:Q9PJ20" FT /db_xref="InterPro:IPR000131" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ20" FT /inference="protein motif:Pfam:PF00231" FT /protein_id="CAL34277.1" FT /translation="MSNLKEIKRKIKSVHNTQKTTNAMKLVSTAKLKKAEEAAKRSKIY FT AQKIDEILSEISFQINKIVHNEDDVRLSLFHKKEQIKTVDLIFITADKGLCGGFNIKTL FT KTVSEMLKEYEAKNINIRLRAIGKTGIEYFNFQKIELLEKYFHLSSSPDYEKACEVIHA FT AVDDFLNGNTDEVILVHNGYKNMITQELKINHLIPVEPKSIEQTHNSLLELEPEGTELL FT KDLMKTYFEYNMYYALIDSLAAEHSARMQAMDNATNNAKARVKQLNLAYNKARQESITT FT ELIEIISGVESMK" FT misc_feature 113005..113880 FT /note="HMMPfam hit to PF00231, ATP synthase, score 2.8e-83" FT /inference="protein motif:Pfam:PF00231" FT CDS 113912..115309 FT /transl_table=11 FT /gene="atpD" FT /locus_tag="Cj0107" FT /product="ATP synthase F1 sector beta subunit" FT /EC_number="3.6.3.14" FT /note="Original (2000) note: Cj0107, atpD, probable ATP FT synthase F1 sector beta subunit, len: 465 aa; highly FT similar to many e.g. ATPB_WOLSU ATP synthase beta chain (EC FT 3.6.1.34) (467 aa), fasta scores; opt: 2558 z-score: 3132.1 FT E(): 0, 83.0% identity in 464 aa overlap. 79.5% identity to FT HP1132. Contains PS00017 ATP /GTP-binding site motif A FT (P-loop), PS00152 ATP synthase al pha and beta subunits FT signature and Pfam matches to entry P F00006 ATP-synt_ab, FT ATP synthase alpha and beta subunits, s core 604.00, FT E-value 9.1e-178 and to entry PF00306 ATP-synt _ab_C, ATP FT synthase ab C terminal, score 193.50, E-value 3. 4e-54" FT /note="Updated (2006) note: Characterised within Wolinella FT succinogenes with acceptable identity scores. Appropriate FT motifs were identified. Putative not added to product FT function. Functional classification - Energy metabolism FT -ATP-proton motive force" FT /note="PMID:6278247, PMID:8276830, FT PMID:11768298,PMID:7961438, PMID:8085791" FT /db_xref="GOA:Q0PC30" FT /db_xref="InterPro:IPR000194" FT /db_xref="UniProtKB/Swiss-Prot:Q0PC30" FT /inference="protein motif:Pfam:PF00306" FT /inference="protein motif:Prosite:PS00152" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34278.1" FT /translation="MQGFISQVLGPVVDVDFNDYLPQINEAIVVNFESEGKKHKLVLEV FT AAHLGDNRVRTIAMDMTDGLVRGLKAEALGAPISVPVGEKVLGRIFNVTGDLIDEGEEI FT SFDKKWAIHRDPPAFEDQSTKSEIFETGIKVVDLLAPYAKGGKVGLFGGAGVGKTVIIM FT ELIHNVAFKHSGYSVFAGVGERTREGNDLYNEMKESNVLDKVALCYGQMNEPPGARNRI FT ALTGLTMAEYFRDEMGLDVLMFIDNIFRFSQSGSEMSALLGRIPSAVGYQPTLASEMGK FT FQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRAIAEKGIYPAVDP FT LDSTSRMLDPNIIGEEHYKVARGVQSVLQKYKDLQDIIAILGMDELSEEDKLVVERARK FT IEKFLSQPFFVAEVFTGSPGKYISLEDTIAGFKGILEGKYDHLPENAFYMVGNIDEAIA FT KADKLKG" FT misc_feature 113924..114136 FT /note="HMMPfam hit to PF02874, ATP synthase alpha/beta FT family, beta-ba, score 4.3e-21" FT /inference="protein motif:Pfam:PF02874" FT misc_feature 114302..114946 FT /note="HMMPfam hit to PF00006, ATP synthase alpha/beta FT family, nucleot, score 1e-94" FT /inference="protein motif:Pfam:PF00006" FT misc_feature 114365..114388 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 114917..114946 FT /note="PS00152 ATP synthase alpha and beta subunits FT signature" FT /inference="protein motif:Prosite:PS00152" FT misc_feature 114983..115306 FT /note="HMMPfam hit to PF00306, ATP synthase alpha/beta FT chain, C termin, score 7.2e-55" FT /inference="protein motif:Pfam:PF00306" FT CDS 115313..115702 FT /transl_table=11 FT /gene="atpC" FT /locus_tag="Cj0108" FT /product="ATP synthase F1 sector epsilon subunit" FT /EC_number="3.6.3.14" FT /note="Original (2000) note: Cj0108, atpC, probable ATP FT synthase F1 sector epsilon subunit, len: 129 aa; similar to FT many e.g. ATPE_BACME ATP synthase epsilon chain (EC FT 3.6.1.34) (134 aa), fasta scores; opt: 200 z-score: 337.5 FT E(): 1.5e-11, 32.4% identity in 108 aa overlap. 40.0% FT identity to HP1131. Contains Pfam match to entry PF00401 FT ATP-synt_DE, ATP synthase, Delta/Epsilon chain, score FT 84.00, E-value 4.2e-22" FT /note="Updated (2006) note: Characterised within Bacillus FT megaterium with acceptable identity scores. Appropriate FT motifs were identified. Putative not added to product FT function. Functional classification - Energy metabolism FT -ATP-proton motive force" FT /note="PMID:6278247, PMID:8276830, FT PMID:11768298,PMID:7961438, PMID:2894831" FT /db_xref="GOA:Q9PJ18" FT /db_xref="HSSP:1BSN" FT /db_xref="InterPro:IPR001469" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ18" FT /inference="protein motif:Pfam:PF00401" FT /protein_id="CAL34279.1" FT /translation="MNDLINFEIVTPLGVIYQGEVKSVTLPGSEGEFGVLKGHAALVSS FT LKSGVIDIEKADLNHELIAIDAGHAKVDEDKICVLAKGAVWVCGSDESEIEKNLAQAKD FT LIKSMSSDNAALAATFSKLDNARMH" FT misc_feature 115322..115570 FT /note="HMMPfam hit to PF02823, ATP synthase, Delta/Epsilon FT chain, beta, score 2.6e-21" FT /inference="protein motif:Pfam:PF02823" FT CDS 115702..116256 FT /transl_table=11 FT /gene="exbB3" FT /locus_tag="Cj0109" FT /product="putative MotA/TolQ/ExbB proton channel family FT protein" FT /note="Original (2000) note: Cj0109, exbB3, probable FT exbB/tolQ family transport protein, len: 184 aa; similar to FT members of the exbB/tolQ family, e.g. EXBB_ECOLI biopolymer FT transport exbB protein (244 aa), fasta scores; opt: 208 FT z-score: 287.0 E(): 9.9e-09, 33.6% identity in 128 aa FT overlap, and TOLQ_ECOLI tolQ protein (230 aa),fasta scores; FT opt: 187 z-score: 280.1 E(): 2.4e-08, 48.4% identity in 62 FT aa overlap. 42.6% identity to HP1130. Also similar to FT Cj0179 (30.6% identity in 186 aa overlap) and Cj1628 (44.4% FT identity in 81 aa overlap)" FT /note="Updated (2006) note: Pfam domain FT PF01618,MotA/TolQ/ExbB proton channel family identified FT within CDS. Product modified to more specific family member FT due to motif match. No specific characterisation has been FT carried out yet. Thus, putative kept within product FT function. Functional classification - Transport/binding FT proteins - Other" FT /note="PMID:8437515, PMID:9371459" FT /db_xref="GOA:Q0PC28" FT /db_xref="InterPro:IPR017269" FT /db_xref="UniProtKB/TrEMBL:Q0PC28" FT /inference="protein motif:Pfam:PF01618" FT /protein_id="CAL34280.1" FT /translation="MNFEAIFHFFNSSSIITYIVLLWLSLYFILAFSILFARLTYLATW FT RNKEKESLETLLLGEKDLSRTDSILRKCNDTTSNHLEIYKNLASRRASAGLTWLSIIAS FT TSPFIGLFGTVISILETFGGLGTQNSLSIIAPKISEALVATGCGILVAIPAYTFHLIIK FT RKAFELLSIIDSEIKVISSSK" FT misc_feature order(115744..115812,115987..116055,116113..116181) FT /note="3 probable transmembrane helices predicted for FT Cj0109 by TMHMM2.0 at aa 15-37, 96-118 and 138-160" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 115837..116235 FT /note="HMMPfam hit to PF01618, MotA/TolQ/ExbB proton FT channel family, score 1e-24" FT /inference="protein motif:Pfam:PF01618" FT CDS 116265..116654 FT /transl_table=11 FT /gene="exbD3" FT /locus_tag="Cj0110" FT /product="putative exbD/tolR family transport protein" FT /note="Original (2000) note: Cj0110, exbD3, probable FT exbD/tolR family transport protein, len: 129 aa; similar to FT members of the exbD/tolR family, e.g. EXBD_ECOLI biopolymer FT transport exbD protein (141 aa), fasta scores; opt: 225 FT z-score: 240.1 E(): 4e-06, 31.1% identity in 132 aa FT overlap, and TOLR_ECOLI tolR protein (142 aa), fasta FT scores; opt: 191 z-score: 240.1 E(): 4.1e-06, 27.7% FT identity in 130 aa overlap. 46.8% identity to HP1129. Also FT similar to Cj0180 (34.1% identity in 126 aa overlap) and FT Cj1629 (26.4% identity in 121 aa overlap)" FT /note="Updated (2006) note: Pfam domain PF02472 Biopolymer FT transport protein ExbD/TolR identified within CDS. Further FT support given to product function. No specific FT characterisation with acceptable identity scores were FT identified. Thus, putative kept within product function. FT Functional classification - Transport/binding proteins FT -Other" FT /note="PMID:9371459" FT /db_xref="GOA:Q0PC27" FT /db_xref="InterPro:IPR003400" FT /db_xref="UniProtKB/TrEMBL:Q0PC27" FT /inference="protein motif:Pfam:PF02472" FT /protein_id="CAL34281.1" FT /translation="MPFDDEKPELNITPLVDIMLVLLAILMVTAPSITYEEKINLPQGS FT QKNTSTPTVKSLIISINAKKEIFLNQEKYDFISFADNLAQRKAQFNTEDPVFIRADKSL FT KYDDVISVLRSVKNLGFNKVALQTE" FT misc_feature 116271..116651 FT /note="HMMPfam hit to PF02472, Biopolymer transport protein FT ExbD/TolR, score 7.2e-16" FT /inference="protein motif:Pfam:PF02472" FT misc_feature 116292..116360 FT /note="1 probable transmembrane helix predicted for Cj0110 FT by TMHMM2.0 at aa 10-32" FT /inference="protein motif:TMHMM:2.0" FT CDS 116657..117436 FT /transl_table=11 FT /locus_tag="Cj0111" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0111, possible periplasmic FT protein, len: 259 aa; no Hp match. Contains possible FT N-terminal signal sequence" FT /note="Updated (2006) note: Literature search identified FT paper (PMID:15231804) suggesting a number of differentially FT expressed genes (e.g. Cj0111) in microarray experiments may FT be co-trasncribed. Cj0111 seems to be iron induced and FT based on RT-PCR seems to be co-transcribed with Cj1658. FT Functional classification - Miscellaneous periplasmic FT proteins" FT /note="PMID:15231804" FT /db_xref="UniProtKB/TrEMBL:Q0PC26" FT /protein_id="CAL34282.1" FT /translation="MKNYGLSNLNSFLLALAIYISIVILVFFRLVSEVEPAIQYTDIKD FT SFVDIELAEPSKQVITQSNTPKEIQKPTEQIDIEKLFAQTTNKTVKTEDIDQKASNFNE FT LFGNIKEIQEEKTTKIQSSAKSGISSAPKPQASELVKQLNDSLLQEESSTQGESTKAQK FT IGIYDEFLGKVVRIITQRWTQYYPNSEKISVKVKIFIDENGKFGYTSVEKSGNPLYDAK FT VAEFLESQKGKFITYPPQNKNISITMNLRDEVKVKND" FT sig_peptide 116657..116758 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000046_116657_117436 by SignalP 2.0 FT HMM (Signal peptide probability 0.888) with cleavage site FT probability 0.573 between residues 34 and 35" FT misc_feature 116681..116749 FT /note="1 probable transmembrane helix predicted for Cj0111 FT by TMHMM2.0 at aa 9-31" FT /inference="protein motif:TMHMM:2.0" FT CDS 117446..118654 FT /transl_table=11 FT /gene="tolB" FT /locus_tag="Cj0112" FT /product="putative TolB precursor protein" FT /note="Original (2000) note: Cj0112, probable periplasmic FT protein, len: 402 aa; some similarity to TOLB_HAEIN P44677 FT tolB protein precursor (427 aa), blastp scores; E= 3.1e-09, FT 23% identity in 259 aa overlap. 41.0% identity to HP1126" FT /note="Updated (2006) note: Pfam domain PF04052 TolB FT amino-terminal domain identified within CDS. Further FT support given to product function. Characterisation has FT been carried out within Escherichia coli, however,identity FT score was not acceptable. Thus, putative kept within FT product function. Functional classification -Miscellaneous FT periplasmic proteins" FT /note="PMID:2687247, PMID:7929011, PMID:9761825" FT /db_xref="GOA:Q9PJ14" FT /db_xref="InterPro:IPR007195" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ14" FT /inference="protein motif:Pfam:PF04052" FT /protein_id="CAL34283.1" FT /translation="MKKIVAIFLVFLGSLWAEDPVIDVVNSGVVLPKIIVKDNSNLSDE FT NLKKSFYNIIVNDLKVSSNFEVVANATETSNYIFEYTLNKNGNTLSLNVKIKAGGSDKS FT EQTYTLNGLEQYPFLAHKSVKASVNALGLAPVDWMDHKILIARNSSSKKSQIIMADYTL FT TYQKVIVDGGLNLFPKWGNKEQTLFYYTAYDHDKPTLYRYDLNTNKASKILSSGGMVVA FT SDVNVDGSKLLVTMAPKDQPDVYLYDLNTKNLTQLTNYSGIDVNGNFIGSDDSKVVFVS FT DRLGYPNIFMQDLNSNSAEQVVFHGRNNSAVSTYKDFLVYSSREPNQAGVFNIYLMSIN FT SDYIRQLTANGKNLFPRFSSDGGSIVFIKYLGAQSALGVIRVNANKTFYFPLRVGKIQS FT IDW" FT sig_peptide 117446..117496 FT /note="Signal peptide predicted for tolB by SignalP 2.0 HMM FT (Signal peptide probability 0.904) with cleavage site FT probability 0.791 between residues 17 and 18" FT misc_feature 117455..117889 FT /note="HMMPfam hit to PF04052, TolB amino-terminal FT domain,score 4e-51" FT /inference="protein motif:Pfam:PF04052" FT misc_feature 118589..118621 FT /note="PS00284 Serpins signature" FT /inference="protein motif:Prosite:PS00284" FT CDS 118731..119228 FT /transl_table=11 FT /gene="pal" FT /locus_tag="Cj0113" FT /product="peptidoglycan associated lipoprotein (omp18)" FT /note="Original (2000) note: Cj0113, pal, peptidoglycan FT associated lipoprotein (omp18), len: 165 aa; identical to FT TR:Q46123 (EMBL:X83374) precursor of peptidoglycan FT associated lipoprotein (165 aa), almost identical to FT TR:Q46099 omp18 (165 aa) (93.9% identity). Similar to e.g. FT PAL_ECOLI peptidoglycan-associated lipoprotein precursor FT (173 aa), fasta scores; opt: 322 z-score: 491.5 E(): 4e-20, FT 38.5% identity in 169 aa overlap. 42.2% identity (in 109 aa FT overlap) to HP1125. Contains N-terminal signal sequence FT with appropriately positioned PS00013 Prokaryotic membrane FT lipoprotein lipid attachment site and Pfam match to entry FT PF00691 OmpA, OmpA family, score 100.60, E-value 3.2e-26" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni (PMID:8576327). Putative not added to FT product function. Functional classification - FT Membranes,lipoproteins and porins" FT /note="PMID:8576327" FT /db_xref="GOA:Q46123" FT /db_xref="HSSP:1OAP" FT /db_xref="InterPro:IPR014169" FT /db_xref="UniProtKB/TrEMBL:Q46123" FT /inference="protein motif:Pfam:PF00691" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34284.1" FT /translation="MKKILFTSIAALAVVISGCSTKSTSVSGDSSVDSNRGSGGSDGWD FT IDSKISQLNDTLNKVYFDFDKFNIRPDMQNVVSTNANIFNTEVSGVSITVEGNCDEWGT FT DEYNQALGLKRAKAVKEALIAKGVNADRIAVKSYGETNPVCTEKTKACDAQNRRAEFKL FT SR" FT sig_peptide 118731..118814 FT /note="Signal peptide predicted for pal by SignalP 2.0 HMM FT (Signal peptide probability 1.000) with cleavage site FT probability 0.827 between residues 28 and 29" FT misc_feature 118755..118787 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 118911..119201 FT /note="HMMPfam hit to PF00691, OmpA family, score 2.1e-27" FT /inference="protein motif:Pfam:PF00691" FT CDS 119232..120179 FT /transl_table=11 FT /locus_tag="Cj0114" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0114, possible periplasmic FT protein, len: 315 aa; similar to hypothetical protein FT YBGF_ECOLI hypothetical 28.2 kd protein in pal-lysT FT intergenic region (263 aa), fasta scores; opt: 144 z-score: FT 238.8 E(): 4.8e-06, 21.3% identity in 249 aa overlap. 28.6% FT identity to HP1124. Contains possible N-terminal signal FT sequence" FT /note="Updated (2006) note: Prosite PS50005 FT TPR_REPEAT,Tetratricopeptide region identified within CDS. FT Supporting paper identifies protein as a glycoprotein. FT Functional classification - Miscellaneous periplasmic FT proteins" FT /note="PMID:12186869" FT /db_xref="GOA:Q0PC23" FT /db_xref="InterPro:IPR011990" FT /db_xref="UniProtKB/TrEMBL:Q0PC23" FT /inference="protein motif:Prosite:PS50005" FT /protein_id="CAL34285.1" FT /translation="MKKIFTVALLGATLLYAESSAFGAGDITSNSSYGLTSNEKLFKEK FT LDNLNNENIQTNARINEINERIEGLQSTLEGINSQYAKSNSRLSQVEENNQNIENNFTS FT EIQKLKAYVEESRKIQEANNKQVKKVLAELSSLVDAINANYVSKNELNDANLSVKTITP FT SVVVSTTDSNSTIENNNTQNTQDDKAKQIDESWKKKKNNEILELAIKDVDKNAFEDSKA FT KLNFLITKQYKPARANFWLGEIEYKQKNYNNAIVYYKKSSSLSTKGDYFPKLLYHTAIS FT LDKTGDTKTANGFYKALKTNYPNSPEAKASPNRK" FT sig_peptide 119232..119300 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000047_119232_120179 by SignalP 2.0 FT HMM (Signal peptide probability 0.999) with cleavage site FT probability 0.874 between residues 23 and 24" FT misc_feature 119934..120035 FT /note="HMMPfam hit to PF07719, Tetratricopeptide FT repeat,score 0.012" FT /inference="protein motif:Pfam:PF07719" FT CDS 120194..120763 FT /transl_table=11 FT /gene="slyD" FT /locus_tag="Cj0115" FT /product="FKBP-type peptidyl-prolyl cis-trans isomerase" FT /EC_number="5.2.1.8" FT /note="Original (2000) note: Cj0115, slyD, probable FT peptidyl-prolyl cis-trans isomerase, len: 189 aa; similar FT to many of the FKBP-type e.g. SLYD_ECOLI FKBP-type FT peptidyl-prolyl cis-trans isomerase (196 aa), fasta scores; FT opt: 478 z-score: 296.9 E(): 2.8e-09, 38.5% identity in 200 FT aa overlap. 39.2% identity to HP1123" FT /note="Updated (2006) note: Prosite PS50059 FT FKBP_PPIASE,Peptidylprolyl isomerase, FKBP-type domain FT identified within CDS. Product modified to more specific FT family member due to motif match. Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Protein translation and modification" FT /note="PMID:9188461" FT /db_xref="GOA:Q0PC22" FT /db_xref="InterPro:IPR001179" FT /db_xref="UniProtKB/TrEMBL:Q0PC22" FT /inference="protein motif:Prosite:PS50059" FT /protein_id="CAL34286.1" FT /translation="MAIEKNSVVSMFYELKDANTNEVLESNLYSQPISFILGKGQILES FT LEEEVMKLDCPSNADVVIKKEKGLGEYDENAVQTLPKEQFAGIDLKVGMELFGEGENGE FT TVRVTVKEIGENDVTIDYNHPYAGRDLLFSLNIVDARAASEDEILTGIIAGSHSCGCGS FT GHGHDHHHGHGHGGGGCCGGGGCGCH" FT misc_feature 120701..120733 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 120763..121683 FT /transl_table=11 FT /gene="fabD" FT /locus_tag="Cj0116" FT /product="malonyl CoA-acyl carrier protein transacylase" FT /EC_number="2.3.1.39" FT /note="Original (2000) note: Cj0116, fabD, probable malonyl FT CoA-acyl carrier protein transacylase, len: 306 aa; similar FT to many e.g. FABD_ECOLI malonyl CoA-acyl carrier protein FT transacylase (EC 2.3.1.39) (308 aa), fasta scores; opt: 555 FT z-score: 655.2 E(): 3.1e-29, 36.1% identity in 296 aa FT overlap. 49.5% identity to HP0090. Contains Pfam match to FT entry PF00698 Acyl_transf, Acyl transferase domain, score FT 58.10, E-value 1.9e-13" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity scores. FT Thus,putative not added to product function. Functional FT classification - Fatty acid biosynthesis" FT /note="PMID:1339356, PMID:7768883, PMID:8759840" FT /db_xref="GOA:Q0PC21" FT /db_xref="InterPro:IPR004410" FT /db_xref="UniProtKB/TrEMBL:Q0PC21" FT /inference="protein motif:Pfam:PF00698" FT /protein_id="CAL34287.1" FT /translation="MNAAFIFPGQGSQSLGMGKDFYENSIKAKELLQNASDFCKIDFKH FT LLFEENEKLNQSEFTQPAIVLNSLMAYSVLLEKKPDLSSKFALGHSLGEFSALAVNGAF FT DFLEALSLVNKRGLFMQEDCAKVEAGMMVVLGLDDEKVEELCQKAQKENKQIFAANYNC FT DGQIVVAGLKPDLASYESVFKEAGAKRAMLLNMSVASHCPLLENASAKLCVELEKVLKP FT NFKAVISNANAKIYTSKEEALELLKAQLISPVLYKQSIKACENEVDYFIEFGASVLKGL FT NKKITSKETYALTNMNDIDEFLKVV" FT misc_feature 120772..121680 FT /note="HMMPfam hit to PF00698, Acyl transferase FT domain,score 6.7e-07" FT /inference="protein motif:Pfam:PF00698" FT CDS 121680..122369 FT /transl_table=11 FT /gene="pfs" FT /locus_tag="Cj0117" FT /product="5'-methylthioadenosine/S-adenosylhomocysteine FT nucleosidase" FT /EC_number="3.2.2.16" FT /note="Original (2000) note: Cj0117, pfs, probable FT 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase, FT len: 229 aa; similar to many e.g. PFS_ECOLI FT 5'-methylthioadenosine (EC 3.2.2.16) / FT S-adnosylhomocysteine nucleosidase (232 aa), fasta scores; FT opt: 478 z-score: 817.7 E(): 0, 36.7% identity in 229 aa FT overlap. 50.0% identity to HP0089. Contains Pfam match to FT entry PF01048 PNP_UDP_1, Phosphorylase family, score FT 216.20, E-value 4.7e-61" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity scores. FT Thus,putative not added to product function. Functional FT classification - Misc" FT /note="PMID:9524204" FT /db_xref="GOA:Q0PC20" FT /db_xref="InterPro:IPR010049" FT /db_xref="UniProtKB/TrEMBL:Q0PC20" FT /inference="protein motif:Pfam:PF01048" FT /protein_id="CAL34288.1" FT /translation="MMKIAILGAMSEEITPLLETLKDYTKIEHANNTYYFAKYKNHELV FT LAYSKIGKVNSTLSASVMIEKFGAQALLFTGVAGAFNPELEIGDLLYATKLAQYDLDIT FT AFGHPLGFVPGNEIFIKTDEKLNNLALEVAKELNIKLRAGIIATGDEFICDEAKKAKIR FT EIFNADACEMEGASVALVCDALKVPCFILRAMSDKAGEKAEFDFDEFVINSAKISANFV FT LKMCEKL" FT misc_feature 121686..122357 FT /note="HMMPfam hit to PF01048, Phosphorylase family, score FT 1.9e-56" FT /inference="protein motif:Pfam:PF01048" FT CDS 122366..123121 FT /transl_table=11 FT /locus_tag="Cj0118" FT /product="conserved hypothetical protein Cj0118" FT /note="Original (2000) note: Cj0118, unknown, len: 251 aa; FT similar to hypothetical proteins from many organisms e.g. FT YDAO_ECOLI (311 aa), fasta scores; opt: 447 z-score: 465.6 FT E(): 1.1e-18, 32.5% identity in 240 aa overlap. 49.4% FT identity to HP1182. Contains Pfam match to entry PF01171 FT UPF0021, Uncharacterized protein family UPF0021, score FT -88.80, E-value 9.9e-05" FT /note="Updated (2006) note: Pfam domain PF01171 PP-loop FT family identified within CDS. No specific characterisation FT has been carried out. Thus, putative kept within product FT function. Conserved added to product function. Functional FT classification - Conserved hypothetical proteins" FT /db_xref="GOA:Q0PC19" FT /db_xref="InterPro:IPR014729" FT /db_xref="UniProtKB/TrEMBL:Q0PC19" FT /inference="protein motif:Pfam:PF01171" FT /protein_id="CAL34289.1" FT /translation="MINLSKKLIRQVAQANAKFGLIKDGDRVLLGLSGGKDSLALAHLL FT NRMQAHAPFKFELEAVTLSYGMGEDYSHLHAHCEEHGIKHSVLDSNIYEVSGDTIRENS FT SFCSYFSRMRRGALYTYALEKGFNKLAIAHHLDDAAESFFMNFIHNGALRTLAPIYQSK FT RGITVIRPLIFVRERQLRDNATQNELSVIGNEFCPGMKLSEKNVKFPHAREEAKQLLAN FT LEKDHPKLFTSLKTAFANLHTESFWLQKA" FT misc_feature 122444..123043 FT /note="HMMPfam hit to PF01171, PP-loop family, score 4e-14" FT /inference="protein motif:Pfam:PF01171" FT CDS 123126..123647 FT /transl_table=11 FT /locus_tag="Cj0119" FT /product="putative hydrolase" FT /note="Original (2000) note: Cj0119, unknown, len: 173 aa; FT similar to a hypothetical protein from B. subtilis FT TR:O32091 (EMBL:Z99120) YUEJ protein (183 aa), fasta FT scores; opt: 172 z-score: 282.5 E(): 1.8e-08, 29.5% FT identity in 166 aa overlap. No Hp match" FT /note="Updated (2006) note: Motif match (IPR000868) FT identified link to hydrolase. Product modified to more FT specific family member based on motif match. No specific FT characterisation with acceptable identity score has been FT carried out yet. Putative kept within product function. FT Functional classification - Misc" FT /db_xref="GOA:Q0PC18" FT /db_xref="InterPro:IPR000868" FT /db_xref="UniProtKB/TrEMBL:Q0PC18" FT /protein_id="CAL34290.1" FT /translation="MKKAFVLVDYQNDFIDGSLGFDKALKIKENILKALNQIDFNNTHL FT LLTYDTHDEHYLQSKEGLNLPVKHCIKESLGWQMPKEFEPFLQKAHKIFYKNTFGSLEL FT ANFIQKSDYEELHFAGLVSHICVFCNIILAFGAKPNARIILHQNLSASFDENLEKSAFD FT ILRAYGIEIV" FT CDS 123647..124261 FT /transl_table=11 FT /locus_tag="Cj0120" FT /product="hypothetical protein Cj0120" FT /note="Original (2000) note: Cj0120, unknown, len: 204 aa; FT 41.7% identity to HP0951. Functional classification FT -Conserved hypothetical proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PC17" FT /protein_id="CAL34291.1" FT /translation="MQGFILHTQKVKDEDLIVYILSPKMLIKAYRFYGLRHSSILSGYK FT IDFALEENPSFLPRLKDVLHLGFLWIMQRDKMLIWQEFIRLLYRHLKDVEELDSFYFDL FT LDECVKRFEKQNPKRVIVDAYLKILEFEGRLHKDFFCFACDEKIQNSITLLRAFLPSHS FT QCALGFEFEEKKLKQFYSSKNCAIFDDEEIENLYHLIKEGL" FT CDS 124258..124665 FT /transl_table=11 FT /locus_tag="Cj0121" FT /product="conserved hypothetical protein Cj0121" FT /note="Original (2000) note: Cj0121, unknown, len: 135 aa; FT similar to hypothetical proteins from many organisms e.g. FT YBEY_ECOLI (155 aa) fasta scores; opt: 218 z-score: 353.9 FT E(): 1.9e-12, 37.8% identity in 111 aa overlap. 59.8% FT identity to HP1160" FT /note="Updated (2006) note: Pfam PF02130 Uncharacterized FT protein family UPF0054 was present within CDS. Conserved FT added to product function. Functional classification FT -Conserved hypothetical proteins" FT /db_xref="GOA:Q9PJ06" FT /db_xref="InterPro:IPR002036" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ06" FT /inference="protein motif:Pfam:PF02130" FT /protein_id="CAL34292.1" FT /translation="MILSDEKCDFLESIASFLSPKDVELVFVDSKEMQEINLEQRKQDK FT TTDVLSFPLENIDESLPLGSVVINVDLAKEKAKELGHSYEEEISLLFIHAMLHLLGFDH FT ENDNGEMREKEKELIEHFNLPKSLIVRTLED" FT misc_feature 124339..124602 FT /note="HMMPfam hit to PF02130, Uncharacterized protein FT family UPF0054, score 6.5e-36" FT /inference="protein motif:Pfam:PF02130" FT CDS 124789..125478 FT /transl_table=11 FT /locus_tag="Cj0122" FT /product="hypothetical protein Cj0122" FT /note="Original (2000) note: Cj0122, unknown, len: 229 aa; FT no Hp match. Similar in C-terminus to Cj0055c (46.6% FT identity in 148 aa overlap), and in N-terminus to Cj0416 FT (88.2% identity in 34 aa overlap)" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Functional classification FT -Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PC15" FT /protein_id="CAL34293.1" FT /translation="MIVFPLSSFNRYFGNNPLQTLTKIRDESIENGNPELTKKQREELG FT NDLIDLYKISKKFSDKIELVEGSIEDKLRNNELPESEVKNLFQWMDENAKHPRWMHIDG FT VSYDEAYVKIFHTSKSIDEFKEKYLELQKKYFVDFNNIDSSQKKLQETSEEDKKAFKPI FT QVESKSETYKDDNKMNELLRKLLETKFGTSDELEILFGMNFSNDNAGEFNKILSQNTSA FT KIIDIKA" FT CDS complement(125503..126429) FT /transl_table=11 FT /locus_tag="Cj0123c" FT /product="putative tRNA-dihydrouridine synthase" FT /note="Original (2000) note: Cj0123c, possible FT transcriptional regulator, len: 308 aa; similar to FT hypothetical proteins e.g. YACF_BACSU (333 aa), fasta FT scores; opt: 566 z-score: 916.8 E(): 0, 37.2% identity in FT 312 aa overlap, and to e.g. NIR3_RHOCA nitrogen regulation FT protein nifR3 (324 aa), fasta scores; opt: 517 z-score: FT 616.2 E(): 4.6e-27, 34.4% identity in 317 aa overlap. 49.5% FT identity to HP0727. Contains Pfam match to entry PF01207 FT UPF0034, Uncharacterized protein family UPF0034,score FT 260.90, E-value 1.7e-74" FT /note="Updated (2006) note: Pfam domain PF01207 FT Dihydrouridine synthase (Dus) identified within CDS. FT Product modified to more specific family member due to FT motif match. No specific characterisation with acceptable FT identity scores carried out yet. Thus, putative kept within FT product function. Functional classification - Misc" FT /db_xref="GOA:Q0PC14" FT /db_xref="InterPro:IPR013785" FT /db_xref="UniProtKB/TrEMBL:Q0PC14" FT /inference="protein motif:Pfam:PF01207" FT /protein_id="CAL34294.1" FT /translation="MIDFSKKPLFLAPMAGFSDLPFRNVVKKFGADITISEMISSNALV FT YESSKTLHMLERAELENPYIVQIAGGDKEVLKKAVQMLNEMDFVDGIDFNCGCPVNKVV FT KQCAGSALLENLELFKNLVGVIKENNKKSLTSVKFRLGFNEKYPEKMAKICESLGVDFI FT SIHGRTRKQLYSGKADYGSIASAKASVKIPVIANGDINAQNAKEVYKITKCDGLMIGRA FT SVGNPWIFYEIKSGKSVDEKLKKEIILTHFDEMIKHYKDQGVSIFRKHLHEYSKGHKDA FT STFRDTVNRIDNVEEMRKKIEEFFSLT" FT misc_feature complement(125515..126402) FT /note="HMMPfam hit to PF01207, Dihydrouridine synthase FT (Dus), score 3.1e-75" FT /inference="protein motif:Pfam:PF01207" FT CDS complement(126426..127412) FT /transl_table=11 FT /locus_tag="Cj0124c" FT /product="putative membrane protein" FT /note="Original (2000) note: Cj0124c, probable membrane FT protein, len: 328 aa; 21.1% identity to HP0948. Contains FT two possible transmembrane domains. Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="GOA:Q0PC13" FT /db_xref="UniProtKB/TrEMBL:Q0PC13" FT /protein_id="CAL34295.1" FT /translation="MKIKLFLLASFIYIALIFAFAWHLELGSYTLNISTYTFELPIMIW FT LVIPLFIYMILAVLHIAFYGFLRYLKFKHFFKDAAKFEAYTQDLLLEKDLKTTFQTKEF FT RSVAQLFKTIKTHEKIPHSNKINEILDLIDGLNKNEFFNLSKFKLENNNVLYLQNEKNH FT LKNDANYAYNKLKNLNEIKDEFEEIAFNTLIEKASYEQIKNVKIPKKPSEVLTLIKRFK FT EGNLELSVAEYEVLLSHNILSEKDYLNAAKLSTKLLNPDAILGIFNKIKNEKSEALRAY FT LYLLAEFGLLDELREQIHNDDKKFNDFKAFLALREKNIKIDLNQLIQ" FT misc_feature complement(order(127332..127400,127221..127289)) FT /note="2 probable transmembrane helices predicted for FT Cj0124c by TMHMM2.0 at aa 5-27 and 42-64" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(127350..127412) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000054_126426_127412 by SignalP 2.0 FT HMM (Signal peptide probability 0.978) with cleavage site FT probability 0.782 between residues 21 and 22" FT CDS complement(127402..127764) FT /transl_table=11 FT /locus_tag="Cj0125c" FT /product="hypothetical protein Cj0125c" FT /note="Original (2000) note: Cj0125c, unknown, len: 120 aa; FT some similarity to e.g. DKSA_ECOLI dnaK suppressor protein FT (151 aa), fasta scores; opt: 186 z-score: 276.6 E(): FT 3.8e-08, 26.3% identity in 118 aa overlap. No Hp match. FT Contains PS01102 Prokaryotic dksA/traR C4-type zinc finger FT and Pfam match to entry PF01258 zf_dskA_traR,Prokaryotic FT dksA/traR C4-type zinc finger, score 39.20,E-value 9.7e-08" FT /note="Updated (2006) note: No specific characterisation FT has been carried out yet. Functional classification FT -Conserved hypothetical proteins" FT /db_xref="GOA:Q0PC12" FT /db_xref="InterPro:IPR020458" FT /db_xref="UniProtKB/TrEMBL:Q0PC12" FT /inference="protein motif:Pfam:PF01258" FT /inference="protein motif:Prosite:PS01102" FT /protein_id="CAL34296.1" FT /translation="MKKNEIQNFKNILEERKKAILENLQSNSNEIEALHNSVPSDSVDF FT SVIETGSQIDFAISTNLKEELIEIEDSLDKIKNGTYGICESCDDEIDSQRLKVKPHARY FT CITCRQIAEQGKKHEN" FT misc_feature complement(127417..127617) FT /note="HMMPfam hit to PF01258, Prokaryotic dksA/traR FT C4-type zinc finge, score 6.8e-09" FT /inference="protein motif:Pfam:PF01258" FT misc_feature complement(127441..127515) FT /note="PS01102 Prokaryotic dksA/traR C4-type zinc finger" FT /inference="protein motif:Prosite:PS01102" FT CDS complement(127776..128237) FT /transl_table=11 FT /locus_tag="Cj0126c" FT /product="conserved hypothetical protein Cj0126c" FT /note="Original (2000) note: Cj0126c, unknown, len: 153 aa; FT similar to hypotheticals e.g. YBEA_ECOLI (155 aa),fasta FT scores; opt: 189 z-score: 288.6 E(): 8.1e-09, 28.1% FT identity in 153 aa overlap. 37.2% identity to HP0949" FT /note="Updated (2006) note: Pfam PF02590 Uncharacterized FT ACR family was present within CDS. Conserved added to FT product function. Functional classification - Conserved FT hypothetical proteins" FT /db_xref="GOA:Q9PJ01" FT /db_xref="InterPro:IPR003742" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ01" FT /inference="protein motif:Pfam:PF02590" FT /protein_id="CAL34297.1" FT /translation="MENNLQVNIFCIQKSDEFKTCSEKYSKLISKYATLKEINVFNKKI FT ALAQNLNAIEAKKSYEEAFMPYKKGYCIALDEKGKDLTSIEFAKLIQDKNELSFFIGGA FT YGLREEFNQSLDFRLSLSKLTLAHQFVKTLLLEQIYRAFCINNNHPYHK" FT misc_feature complement(127782..128225) FT /note="HMMPfam hit to PF02590, Uncharacterized ACR,COG1576, FT score 9.2e-69" FT /inference="protein motif:Pfam:PF02590" FT CDS complement(128227..129069) FT /transl_table=11 FT /gene="accD" FT /locus_tag="Cj0127c" FT /product="acetyl-coenzyme A carboxylase carboxyl FT transferase subunit beta" FT /EC_number="6.4.1.2" FT /note="Original (2000) note: Cj0127c, accD, probable FT acetyl-coenzyme A carboxylase carboxyl transferase subunit FT beta , len: 280 aa; similar to many e.g. ACCD_ECOLI FT acetyl-coenzyme A carboxylase carboxyl transferase subunit FT beta (EC 6.4.1.2) (304 aa), fasta scores; opt: 903 z-score: FT 1278.3 E(): 0, 53.4% identity in 251 aa overlap. 65.5% FT identity to HP0950" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Thus,putative not added to product function. Functional FT classification - Fatty acid biosynthesis" FT /note="PMID:7678242, PMID:1355086" FT /db_xref="GOA:Q0PC10" FT /db_xref="InterPro:IPR011762" FT /db_xref="UniProtKB/TrEMBL:Q0PC10" FT /protein_id="CAL34298.1" FT /translation="MNFADIFSKIRRQQPSVKEAPNHWVKCQSCHALMYYKEIESCFNV FT CPKCNYHMRISADERIKLLSDEGSFIEYDANLEAIDPLKFVDSKSYKKRLSEGESKTGR FT KSSVISGECEINGLKTQLVVFDFSFMGGSLGSVEGEKIVRAIQRAITSKTSLVIVSASG FT GARMQESTYSLMQMSKTSAALKLLSKEKLPYISILTDPTMGGVSASFAWLGDLIIAEPE FT ALVGFAGARVIKQTIGADLPEGFQKAEFLLEHGLIDAIVERGEQKQYLSDVLKFFSGK" FT misc_feature complement(128974..128991) FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT CDS complement(129078..129800) FT /transl_table=11 FT /locus_tag="Cj0128c" FT /product="putative inositol monophosphatase family protein" FT /note="Original (2000) note: Cj0128c, unknown, len: 240 aa; FT some similarity to e.g. SUHB_ECOLI extragenic suppressor FT protein suhB (267 aa), fasta scores; opt: 168 z-score: FT 229.0 E(): 1.7e-05, 29.9% identity in 134 aa overlap. No Hp FT match" FT /note="Updated (2006) note: Pfam domain PF00459 Inositol FT monophosphatase family identified within CDS. Product FT modified to more specific family member due to motif match. FT Characterised within Escherichia coli, however,identity FT scores were not acceptable. Functional classification - FT Misc" FT /note="PMID:10747806, PMID:8002619" FT /db_xref="GOA:Q0PC09" FT /db_xref="InterPro:IPR000760" FT /db_xref="UniProtKB/TrEMBL:Q0PC09" FT /inference="protein motif:Pfam:PF00459" FT /protein_id="CAL34299.1" FT /translation="MKEFLDACLNANLQIRKYLNNIPQNDLKLCSKLGYDKNQGYELDL FT KCEQIFIKYLSCFGQIFSEESGLIGKASPKQMILDPLDGSSNFVSKIPFYGTSIALMEK FT DQAKSAFVCNLVSQEIFAFNNKQAFKSNLSDPKYSPLTPNLFSKIGIVEKISLYPELLD FT FLTKNQLKFRSLGATALSLAYASYFSFVLILGKTRIFDTAAALAIHQNLYIEKNENFLL FT LSQDKKIFDIILEFLKNN" FT misc_feature complement(129096..129800) FT /note="HMMPfam hit to PF00459, Inositol monophosphatase FT family, score 1.2e-06" FT /inference="protein motif:Pfam:PF00459" FT misc_feature complement(129219..129287) FT /note="1 probable transmembrane helix predicted for Cj0128c FT by TMHMM2.0 at aa 172-194" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(129800..132019) FT /transl_table=11 FT /locus_tag="Cj0129c" FT /product="outer membrane protein" FT /note="Original (2000) note: Cj0129c, probable outer FT membrane protein, len: 739 aa; similar to e.g. TR:O30912 FT (EMBL:AF021245) Neisseria meningitidis outer membrane FT protein omp85 (797 aa), fasta scores; opt: 643 z-score: FT 886.3 E(): 0, 25.3% identity in 782 aa overlap, and FT D152_HAEIN protective surface antigen d15 precursor (795 FT aa), fasta scores; opt: 523 z-score: 548.2 E(): FT 2.8e-23,24.3% identity in 807 aa overlap. 34.2% identity to FT HP0655. Contains N-terminbal signal sequence and Pfam match FT to entry PF01103 Bac_suface_Ag, Bacterial surface antigen, FT score 404.10, E-value 1.3e-117" FT /note="Updated (2006) note: Pfam domains PF01103 Surface FT antigen and x5 PF07244 Surface antigen variable number FT repeat were identified within CDS. Further support given to FT product function. Literature search identified papers FT giving further clues to product function. Characterisation FT has been carried out within Escherichia coli, FT however,identity scores were marginal. Appropriate motifs FT were present. Putative not added to product function. FT Functional classification - Membranes, lipoproteins and FT porins" FT /note="PMID:11422558, PMID:16102012" FT /db_xref="GOA:Q0PC08" FT /db_xref="InterPro:IPR000184" FT /db_xref="UniProtKB/TrEMBL:Q0PC08" FT /inference="protein motif:Pfam:PF07244" FT /inference="protein motif:Pfam:PF01103" FT /protein_id="CAL34300.1" FT /translation="MKKHLISICALVAMANAATIKDIKFIGLNHLSNTSAINIAGLKIG FT EEINPAKINTAILNLYKQNYFENIAVENNNGILEIIVTEKPTIAKVTITGIASNDRKQV FT ESILGIKRGTLLDEGNIKEAIERIKAYYEAKSYFDTIVEYKKKTLENTDGLELEFIVNR FT GENIIIDNVHLSGAKKFSYSDIEPAVVNKEKEFMGWMWGRNDGKLKVFELSNDSSRIAD FT EYMKKGYLDVQVSSPYLKTYTDTYQANLTYFIKEGKPYKIKSISIENPLFDDKQNAQTV FT KDLRSSAGKTINIEDIRKDVKTIETQSADLGYAFVEVYPDIQKNDQTQEATVVFKVIPH FT DKVYIRNVIISGNSRTVDRVIRRELYITEGNLYNRTDLSESKNALKRTSYFDDVNIKEE FT KVDDTHIDLIVDVKEASTGAISGGIGYGSSDGILLNASLSDTNIFGSGIKSSVSVDKSD FT DTLSGRISLVNPRVLDSQYSLGGTLYSNDYEWDNYSEKNYGFDITIGRQFARYYNVSLT FT YNLEQSDIYHLSPTLLRTGYELGKSIKSSITPAITFNDTDDYYLPRSGIIASTSLEYAG FT LGGDQEFISSSSKFNFYQGLQDYIGYDLIYRYKASFYKVWDEGYLPINQRIYLGGIRSI FT RGFESRTVSPKNQWGDEIGGTIAFANSVELSFPLIDRIKLRGSVFFDYGMIGRKNLDEI FT KRMSTGIGIEWITPIGPLQLVFAKPLNDKKGDDTNSFEFNLGTRF" FT misc_feature complement(129803..130726) FT /note="HMMPfam hit to PF01103, Surface antigen, score FT 3e-78" FT /inference="protein motif:Pfam:PF01103" FT misc_feature complement(130760..130921) FT /note="HMMPfam hit to PF07244, Surface antigen variable FT number repeat, score 5.9e-08" FT /inference="protein motif:Pfam:PF07244" FT misc_feature complement(130991..131164) FT /note="HMMPfam hit to PF07244, Surface antigen variable FT number repeat, score 3e-07" FT /inference="protein motif:Pfam:PF07244" FT misc_feature complement(131234..131416) FT /note="HMMPfam hit to PF07244, Surface antigen variable FT number repeat, score 1.7e-07" FT /inference="protein motif:Pfam:PF07244" FT misc_feature complement(131519..131692) FT /note="HMMPfam hit to PF07244, Surface antigen variable FT number repeat, score 1.3e-07" FT /inference="protein motif:Pfam:PF07244" FT misc_feature complement(131756..131896) FT /note="HMMPfam hit to PF07244, Surface antigen variable FT number repeat, score 3.7e-07" FT /inference="protein motif:Pfam:PF07244" FT sig_peptide complement(131969..132019) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000058_129800_132019 by SignalP 2.0 FT HMM (Signal peptide probability 0.997) with cleavage site FT probability 0.981 between residues 17 and 18" FT CDS 132096..132923 FT /transl_table=11 FT /gene="tyrA" FT /locus_tag="Cj0130" FT /product="putative prephenate dehydrogenase" FT /EC_number="1.3.1.12" FT /note="Original (2000) note: Cj0130, tyrA, probable FT prephenate dehydrogenase, len: 275 aa; similar to e.g. FT TYRA_BACSU prephenate dehydrogenase (EC 1.3.1.12) (372 aa), FT fasta scores; opt: 474 z-score: 529.7 E(): 3e-22,31.0% FT identity in 284 aa overlap. 45.3% identity to HP1380" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis with marginal identity score. Alignment does not FT cover full sequence length. Putative kept within product FT function. Functional classification - Amino acid FT biosynthesis - Aromatic amino acid family" FT /note="PMID:3106153" FT /db_xref="GOA:Q0PC07" FT /db_xref="InterPro:IPR003099" FT /db_xref="UniProtKB/TrEMBL:Q0PC07" FT /protein_id="CAL34301.1" FT /translation="MKIAIIGLGLMGGSLGLCLKENKLISCVYGMDLSKENEKDALQLG FT LIHELIEFKDLALCDMIFVATPVNAIIEILQKLVDLPSNVTIIELGSTKRKIIESLPKN FT LIKQTLFAHPMTGTENSGPKAAFKELYKDAVCVLCDSEIADDLHQKRAVEIFSHLGMKI FT VFMDSKAHDHHAAIISHLPHVISFSLANFVMKEEDKRNIVHLAGGSFKGMSRIAKSSPQ FT MWESIFLQNKDNLLSSIDFFQQELERCKQMIQLDKNDELREWMKQANTLREIL" FT misc_feature 132108..132911 FT /note="HMMPfam hit to PF02153, Prephenate FT dehydrogenase,score 1.2e-83" FT /inference="protein motif:Pfam:PF02153" FT CDS 133003..134376 FT /transl_table=11 FT /locus_tag="Cj0131" FT /product="putative peptidase M23 family protein" FT /note="Original (2000) note: Cj0131, probable periplasmic FT protein, len: 457 aa; similar to hypothetical proteins FT e.g.TR:O25694 (EMBL:AE000754) Aquifex aeolicus AQ_1743 (422 FT aa), fasta scores; opt: 401 z-score: 635.2 E(): 4e-28, FT 30.0% identity in 420 aa overlap. 30.0% identity to HP1054. FT Contains probable N-terminal signal sequence. Also similar FT in C-terminus to Cj1235 (30.2% identity in 222 aa overlap)" FT /note="Updated (2006) note: Pfam domain PF01551 Peptidase FT family M23 identified within CDS. Product modified to more FT specific family member due to motif match. No specific FT characterisation with acceptable identity scores identified FT yet. Thus, putative kept within product function. FT Functional classification - Degradation of macromolecules - FT Proteins, peptides and glycopeptides" FT /db_xref="GOA:Q0PC06" FT /db_xref="InterPro:IPR002886" FT /db_xref="UniProtKB/TrEMBL:Q0PC06" FT /inference="protein motif:Pfam:PF01551" FT /protein_id="CAL34302.1" FT /translation="MAKRKGKTYLSVLILVLIAILIFFISRLSIFEKNPPQILMPDVVY FT TDLKKPILVHIKDDESSIKNVQIILHKDDNTSAMVIADEKISNLKDITLQVALPKFGYK FT ENVKSFVLEVIAKDSSFWNFFSGNEARKQIAVLVDNTAPKINIISNSYQIEQGGAGAVV FT FKADDANLDKVYIETNKGKIFKATPYVKEGYYAALIAWDARDEEFRAFVIATDKAGNIS FT KERIRYYFVNRKYRVSNINLTDKFLDGKIENLANQYAPKDNNLNRYEKFKFVNETLRNS FT NEKLIHEITSKVPEEKIDNFDLNLFLPLKNGMKVADFADHRYYSYNGQFVSDSYHMGLD FT LASVAQAPIISNNAGKVVFAAENGIYGLNLIVYHGFGVYSLYGHCSSKNVDLDEMINKQ FT SIIGKTGTSGLALGDHLHFGVLVQGVETRPEQWQDKKWIENNIYNVLNDGKKIILGKN" FT sig_peptide 133003..133098 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000059_133003_134376 by SignalP 2.0 FT HMM (Signal peptide probability 0.999) with cleavage site FT probability 0.745 between residues 32 and 33" FT misc_feature 133027..133095 FT /note="1 probable transmembrane helix predicted for Cj0131 FT by TMHMM2.0 at aa 9-31" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 134002..134289 FT /note="HMMPfam hit to PF01551, Peptidase family M23, score FT 5.2e-27" FT /inference="protein motif:Pfam:PF01551" FT CDS 134376..135260 FT /transl_table=11 FT /gene="lpxC" FT /locus_tag="Cj0132" FT /product="UDP-3-O-[3-hydroxymyristoyl] n-acetylglucosamine FT deacetylase" FT /EC_number="3.5.1.-" FT /note="Original (2000) note: Cj0132, lpxC, probable FT UDP-3-O-[3-hydroxymyristoyl] n-acetylglucosamine FT deacetylase, len: 294 aa; simlar to e.g. LPXC_ECOLI FT UDP-3-O-[3-hydroxymyristoyl] n-acetylglucosamine FT deacetylase (305 aa), fasta scores; opt: 804 z-score: FT 1267.2 E(): 0, 42.5% identity in 287 aa overlap. 54.9% FT identity to HP1052" FT /note="Updated (2006) note: Pfam domain PF03331 FT UDP-3-O-acyl N-acetylglycosamine deacetylase identified FT within CDS. Further support given to product function. FT Characterised within Escherichia coli with acceptable FT identity scores. Thus, putative not added to product FT function. Functional classification - Surface FT polysaccharides, lipopolysaccharides and antigens" FT /note="PMID:8752330" FT /db_xref="GOA:Q9PIZ5" FT /db_xref="HSSP:1P42" FT /db_xref="InterPro:IPR004463" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIZ5" FT /inference="protein motif:Pfam:PF03331" FT /protein_id="CAL34303.1" FT /translation="MKQLTLAKTVKGVGIGLHKGEPIEITLEPLEANSGIVFFRSDLNA FT SYKASPENVINTQMATVLGDDRGFISTIEHLMSAINAYGIDNVRIVLNANEAPVMDGSS FT ISFCMMLDEAGVKELDAPKKIMVIKKPIEVRDGNKFVRLTPTKEPRINYTIKFDNAVIG FT EQSYNFEFSKKNYIENIARARTFGFLKDVQALRSMNLALGGSLENTIVVDENRILNPEG FT LRFKDEFVRHKILDAIGDLTLLGYRVFGDYTSYAGSHHLNHLLTKEVLKDKDAYEIVSL FT EKTTQKAYEKVFA" FT misc_feature 134376..135197 FT /note="HMMPfam hit to PF03331, UDP-3-O-acyl FT N-acetylglycosamine deacetylase, score 5.5e-135" FT /inference="protein motif:Pfam:PF03331" FT CDS 135299..135700 FT /transl_table=11 FT /locus_tag="Cj0133" FT /product="putative glycoprotease family protein" FT /note="Original (2000) note: Cj0133, unknown, len: 133 aa; FT 33.6% identity to HP1051" FT /note="Updated (2006) note: Pfam domain PF00814 FT Glycoprotease family identified within CDS. Further support FT given to product function. No specific characterisation FT with acceptable identity score carried out yet. Putative FT kept within product function. Functional classification - FT Degradation of macromolecules - Proteins,peptides and FT glycopeptides" FT /db_xref="GOA:Q0PC04" FT /db_xref="UniProtKB/TrEMBL:Q0PC04" FT /inference="protein motif:Pfam:PF00814" FT /protein_id="CAL34304.1" FT /translation="MIGIYQDDKLIKTYKSEEKASEFLPKILDELLKEYDFTSLIYANG FT PGSYMGIKISYVSLSTLSIVKNIPLFAVSAFELNGYKPISANKNFCFVYKEGEICLEQN FT IPAEFFLPKNLQELKLNNDNLPFYFLDAI" FT misc_feature 135323..135550 FT /note="HMMPfam hit to PF00814, Glycoprotease family, score FT 1e-18" FT /inference="protein motif:Pfam:PF00814" FT CDS 135709..136587 FT /transl_table=11 FT /gene="thrB" FT /locus_tag="Cj0134" FT /product="putative homoserine kinase" FT /EC_number="2.7.1.39" FT /note="Original (2000) note: Cj0134, thrB, probable FT homoserine kinase, len: 292 aa; similar to many e.g. FT KHSE_FREDI homoserine kinase (EC 2.7.1.39) (307 aa), fasta FT scores; opt: 537 z-score: 750.4 E(): 0, 31.6% identity in FT 294 aa overlap. 51.6% identity to HP1050. Contains PS00627 FT GHMP kinases putative ATP-binding domain" FT /note="Updated (2006) note: Pfam domain PF00288 GHMP FT kinases putative ATP-binding protein identified within CDS. FT Further support given to product function. Characterised FT within Fremyella diplosiphon with marginal identity score. FT Putative kept within product function" FT /note="Updated (2006) note: PMID:2838727. Functional FT classification - Amino acid biosynthesis - Aspartate FT family" FT /note="PMID:2838727" FT /db_xref="GOA:Q9PIZ3" FT /db_xref="InterPro:IPR014721" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIZ3" FT /inference="protein motif:Pfam:PF00288" FT /inference="protein motif:Prosite:PS00627" FT /protein_id="CAL34305.1" FT /translation="MKILVPATSANLGPGFDCLGLSLKLFNETQIQKSGVFSISIGGEG FT SDNIFLKKNNIFVNIFYEIYEKLSGKKDNFRFIFQNNIPLSRGLGSSSAVIVGAIASAY FT YMSGFKVEKECILDEALIYENHPDNIAPATLGGFVCSLVEKNKVYSIKKEIDKDLAAVV FT VIPNLAMSTEQSRQALAKNLSFNDAVFNLSHASFLTACFLEKKYEFLKFASQDKLHEIN FT RMKNLPELFEVQKFALENKALMSTLSGSGSSFFSLAFKDDALALAKKIQTKFKDFRVQY FT LEFDDNGFEIC" FT misc_feature 135928..136494 FT /note="HMMPfam hit to PF00288, GHMP kinases putative FT ATP-binding protei, score 6e-28" FT /inference="protein motif:Pfam:PF00288" FT misc_feature 135955..135990 FT /note="PS00627 GHMP kinases putative ATP-binding domain" FT /inference="protein motif:Prosite:PS00627" FT misc_feature 136279..136311 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 136612..136869 FT /transl_table=11 FT /locus_tag="Cj0135" FT /product="conserved hypothetical protein Cj0135" FT /note="Original (2000) note: Cj0135, unknown, len: 85 aa; FT 44.6% identity to HP1049" FT /note="Updated (2006) note: Pfam PF04296 Protein of unknown FT function (DUF448) was present within CDS. Conserved added FT to product function. Functional classification - Conserved FT hypothetical proteins" FT /db_xref="InterPro:IPR007393" FT /db_xref="UniProtKB/TrEMBL:Q0PC02" FT /inference="protein motif:Pfam:PF04296" FT /protein_id="CAL34306.1" FT /translation="MKKHIPIRMCIVCKNRFEQNMLFRFKVVLGDIVPKAEHGRSGYLC FT QNCIEREDKVLQKAFSKICKNLNTKITQQGLKEIFLNGKD" FT misc_feature 136624..136857 FT /note="HMMPfam hit to PF04296, Protein of unknown function FT (DUF448), score 5.8e-31" FT /inference="protein motif:Pfam:PF04296" FT CDS 136856..139471 FT /transl_table=11 FT /gene="infB" FT /locus_tag="Cj0136" FT /product="translation initiation factor IF-2" FT /note="Original (2000) note: Cj0136, infB, probable FT translation initiation factor IF-2, len: 871 aa; similar to FT many e.g. IF2_ENTFC translation initiation factor IF-2 (784 FT aa), fasta scores; opt: 1893 z-score: 1909.4 E(): 0,40.0% FT identity in 865 aa overlap. 46.3% identity to HP1048. FT Contains PS00017 ATP/GTP-binding site motif A (P-loop), FT PS01176 Initiation factor 2 signature and Pfam match to FT entry PF00009 GTP_EFTU, Elongation factor Tu family FT (contains ATP/GTP binding P-loop), score 136.20,E-value FT 6e-37" FT /note="Updated (2006) note: Characterised within FT Escherichia coli and Bacillus subtilis with acceptable FT identity scores. Thus, putative not added to product FT function. Functional classification - Protein translation FT and modification" FT /note="PMID:2110148, PMID:3025199" FT /db_xref="GOA:Q9PIZ1" FT /db_xref="HSSP:1G7R" FT /db_xref="InterPro:IPR004161" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIZ1" FT /inference="protein motif:Pfam:PF00009" FT /inference="protein motif:Prosite:PS01176" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34307.1" FT /translation="MAKIRIHEIAKELGYDSKEIIEKANELGLGIKTASNAVEPEIAAA FT IYEYIQTREIPEAFKKNIKTPTAKKPKKENIKEQEKLNESEKKEPKKEEKLKQEVKKEE FT LKIEKENAKEEEKQEIIDAHKPQSLASATLAKRRGLVIVKKKKDEEEIQVKKEEVKNSN FT DISINNEERLSLKTMFSNADESLKKKKKEKKSFVASKKESTEKMNFLDEHDFGDISLDD FT EDEVVLPDFSVKEQEKPQNINKKQPNFIRQAVGNSAGFGFEGGIQRRSRKKPSKKIEKK FT EVEEVGSVAISKEIRVYEFADKIGKSTSEVISKLFMLGMMTTKNDFLDEDAIEILAAEF FT GIEINIINEADEFDYVKDYEEETDEKDLVTRAPVITIMGHVDHGKTSLLDYIRKSRVAS FT GEAGGITQHVGAYMVEKNGRKITFIDTPGHEAFTAMRARGASITDIVIIVVAADDGVKP FT QTKEAINHAKAAGVPIIIAINKMDKEAANPDMVKTQLAEMEIMPVEWGGSYEFVGVSAK FT TGMGIEDLLEIVLLQADILELKANPKSFAKASIIESSVQKGRGAVATVIVQNGTLTVGS FT TVVAGEAYGKVRAMSDDQGKALKEIKPGECGVIVGLSEVADAGEILIAVKTDKEAREYA FT NKRHEYNRQKELSKSTKVSIDELGAKIKEGNLKALPVILKADVQGSLEALKASLEKLRN FT DEIKVNIIHSGVGGITQSDIELASASENSIVLGFNIRPTGEVKERAKDKGVEIKTYNVI FT YNLLDDVKALLGGMMSPIISEEQLGQAEIRQVINVPKIGQIAGCMVTEGVINRGAKIRL FT IRDGVVVYEGNVSSLKRFKDDAKEVAKGYECGVGIEGCDDMRVGDYIESYKEVEEQASL FT " FT misc_feature 136856..137014 FT /note="HMMPfam hit to PF04760, Translation initiation FT factor IF-2, N-ter, score 8.4e-15" FT /inference="protein motif:Pfam:PF04760" FT misc_feature 137729..137884 FT /note="HMMPfam hit to PF04760, Translation initiation FT factor IF-2, N-ter, score 1.2e-20" FT /inference="protein motif:Pfam:PF04760" FT misc_feature 137963..138466 FT /note="HMMPfam hit to PF00009, Elongation factor Tu GTP FT binding domain, score 2.5e-54" FT /inference="protein motif:Pfam:PF00009" FT misc_feature 137972..138301 FT /note="HMMPfam hit to PF01926, GTPase of unknown FT function,score 8.6e-10" FT /inference="protein motif:Pfam:PF01926" FT misc_feature 137990..138013 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 138533..138724 FT /note="HMMPfam hit to PF03144, Elongation factor Tu domain, FT score 1.3e-08" FT /inference="protein motif:Pfam:PF03144" FT misc_feature 139229..139435 FT /note="HMMPfam hit to PF03144, Elongation factor Tu domain, FT score 1.4e-08" FT /inference="protein motif:Pfam:PF03144" FT misc_feature 139319..139387 FT /note="PS01176 Initiation factor 2 signature" FT /inference="protein motif:Prosite:PS01176" FT CDS 139468..139830 FT /transl_table=11 FT /gene="rbfA" FT /locus_tag="Cj0137" FT /product="putative ribosome-binding factor A" FT /note="Original (2000) note: Cj0137, unknown, len: 120 aa; FT weak similarity to RBFA_BACSU P32731 ribosome-binding FT factor A (P15B PROTEIN) (117 aa), blastp scores; E= FT 0.00012, 25% identity in 106 aa overlap. 41.4% identity to FT HP1047" FT /note="Updated (2006) note: Prosite PS01319 FT RBFA,Ribosome-binding factor A identified within CDS. FT Product modified to more specific family member based on FT motif match. Characterised within Bacillus subtilis and FT Escherichia coli, however, identity scores not acceptable. FT Putative kept within product function. Functional FT classification - Misc" FT /note="PMID:12628255" FT /db_xref="GOA:Q9PIZ0" FT /db_xref="InterPro:IPR020053" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIZ0" FT /inference="protein motif:Prosite:PS01319" FT /protein_id="CAL34308.1" FT /translation="MNPSEIKKLRTESILKELIPEALANLDDENLKNLCVVDVECKKGR FT YDAFVYLDKMFFNVHEQEKILSSLKKASRALQNYCMSEQGWYRCPNFHFKFDDRLEYQN FT HMDALFEKIKKDKNES" FT CDS 139820..140242 FT /transl_table=11 FT /locus_tag="Cj0138" FT /product="conserved hypothetical protein Cj0138" FT /note="Original (2000) note: Cj0138, unknown, len: 140 aa; FT similar to hypothetical proteins e.g. YHBC_ECOLI (152 FT aa),fasta scores; opt: 272 z-score: 436.7 E(): 4.5e-17, FT 41.4% identity in 116 aa overlap. 38.9% identity to HP1046" FT /note="Updated (2006) note: Pfam PF02576 Uncharacterised FT BCR, YhbC family was present within CDS. Conserved added to FT product function. Functional classification - Conserved FT hypothetical proteins" FT /db_xref="HSSP:1IB8" FT /db_xref="InterPro:IPR003728" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIY9" FT /inference="protein motif:Pfam:PF02576" FT /protein_id="CAL34309.1" FT /translation="MNLEALCKEAGLSFYDDELVSENGRKIYRIYVQKEGGVNLDDCAR FT LSEILSPIFDVESPVNGEYFLEVSSPGLERKLSKIEHFAKSIGELVKITTNEKEKFEAK FT IIAVDDENITLENLENKEKTTINFNDIKKARTFVEW" FT misc_feature 139823..140227 FT /note="HMMPfam hit to PF02576, Uncharacterised BCR, YhbC FT family COG0779, score 1e-62" FT /inference="protein motif:Pfam:PF02576" FT CDS 140289..142640 FT /transl_table=11 FT /locus_tag="Cj0139" FT /product="putative endonuclease" FT /note="Original (2000) note: Cj0139, possible endonuclease, FT len: 783 aa; similar in part to MCRB_ECOLI FT 5-methylcytosine-specific restriction enzyme B (465 FT aa),fasta scores; opt: 305 z-score: 505.4 E(): 6.7e-21, FT 40.9% identity in 186 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF07728 ATPase FT family associated with various cellular activities was FT identified within CDS. Characterised within Eschereichia FT coli with acceptable identity scores. Sequence alignment FT was only partial. Thus, putative kept within product FT function. Functional classification - DNA FT replication,restriction/modification, recombination and FT repair" FT /note="PMID:7781618" FT /db_xref="GOA:Q0PBZ8" FT /db_xref="InterPro:IPR011704" FT /db_xref="UniProtKB/TrEMBL:Q0PBZ8" FT /inference="protein motif:Pfam:PF07728" FT /protein_id="CAL34310.1" FT /translation="MWNLDEKKLQEMLDGFLNFQEVWTLEKVKNMTLEEYTNIKKDNPN FT RDDFTFWIESKLDNLGSIWGGSAFKFGIYRRNDESQKESSSGRLYSQNYAWIAKYGNNE FT NEAFNNIKEKIIQIIQASQDNNLKTIEKIDFGDAIKWKIAFHYQDVKNIKIVNIFSKNV FT LDLISLNEFKEKLKIYQIHKKLLENKNLSLVKMIENIAIPLWNKYGMDSQNYIDKMKNL FT FSEYLNKKKLDKNTINKYIQVIENISKEFLKENLYSCDLFSFDQNINKLNKNEEFKLKN FT SNGHNMYSSALNYYRAFLIDYYEQDIFITERVQSEESNMKIIPLNQILYGPPGTGKTYH FT TIDKALEILGENLESRDEKKAKFDEYVRKGQIVFTTFHQSYGYEEFVEGIKPIIDNDEN FT SQEVKYDVKDGIFKELCDKSLKNYILSMQNENEIDLDKLIFEFANYINQDFLNKGNEFP FT LENKVSIKKILLNFKDEYRSFSLGGSIKSPQSLTIDIIKRDYLNFKNKKILSFKDIKPK FT YDSQSDYHGNAIYYFMFYNKLKEFENIQNEKFKIKKEILKSYIIIIDEINRGNVSKIFG FT ELITLIEPSKRIGEKEELKVTLPYSGEKFGVPKNVYIIGTMNTADRSITSLDTALRRRF FT EFVEMMPDVSKLSMDCEGINLQELLKAINTRIEYLLDREKTIGHAFFVSVENLEDLKKV FT FQNKIIPLLQEYFYNDYALINAVLNDNDMIFEDKKDDKYLQKIKNLDSVNSERSIYNIA FT SFDDKIWDKIEIYQAIYNDEIANKLKNENE" FT misc_feature 141279..141302 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 142633..143964 FT /transl_table=11 FT /locus_tag="Cj0140" FT /product="hypothetical protein Cj0140" FT /note="Original (2000) note: Cj0140, unknown, len: 443 aa; FT no Hp match" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Functional classification FT -Unknown" FT /db_xref="InterPro:IPR019292" FT /db_xref="UniProtKB/TrEMBL:Q0PBZ7" FT /protein_id="CAL34311.1" FT /translation="MNSIFSIIEHQAFSKEDLKEIFKEKAEGFYKELEDFAKNNENLLG FT FKNKNSLKAKNYVGIIQTKSGVLEILPKCTNLDSYKKEDSSSNHDKEKLRRCYELDNIS FT KNNDFYEKDFKFNPKNLLINMLKTLKNSPFKKSQISSLQSSKIPLFEVFITMFLDEFDS FT VYKKGLMRSYLSCEENRAFLKGKLLFNEHIKQNLIHKERFFTSNDEFVLDIAPNRLIKS FT TLNFLKSKTSLNKFRLIKAMQMLDEVEFSKNYEKDFSYKISRHFDYYENLLLWCKIFLK FT NESFMPYHGKNEAFALLFPMEKIFEDYVAYMLKKVNSTQDIKVQNNGKYLISKNDENCF FT MLKPDLYIKNKMILDTKWKIPNDSEDEKKQGIAQSDLYQMFAYACKFKIYDIKLVYPLC FT EKTQDLQRKIAEKFFVFKASEHLYFKEQGQKDIKVQVFFAPLPF" FT CDS complement(143953..144756) FT /transl_table=11 FT /locus_tag="Cj0141c" FT /product="putative ABC transporter integral membrane FT protein" FT /note="Original (2000) note: Cj0141c, ABC transporter FT integral membrane protein, len: 267 aa; similar to many FT e.g. MNTB_SYNY3 manganese transport system membrane protein FT (306 aa), fasta scores; opt: 425 z-score: 449.6 E(): FT 8.7e-18, 25.8% identity in 264 aa overlap. No Hp match. FT Contains Pfam match to entry PF00950 ABC-3, ABC 3 transport FT family, score 276.20, E-value 4.3e-79" FT /note="Updated (2006) note: Seven probable transmembrane FT helices predicted by TMHMM2.0. Further support given to FT product function. No specific characterisation with FT acceptable identity score identified. Thus, putative added FT to product function. Functional classification FT -Transport/binding proteins - Other" FT /db_xref="GOA:Q0PBZ6" FT /db_xref="InterPro:IPR001626" FT /db_xref="UniProtKB/TrEMBL:Q0PBZ6" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00950" FT /protein_id="CAL34312.1" FT /translation="MLEILNFTFFQNALLGAILVSIACGIIGTLVMINRLFSMAGGITH FT GAFGGIGIAFYFSLPILLSTGIFTLFLAFLVAFLAKRYEHRSDSIIAVIWAFGMAVGII FT LIDLSPSYNTDLMAYLFGSILAVGTQDLWLMALVDSVMVLLIFLFYRQFEALSFDVEFT FT KVRGINTSFFHYLLIALMAFCIVISIRLVGLILVMALLSIPSFIAENFTKRLGFIMILA FT SFLSMIFCILGLILSYYLNLSSGACIIAIACFGFLVHLIGKFLKR" FT misc_feature complement(143968..144741) FT /note="HMMPfam hit to PF00950, ABC 3 transport family,score FT 7.6e-82" FT /inference="protein motif:Pfam:PF00950" FT misc_feature complement(order(144652..144720,144526..144594, FT 144421..144489,144307..144363,144157..144246, FT 144046..144114,143974..144042)) FT /note="7 probable transmembrane helices predicted for FT Cj0141c by TMHMM2.0 at aa 13-35, 55-77, 90-112, FT 132-150,171-200, 215-237 and 239-261" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(144016..144048) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT sig_peptide complement(144643..144756) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000065_143953_144756 by SignalP 2.0 FT HMM (Signal peptide probability 0.645) with cleavage site FT probability 0.464 between residues 38 and 39" FT misc_feature complement(144685..144717) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(144749..145603) FT /transl_table=11 FT /locus_tag="Cj0142c" FT /product="putative ABC transporter ATP-binding protein" FT /note="Original (2000) note: Cj0142c, ABC transporter FT ATP-binding protein, len: 284 aa; simlar to many e.g. FT MNTA_SYNY3 manganese transport system ATP-binding protein FT (260 aa), fasta scores; opt: 417 z-score: 613.7 E(): FT 6.2e-27, 32.9% identity in 252 aa overlap. No Hp ortholog FT but 30.4% identity to HP0250 oligopeptide ABC transporter. FT Contains PS00017 ATP/GTP-binding site motif A FT (P-loop),PS00211 ABC transporters family signature and Pfam FT match to entry PF00005 ABC_tran, ABC transporters, score FT 165.90,E-value 6.9e-46" FT /note="Updated (2006) note: Some characterisation within FT Bacillus subtilis with acceptable identity score. Sequence FT alignment was only partial. Thus, putative added to product FT function. Functional classification -Transport/binding FT proteins - Other" FT /note="PMID:10760146" FT /db_xref="GOA:Q0PBZ5" FT /db_xref="InterPro:IPR017871" FT /db_xref="UniProtKB/TrEMBL:Q0PBZ5" FT /inference="protein motif:Pfam:PF00005" FT /inference="protein motif:Prosite:PS00211" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34313.1" FT /translation="MLFFEISNLNYAYDNEIILKNINLSYDNKDFLSIIGPNGAGKSTL FT VKLILGLLKSKNEIHFKALQRKEIGYVPQHTLANPNFCPRVLEIVLMGLVSKKIFGFYG FT KKDKEKAMQALKSVGMEKFWNKTIDSLSGGQRQRVFIARALASECKMLILDEPTASVDN FT KSAIQIFELLISLHQKGMGILLICHDINLVLAYSDKIAHLNKELFLHTNTKEKEKSSFL FT KHLYENHSHFCDVEMSLNTCFCNEENCDSKKLCEQEFTRRNLKKTEFKKENFCLKFSKE FT NNA" FT misc_feature complement(144986..145519) FT /note="HMMPfam hit to PF00005, ABC transporter, score FT 7.4e-49" FT /inference="protein motif:Pfam:PF00005" FT misc_feature complement(145169..145213) FT /note="PS00211 ABC transporters family signature" FT /inference="protein motif:Prosite:PS00211" FT misc_feature complement(145475..145498) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(145616..146506) FT /transl_table=11 FT /locus_tag="Cj0143c" FT /product="putative periplasmic solute binding protein for FT ABC transport system" FT /note="Original (2000) note: Cj0143c, probable periplasmic FT solute binding protein for ABC transport system, len: 296 FT aa; similar to e.g. ZNUA_ECOLI high-affinity zinc uptake FT system protein znuA (328 aa), fasta scores; opt: 386 FT z-score: 471.6 E(): 5.2e-19, 26.4% identity in 288 aa FT overlap. No Hp match. Contains probable N-terminal signal FT sequence and Pfam match to entry PF01297 FT Lipoprotein_4,score 133.20, E-value 4.6e-36" FT /note="Updated (2006) note: Pfam domain PPF01297 FT Periplasmic solute binding protein identified within CDS. FT Further support given to product function. Some FT characterisation within Eschericia coli, however, identity FT score was marginal. Thus, putative kept within product FT function. Paper identified linking protein to glycoprotein FT (PMID:12186869). Also, found to have adhesin family FT signature. Functional classification - Transport/binding FT proteins - Other" FT /note="PMID:9680209, PMID:12186869" FT /db_xref="GOA:Q0PBZ4" FT /db_xref="InterPro:IPR006127" FT /db_xref="UniProtKB/TrEMBL:Q0PBZ4" FT /inference="protein motif:Pfam:PF01297" FT /protein_id="CAL34314.1" FT /translation="MKKIILFILSLGIFYTFTQAKNLEQEQNTSSNLVSVSIAPQAFFV FT KKIAANTLDVNVILPPNSNEHNFEFKPSTMKKLEKSDIYFTIGLEFEKVFTDKFKQNFP FT KLQVINMQKNIALIQTHDTHEHSHEHEHHEHGHFDPHTWLDPILVQTMALNIYDTLIQK FT YPQNENLYKENLDKFLAELDSLNLQIASKLEKLKNREFVVYHPSWTYFAKRYNLTQIPV FT EILGKEPKSKDLQKLITLMKDKNLKVIFVQNGFPENAAKTLAKECDAKIYKIDHLSYDW FT ENELLKTADAFSHNL" FT misc_feature complement(145628..146494) FT /note="HMMPfam hit to PF01297, Periplasmic solute binding FT protein family, score 6.1e-62" FT /inference="protein motif:Pfam:PF01297" FT sig_peptide complement(146432..146506) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000067_145616_146506 by SignalP 2.0 FT HMM (Signal peptide probability 0.895) with cleavage site FT probability 0.415 between residues 25 and 26" FT CDS 146705..148684 FT /transl_table=11 FT /locus_tag="Cj0144" FT /product="putative methyl-accepting chemotaxis signal FT transduction protein" FT /note="Original (2000) note: Cj0144, probable FT methyl-accepting chemotaxis signal transduction FT protein,len: 659 aa; similar to mnay e.g. MCPS_ENTAE FT methyl-accepting chemotaxis serine transducer (557 FT aa),fasta scores; opt: 297 z-score: 493.4 E(): 3.2e-20, FT 28.6% identity in 377 aa overlap. No Hp ortholog. FT C-terminus contains repeat1, and is identical to the other FT repeat 1-containing genes Cj0262c and Cj1564. Contains FT N-terminal signal sequence and transmembrane anchor around FT aa 300. Also contains Pfam match to entry PF00015 FT MCPsignal,Methyl-accepting chemotaxis protein (MCP) FT signaling domain, score 110.60, E-value 4.1e-30" FT /note="Updated (2006) note: Some characterisation work FT within Bacillus subtilis and Escherichia coli, FT however,identity scores were unnacceptable. Thus, putative FT kept within product function. Functional classification FT -Chemotaxis and mobility" FT /note="PMID:6213619, PMID:7921238" FT /db_xref="GOA:Q0PBZ3" FT /db_xref="InterPro:IPR004010" FT /db_xref="UniProtKB/TrEMBL:Q0PBZ3" FT /inference="protein motif:Pfam:PF00015" FT /protein_id="CAL34315.1" FT /translation="MKSVKLKVSLIANLIAVVCLIILGVVTFIFVKQAIFHEVVNAEIN FT YVKTAKNSIESFKARNSLALESLAKSILKHPIEQLDSQDALMHYVGKDLKNFRDAGRFL FT AVYIAQPNGELVVSDPDSDAKNLDFGTYGKADNYDARTREYYIEAVKTNKLYITPSYID FT VTTNLPCFTYSIPLYKDGKFIGVLAVDILAADLQAEFENLPGRTFVFDEENKVFVSTDK FT ALLQKGYDISAIANLAKTKEDLEPFEYTRPKDGNERFAVCTKVSGIYTACVGEPIEQIE FT APVYKIAFIQTAIVIFTSIISVILLYFIVSKYLSPLAAIQTGLTSFFDFINYKTKNVST FT IEVKSNDEFGQISNAINENILATKRGLEQDNQAVKESVQTVSVVEGGNLTARITANPRN FT PQLIELKNVLNKLLDVLQARVGSDMNAIHKIFEEYKSLDFRNKLENASGSVELTTNALG FT DEIVKMLKQSSDFANALANESGKLQTAVQSLTTSSNSQAQSLEETAAALEEITSSMQNV FT SVKTSDVITQSEEIKNVTGIIGDIADQINLLALNAAIEAARAGEHGRGFAVVADEVRKL FT AERTQKSLSEIEANTNLLVQSINDMAESIKEQTAGITQINDSVAQIDQTTKDNVEIANE FT SAIISSTVSDIANNILEDVKKKRF" FT sig_peptide 146705..146830 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000068_146705_148684 by SignalP 2.0 FT HMM (Signal peptide probability 0.999) with cleavage site FT probability 0.672 between residues 42 and 43" FT misc_feature order(146732..146800,147563..147631) FT /note="2 probable transmembrane helices predicted for FT Cj0144 by TMHMM2.0 at aa 10-32 and 287-309" FT /inference="protein motif:TMHMM:2.0" FT repeat_region 147606..148684 FT /note="repeat 1: identical to complement(238817..239964) FT and 1492913..1493990 (approximate numbers)" FT misc_feature 148184..148678 FT /note="HMMPfam hit to PF00015, Methyl-accepting chemotaxis FT protein (MCP) s, score 6.4e-21" FT /inference="protein motif:Pfam:PF00015" FT CDS 148819..150600 FT /transl_table=11 FT /locus_tag="Cj0145" FT /product="putative TAT (Twin-Arginine Translocation) FT pathway signal sequence domain protein" FT /note="Original (2000) note: Cj0145, unknown, len: 593 aa; FT some similarity to a hypothetical protein from Streptomyces FT coelicolor TR:O69840 (EMBL:AL023517) SC1B5.12C (465 aa), FT fasta scores; opt: 124 z-score: 327.1 E(): 5.8e-11, 23.0% FT identity in 574 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF05787 Bacterial FT protein of unknown function (DUF83), identified within CDS. FT TIGRFAM TIGR01409 TAT_signal_seq, Tat (twin-arginine FT translocation) pathway signal sequence identified within FT CDS. Product modified to more specific family member based FT on motif search results. No specific characterisation with FT acceptable identity scores carried out yet. Thus, putative FT kept within product function. Functional classification FT -Misc" FT /note="PMID:10766774" FT /db_xref="InterPro:IPR006311" FT /db_xref="UniProtKB/TrEMBL:Q0PBZ2" FT /inference="protein motif:Pfam:PF05787" FT /protein_id="CAL34316.1" FT /translation="MERRLFLKGSALGSMVAFFASSNLSAAMLKDKDLLGFKAVSASTQ FT DKVIVPQGYEAKVLISWGDPLFSKAKPYDENKIIDMNAVKNAHLVFGDDNDGMSFFPLS FT KNRGILAVNNEYINPEIMFNHHGKNLSKEDILYEQASVGVSILEIEKKGDDWTVVLDSK FT YNRRIDANTKMQVSGAAKKEVLKNEKFVHGTFANCANGQTPWGTYITCEENFDDFFGSL FT DENLEFNDSLKRYGFNKTSLYGWEKFDERFDLAKNMDEANRFGWIVEINPFDAQSTPVK FT RTSLGRFKHENAEIIVEKDGSVIVYMGDDEMNEFIYKFVSKHKYKKGADTSKILDEGIL FT YVGQFNGNVGDFKGQGKWIALEYGKNSLNEKNGFKSQAQVLINTRLAASIVGATPMDRC FT EWIASHKQSGSKEVFATLTNNKNRQEPNAANPRTKNVYGQILKWMPKNSHKDDDFTWEI FT FALAGNPDNQQGLYKGSNNITSENKFNSPDGLKFDRDGRLWIQTDGSYSNKDEYESMGN FT NCMLAANPKTGEIRRFLTGPIACELTGIAFSEDYTTMFVGIQHPGEGLKGSTFPYGKTP FT RSSVMMIRKLDGGVIGS" FT sig_peptide 148819..148905 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000069_148819_150600 by SignalP 2.0 FT HMM (Signal peptide probability 0.997) with cleavage site FT probability 0.477 between residues 29 and 30" FT misc_feature 148819..150504 FT /note="HMMPfam hit to PF05787, Bacterial protein of unknown FT function (DUF83, score 0" FT /inference="protein motif:Pfam:PF05787" FT CDS complement(150638..151576) FT /transl_table=11 FT /gene="trxB" FT /locus_tag="Cj0146c" FT /product="thioredoxin reductase" FT /EC_number="1.8.1.9" FT /note="Original (2000) note: Cj0146c, trxB, probable FT thioredoxin reductase, len: 312 aa; similar to many e.g. FT TRXB_LISMO thioredoxin reductase (EC 1.6.4.5) (319 FT aa),fasta scores; opt: 749 z-score: 926.7 E(): 0, 38.0% FT identity in 313 aa overlap. 64.2% identity to HP0825. FT Contains PS00573 Pyridine nucleotide-disulphide FT oxidoreductases class-II active site" FT /note="Updated (2006) note: Pfam domain PF00070 Pyridine FT nucleotide-disulphide oxidoreductase identified within CDS. FT Further support given to product function. Characterised FT within Listeria monocytogenes with acceptable identity FT scores. Appropriate motifs identified. Thus, putative not FT added to product function. Functional classification - FT Biosynthesis of cofactors, prosthetic groups and carriers - FT Thioredoxin" FT /note="PMID:2644268, PMID:15358361" FT /db_xref="GOA:Q0PBZ1" FT /db_xref="InterPro:IPR013027" FT /db_xref="UniProtKB/TrEMBL:Q0PBZ1" FT /inference="protein motif:Pfam:PF00070" FT /inference="protein motif:Prosite:PS00573" FT /protein_id="CAL34317.1" FT /translation="MLDVAIIGGGPAGLSAGLYATRGGLKNVVMFEKGMPGGQITSSSE FT IENYPGVAQVMDGISFMAPWSEQCMRFGLKHEMVGVEQILKNSDGSFTIKLEGGKTELA FT KAVIVCTGSAPKKAGFKGEDEFFGKGVSTCATCDGFFYKNKEVAVLGGGDTALEEALYL FT ANICSKIYLIHRRDEFRAAPSTVEKVKKNEKIELITSASVDEVYGDKMGVAGVKVKLKD FT GSIRDLNVPGIFTFVGLNVRNEILKQDDSKFLCNMEEGGQVSVDLKMQTSVAGLFAAGD FT LRKDAPKQVICAAGDGAVAALSAMAYIESLH" FT misc_feature complement(150716..151570) FT /note="HMMPfam hit to PF00070, Pyridine FT nucleotide-disulphide oxidoreducta, score 6e-58" FT /inference="protein motif:Pfam:PF00070" FT misc_feature complement(151115..151177) FT /note="PS00573 Pyridine nucleotide-disulphide FT oxidoreductases class-II active site" FT /inference="protein motif:Prosite:PS00573" FT CDS complement(151710..152024) FT /transl_table=11 FT /gene="trxA" FT /locus_tag="Cj0147c" FT /product="thioredoxin" FT /note="Original (2000) note: Cj0147c, trxA, FT thioredoxin,len: 104 aa; highly similar to many e.g. FT THIO_ECOLI thioredoxin 1 (108 aa), fasta scores; opt: 344 FT z-score: 590.5 E(): 1.2e-25, 45.7% identity in 105 aa FT overlap. 68.6% identity to HP0824. Contains PS00194 FT Thioredoxin family active site and Pfam match to entry FT PF00085 thiored, Thioredoxins, score 144.20, E-value FT 3.6e-42" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Thus,putative not added to product function. Appropiate FT motifs present. Paper identified linking protein to FT glycoprotein. Functional classification - Biosynthesis of FT cofactors,prosthetic groups and carriers - Thioredoxin" FT /note="PMID:12186869, PMID:15358361" FT /db_xref="GOA:Q0PBZ0" FT /db_xref="InterPro:IPR012335" FT /db_xref="UniProtKB/TrEMBL:Q0PBZ0" FT /inference="protein motif:Pfam:PF00085" FT /inference="protein motif:Prosite:PS00194" FT /protein_id="CAL34318.1" FT /translation="MGKYIELTSDNFAQAKEGVALVDFWAPWCGPCRMLAPVIDELSND FT FDGKAKICKVNTDEQGDLAAEFGVRSIPTLIFFKNGEVVDQLVGAQSKQAISDKLNSLL FT " FT misc_feature complement(151713..152018) FT /note="HMMPfam hit to PF00085, Thioredoxin, score 6.9e-39" FT /inference="protein motif:Pfam:PF00085" FT misc_feature complement(151908..151964) FT /note="PS00194 Thioredoxin family active site" FT /inference="protein motif:Prosite:PS00194" FT CDS complement(152081..152419) FT /transl_table=11 FT /locus_tag="Cj0148c" FT /product="conserved hypothetical protein Cj0148c" FT /note="Original (2000) note: Cj0148c, unknown, len: 112 aa; FT similar to hypothetical proteins e.g. TR:G3323225 FT (EMBL:AE001259) Treponema pallidum TP0913 (126 aa), fasta FT scores; opt: 156 z-score: 253.1 E(): 7.6e-07, 31.0% FT identity in 100 aa overlap. 47.1% identity to HP0823" FT /note="Updated (2006) note: Pfam PF02021 Uncharacterised FT protein family was present within CDS. Conserved added to FT product function. Functional classification - Conserved FT hypothetical proteins" FT /db_xref="GOA:Q9PIX9" FT /db_xref="InterPro:IPR003509" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIX9" FT /inference="protein motif:Pfam:PF02021" FT /protein_id="CAL34319.1" FT /translation="MGVKAYLDGILGEDKACKFLKKQGFEILKRNFHSKFGEIDIIAKK FT DEILHFIEVKFTQNDYEVSERLDRKKLEKILKTIEFYHLKNGISSDFQIDLICIKNDVI FT QFCENISF" FT misc_feature complement(152120..152389) FT /note="HMMPfam hit to PF02021, Uncharacterised protein FT family UPF0102, score 6e-16" FT /inference="protein motif:Pfam:PF02021" FT CDS complement(152419..153666) FT /transl_table=11 FT /gene="hom" FT /locus_tag="Cj0149c" FT /product="homoserine dehydrogenase" FT /EC_number="1.1.1.3" FT /note="Original (2000) note: Cj0149c, hom, probable FT homoserine dehydrogenase, len: 415 aa; similar to many e.g. FT DHOM_BACSU homoserine dehydrogenase (EC 1.1.1.3) (433 aa), FT fasta scores; opt: 932 z-score: 1191.7 E(): 0, 36.4% FT identity in 426 aa overlap. 53.3% identity to HP0822. FT Contains PS01042 Homoserine dehydrogenase signature and FT Pfam match to entry PF00742 Homoserine_dh, Homoserine FT dehydrogenase, score 329.20, E-value 4.7e-95" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis with acceptable identity score. Putative not added FT to product function. Functional classification -Amino acid FT biosynthesis - Aspartate family" FT /note="PMID:3139660" FT /db_xref="GOA:Q0PBY8" FT /db_xref="InterPro:IPR002912" FT /db_xref="UniProtKB/TrEMBL:Q0PBY8" FT /inference="protein motif:Pfam:PF00742" FT /inference="protein motif:Prosite:PS01042" FT /protein_id="CAL34320.1" FT /translation="MKVAILGYGTVGSAVVKFLLENDKLIRARCGQSITPVIALARSPK FT KNALIPITHSVAEILNADVDVFVELMGGVDEAFKIVSEILKKKKAVVTANKAMLAYHRY FT ELENLAKNLAFGYEASVAGGIPIIKVLKEGLSANNILAIKGILNGTSNYILSSMSQKNM FT SFKQALQIAQNLGYAEADPTFDIEGQDAAHKLLVLSSIAYNLKAKPEDILIEGISEIAP FT EDMYFANEFEFTIKLLGIAKVRENKVELRVHPTMIDKEKMLAKVDGVMNAISINGDLLG FT ESLYYGAGAGGEATASAVISDLMDIARDQVKAPMLGFVNTLEYKLLSKDEIYTKYYLRV FT KVEDKIGILSKITQLMSENNISIDSFLQKPKKNDENYSTLFFTTHLTYEKSIQNLLEIL FT RKQDFIKTKPFMMRIE" FT misc_feature complement(152437..152661) FT /note="HMMPfam hit to PF01842, ACT domain, score 2e-10" FT /inference="protein motif:Pfam:PF01842" FT misc_feature complement(152755..153291) FT /note="HMMPfam hit to PF00742, Homoserine FT dehydrogenase,score 2.7e-73" FT /inference="protein motif:Pfam:PF00742" FT misc_feature complement(153085..153153) FT /note="PS01042 Homoserine dehydrogenase signature" FT /inference="protein motif:Prosite:PS01042" FT misc_feature complement(153295..153666) FT /note="HMMPfam hit to PF03447, Homoserine dehydrogenase,NAD FT binding d, score 3.1e-13" FT /inference="protein motif:Pfam:PF03447" FT CDS complement(153670..154872) FT /transl_table=11 FT /locus_tag="Cj0150c" FT /product="aminotransferase" FT /EC_number="2.6.1.1" FT /note="Original (2000) note: Cj0150c, probable FT aminotransferase, len: 400 aa; similar to many hypothetical FT aminotransferases and to e.g. AAT2_BACSU probable aspartate FT aminotransferase (EC 2.6.1.1) (399 aa),fasta scores; opt: FT 722 z-score: 1151.8 E(): 0, 33.8% identity in 390 aa FT overlap, and AAT_BACST aspartate aminotransferase (393 aa), FT fasta scores; opt: 513 z-score: 536.0 E(): 1.3e-22, 28.9% FT identity in 377 aa overlap. No Hp ortholog. Contains Pfam FT match to entry PF00155 aminotran_1, Aminotransferases FT class-I, score 129.10,E-value 8.1e-35" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis with acceptable identity score. Putative not added FT to product function. Functional classification -Misc" FT /note="PMID:12022921" FT /db_xref="GOA:Q0PBY7" FT /db_xref="InterPro:IPR015421" FT /db_xref="UniProtKB/TrEMBL:Q0PBY7" FT /inference="protein motif:Pfam:PF00155" FT /protein_id="CAL34321.1" FT /translation="MFDEIRFNTIERLPNYVFAEVNAIKMAARRAGEDIIDFSMGNPNG FT KTPQHIIDKLCESANKDKTSGYSTSMGIYKLRLAICNWYKRKYNVNLDPENEVVATMGS FT KEGFVNLARAIINPGDVAIVPTPAYPIHTQAFIIAGGNVAKMPLAYNEKFELDENQFFE FT NLHKTLNESIPCPKYVVVNFPHNPTTVTCEKSFYERLIATAKKERFYIISDIAYADLTY FT DDYKTPSILEIEGAKDVAVETYTLSKSYNMAGWRVGFVVGNKRLVSALKKIKSWFDYGM FT YTPIQVAATIALDGDQTCVDEIRATYDKRMHILLEAFENAGWKLQKPRASMFVWAKLPE FT SKRHLKSLEFSKQLLQRASVAVSPGVGFGEAGDEYVRIALIENENRIRQAARNIKKYLK FT E" FT misc_feature complement(153679..154629) FT /note="HMMPfam hit to PF00155, Aminotransferase class I and FT II, score 1.3e-29" FT /inference="protein motif:Pfam:PF00155" FT CDS complement(154884..155690) FT /transl_table=11 FT /locus_tag="Cj0151c" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0151c, possible periplasmic FT protein, len: 268 aa; 26.0% identity to HP0555. Contains FT possible N-terminal signal sequence. Functional FT classification - Miscellaneous periplasmic proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PBY6" FT /protein_id="CAL34322.1" FT /translation="MVKKIIILTFWVNISFAISSLELAKNLVNNPSKNSQLELLFSNNS FT YIDNNGNCDIAKISQILKTNSLIALTLSNPQSLRLNFKAKADEVMFFKILSDVLTDAGY FT IYFIPTDLILREGNIDYTIQVESQYVLDPGTLYNLLKENSVYINNIKRIGVYDYEYDLN FT FSNAVLKTNTNVNLNTPKSLEKPLKDYVLDLKNATNLIIDANDLDNWFPKIFFLDKNLN FT LIKAVKSENKNNHFSELIPNGAIYAIVSDMYSLDNIRRGLKITLKK" FT sig_peptide complement(155640..155690) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000072_154884_155690 by SignalP 2.0 FT HMM (Signal peptide probability 0.634) with cleavage site FT probability 0.438 between residues 17 and 18" FT CDS complement(155684..156622) FT /transl_table=11 FT /locus_tag="Cj0152c" FT /product="putative membrane protein" FT /note="Original (2000) note: Cj0152c, possible membrane FT protein, len: 312 aa; 25.0% identity to HP0554. Contains FT one probable transmembrane domain around aa 110. Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PBY5" FT /protein_id="CAL34323.1" FT /translation="MLNWKKIQELNLKEVAAKTQIELDFLEALVEKNFAVLSRFNVKGF FT VKILSREYELDFSDFNEEYEAYLNENNPTPQTKSKMITPKLDAYSQKSFNTWPFLIVLI FT VLVIIGSGIYYFDTLKTFFKDEQNNTSATVIDIIGQAQENLKSLGGNNVVVIDNNKAQE FT TNRTESVLPSQNISLQENDKNISIENNISENNTTLLDEEKNTQIQEDTNTPKTDSLKEA FT HFKTSTKIWIGLIDLKSLKKTSFVKEKDFNISLDKDQLILTGAAALTMFDQENKEQKFP FT AGISKRFLIKDGKITSISAAEFVKLNKGKEW" FT misc_feature complement(156275..156343) FT /note="1 probable transmembrane helix predicted for Cj0152c FT by TMHMM2.0 at aa 94-116" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(156615..157298) FT /transl_table=11 FT /locus_tag="Cj0153c" FT /product="putative rRNA methylase" FT /note="Original (2000) note: Cj0153c, probable rRNA FT methylase, len: 227 aa; similar to members of the spoU FT family e.g. NHS_STRAS 23S rRNA methyltransferase (274 aa), FT fasta scores; opt: 197 z-score: 247.9 E(): 1.5e-06,29.9% FT identity in 157 aa overlap. 42.7% identity to HP0553. FT Contains Pfam match to entry PF00588 SpoU_methylase, SpoU FT rRNA Methylase family, score 106.90,E-value 3.8e-28" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with marginal identity score. Putative FT kept within product function. Functional classification FT -RNA synthesis, RNA modification and DNA transcription" FT /note="PMID:11698387" FT /db_xref="GOA:Q0PBY4" FT /db_xref="InterPro:IPR013123" FT /db_xref="UniProtKB/TrEMBL:Q0PBY4" FT /inference="protein motif:Pfam:PF00588" FT /protein_id="CAL34324.1" FT /translation="MIVYGKQIFFYILEYHKDCINELYLAKECDKITFSKIAKSGFKIK FT KLDFKTAQAYAKGGNHQGFLLDIKESSFANLNEIKKNDFIVMLYGISDVGNIGAITRTA FT YALGVGALIFIGEKLAMEGVIRTSSGAALDLPIVISNDALSVINELKQVGFYFYASDGS FT GKEIHSVKISNGKKVLVLGSEGFGLSSKIVKKCDECVGIAMKNNFDSLNVSAAFAILCD FT RMLNA" FT misc_feature complement(156633..157052) FT /note="HMMPfam hit to PF00588, SpoU rRNA Methylase FT family,score 7e-28" FT /inference="protein motif:Pfam:PF00588" FT CDS complement(157312..158136) FT /transl_table=11 FT /locus_tag="Cj0154c" FT /product="putative tetrapyrrole methylase family protein" FT /note="Original (2000) note: Cj0154c, possible FT methylase,len: 274 aa; similar to hypotehtical proteins FT e.g. YABC_BACSU (292 aa), fasta scores; opt: 453 z-score: FT 741.0 E(): 0, 32.9% identity in 289 aa overlap. 42.3% FT identity to HP0552. Contains PS01296 Uncharacterized FT protein family UPF0011 signature and Pfam match to entry FT PF00590 TP_methylase, Tetrapyrrole (Corrin/Porphyrin) FT Methylases.,score 81.20, E-value 2.2e-20" FT /note="Updated (2006) note: Pfam domain PF00590 FT Tetrapyrrole (Corrin/Porphyrin) Methylase was identified FT within CDS. Product modified to more specific family member FT due to motif match. No specific characterisation with FT acceptable identity score has yet been carried out. Thus, FT putative kept within product function. Functional FT classification - Misc" FT /db_xref="GOA:Q0PBY3" FT /db_xref="InterPro:IPR008189" FT /db_xref="UniProtKB/TrEMBL:Q0PBY3" FT /inference="protein motif:Pfam:PF00590" FT /inference="protein motif:Prosite:PS01296" FT /protein_id="CAL34325.1" FT /translation="MLYFIPTPIGNLSDISFRALELLKTCDLVFCEDTRVSKSLISLLN FT TKFHTDIHISKFIALHSHNEKEVLASIDLKIFEKNVAYLSDAGMPGISDPGKALVEFAQ FT ENNITYEILPGANAALVALVSSAFCQKEFIFIGFLANKGKERQKDIEKILNFPYPSIIY FT ESPKRILSLVEQIMILDNQREIFLIKEISKKFEKKFKGNAKELSEILKKSNLNGEWVVV FT LQSKEQNFLQNTLCEKDIMDLELSLKAKAKLLSKINGKNAKEIYQKLLLSQD" FT misc_feature complement(157516..158136) FT /note="HMMPfam hit to PF00590, Tetrapyrrole FT (Corrin/Porphyrin) Methylas, score 9.6e-20" FT /inference="protein motif:Pfam:PF00590" FT misc_feature complement(157849..157884) FT /note="PS01296 Uncharacterized protein family UPF0011 FT signature" FT /inference="protein motif:Prosite:PS01296" FT CDS complement(158139..158339) FT /transl_table=11 FT /gene="rpmE" FT /locus_tag="Cj0155c" FT /product="50S ribosomal protein L31" FT /note="Original (2000) note: Cj0155c, rpmE, probable 50S FT ribosomal protein L31, len: 66 aa; highly similar to many FT e.g. RL31_BACSU 50S ribosomal protein L31 (66 aa), fasta FT scores; opt: 271 z-score: 544.9 E(): 4.3e-23, 54.5% FT identity in 66 aa overlap. 58.2% identity to HP0551. FT Contains PS01143 Ribosomal protein L31 signature and Pfam FT match to entry PF01197 Ribosomal_L31, Ribosomal protein FT L31, score 142.80, E-value 6.1e-39" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis with acceptable identity scores. Thus, putative FT not added to product function. Functional classification FT -Ribosomal protein synthesis and modification" FT /note="PMID:7026537, PMID:15049826" FT /db_xref="GOA:Q9PIX2" FT /db_xref="InterPro:IPR002150" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIX2" FT /inference="protein motif:Pfam:PF01197" FT /inference="protein motif:Prosite:PS01143" FT /protein_id="CAL34326.1" FT /translation="MKKEIHPEYVECKVSCACGNTFTTKSNKAELRVDICSNCHPFFTG FT SEKIVDAAGRVEKFKKKYAMQ" FT misc_feature complement(158142..158339) FT /note="HMMPfam hit to PF01197, Ribosomal protein L31,score FT 4.2e-40" FT /inference="protein motif:Pfam:PF01197" FT misc_feature complement(158166..158222) FT /note="PS01143 Ribosomal protein L31 signature" FT /inference="protein motif:Prosite:PS01143" FT misc_feature complement(158217..158234) FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT CDS complement(158418..159074) FT /transl_table=11 FT /locus_tag="Cj0156c" FT /product="conserved hypothetical protein Cj0156c" FT /note="Original (2000) note: Cj0156c, unknown, len: 218 aa; FT similar to hypothetical proteins e.g. YGGJ_ECOLI (243 aa), FT fasta scores; opt: 166 z-score: 226.2 E(): 2.4e-05,25.7% FT identity in 222 aa overlap. 43.7% identity to HP0374" FT /note="Updated (2006) note: Pfam PF04452 Protein of unknown FT function (DUF558) was present within CDS. Conserved added FT to product function. Functional classification - Conserved FT hypothetical proteins" FT /db_xref="GOA:Q0PBY1" FT /db_xref="InterPro:IPR006700" FT /db_xref="UniProtKB/TrEMBL:Q0PBY1" FT /inference="protein motif:Pfam:PF04452" FT /protein_id="CAL34327.1" FT /translation="MQFLYNKQAGEEFIQLQGENFNHLKVRRVKENSELNLRNLQDNFL FT YNYTITNLTRNSCTLKFLNKKSQNIKQSELNLALAIIDIKILEKTLPFLNELGVKKLHL FT VFTNFSQRNFKIDLERFEKIIISSCEQCGRNTKMDLIIHQSTQEFVQKFPNAIMVDFQG FT EQQSHFDEKELYFIGPEGGFNNDERLLFNRKISLKSSNILKSQTAIIAIASKILL" FT misc_feature complement(158424..158711) FT /note="HMMPfam hit to PF04452, Protein of unknown function FT (DUF558), score 1.2e-28" FT /inference="protein motif:Pfam:PF04452" FT CDS complement(159076..159483) FT /transl_table=11 FT /locus_tag="Cj0157c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0157c, probable integral FT membrane protein, len: 135 aa; no Hp match. Contains four FT probable transmembrane domains. Functional classification - FT Membranes, lipoproteins and porins" FT /db_xref="GOA:Q0PBY0" FT /db_xref="UniProtKB/TrEMBL:Q0PBY0" FT /protein_id="CAL34328.1" FT /translation="MDQSYEFFLALHLYSLYASGFLMLFYLILTQGNFKTEFIFIRRIR FT LFLPIYYLFLALIIFTGCLLSAMKQFQMNVNIWVMIFSWILIFALAIFHFVCFKKARRF FT RKYATFRWISCLILPFEIFLLFLPFLIERYL" FT misc_feature complement(order(159397..159456,159280..159348, FT 159193..159252,159091..159159)) FT /note="4 probable transmembrane helices predicted for FT Cj0157c by TMHMM2.0 at aa 10-29, 46-68, 78-97 and 109-131" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(159295..159327) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(159483..159908) FT /transl_table=11 FT /locus_tag="Cj0158c" FT /product="putative haem-binding lipoprotein" FT /note="Original (2000) note: Cj0158c, possible haem-binding FT lipoprotein, len: 141 aa; no Hp match. Contains N-terminal FT signal sequence with appropriately positioned PS00013 FT Prokaryotic membrane lipoprotein lipid attachment site, FT PS00190 Cytochrome c family heme-binding site signature, FT and Pfam match to entry PF00034 cytochrome_c, Cytochrome c, FT score -3.00, E-value 0.87" FT /note="Updated (2006) note: No specific characterisation FT with acceptable identity scores identified yet. Putative FT kept within product function. Functional classification FT -Membranes, lipoproteins and porins" FT /db_xref="GOA:Q0PBX9" FT /db_xref="UniProtKB/TrEMBL:Q0PBX9" FT /inference="protein motif:Pfam:PF00034" FT /inference="protein motif:Prosite:PS00190" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34329.1" FT /translation="MQKAKILIALSFFLLVLSACSNDEKNISKTQNTDQEVVQIEQNDE FT KTELSDSNLPLPVDDEAQSSNDEHEVNPSIINSLYKQKCATCHGEKGELKPKNSTAIKT FT LSNKIFIQKIKTIKDKNHSFLSDEQIQNLADFINKGK" FT misc_feature complement(159486..159689) FT /note="HMMPfam hit to PF00034, Cytochrome c, score 0.041" FT /inference="protein motif:Pfam:PF00034" FT misc_feature complement(159642..159659) FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT sig_peptide complement(159831..159908) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000078_159483_159908 by SignalP 2.0 FT HMM (Signal peptide probability 0.997) with cleavage site FT probability 0.495 between residues 26 and 27" FT misc_feature complement(159849..159881) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(159908..160489) FT /transl_table=11 FT /locus_tag="Cj0159c" FT /product="putative 6-pyruvoyl tetrahydropterin synthase" FT /EC_number="4.2.3.12" FT /note="Original (2000) note: Cj0159c, unknown, len: 193 aa; FT similar in N-terminus to hypothetical proteins FT e.g.TR:O27296 (EMBL:AE000890) Methanobacterium FT thermoautotrophicum MTH1228 (161 aa), fasta scores; opt: FT 140 z-score: 234.0 E(): 8.9e-06, 37.9% identity in 66 aa FT overlap. 35.8% identity to HP0933" FT /note="Updated (2006) note: Pfam domain PF01242 6-pyruvoyl FT tetrahydropterin synthase was identified within CDS. FT Product modified to more specific family member due to FT motif match with own search. No specific characterisation FT with acceptable identity scores carried out yet. FT Thus,putative kept within product function. Functional FT classification - Misc" FT /db_xref="GOA:Q0PBX8" FT /db_xref="InterPro:IPR007115" FT /db_xref="UniProtKB/TrEMBL:Q0PBX8" FT /inference="protein motif:Pfam:PF01242" FT /protein_id="CAL34330.1" FT /translation="MIIRKLFEFENAHIVRFCSSKRCKSSIHGHSYKVEVLLESKYLDN FT AGMVYDFGLLKTYIRQIIDSFDHAITLFKYDDAKYLEEMKKYSSRWICLPVNVSAENFC FT RVFFILIDALLKQTKMVNGEQGVTLQSIIVHETRTGYAQGFREDAYSELMPKISLQDIE FT FSNGIKAEWNDIDFYNKLKNEEIFINPKEI" FT CDS complement(160486..161229) FT /transl_table=11 FT /locus_tag="Cj0160c" FT /product="putative radical SAM domain protein" FT /note="Original (2000) note: Cj0160c, unknown, len: 247 aa; FT similar to hypothetical proteins e.g. TR:O67826 FT (EMBL:AE000769) Aquifex aeolicus AQ_2035 (219 aa), fasta FT scores; opt: 130 z-score: 282.9 E(): 1.7e-08, 28.8% FT identity in 233 aa overlap. 43.1% identity to HP0934" FT /note="Updated (2006) note: Pfam domain PF04055 Radical SAM FT superfamily was identified within CDS. Product modified to FT more specific family member due to motif match. No specific FT characterisation carried out yet, so putative kept within FT product function. Functional classification - Misc" FT /db_xref="GOA:Q0PBX7" FT /db_xref="InterPro:IPR007197" FT /db_xref="UniProtKB/TrEMBL:Q0PBX7" FT /inference="protein motif:Pfam:PF04055" FT /protein_id="CAL34331.1" FT /translation="MQLVESFLSIQGEGKYNGKLAIFMRFAGCNFNCLGFNVKISKNDK FT TLIGCDTIRAVFTKDFKESYETLNANELLKRVIKLKKDFDPIVVITGGEPLIHYENPEF FT IEFIQMLLKNKFEIHFESNGSIEIDFDRYPFYKECIFALSVKLQNSGIKKDKRLNFKAL FT KAFKNYAKDSFYKFVLDANTLDNSFLEINEILKEAPNQIFCMPMGENEQNLKKNAQKIA FT EFCIKNGYNYSDRIHIRLWNDKEGV" FT misc_feature complement(160567..161163) FT /note="HMMPfam hit to PF04055, Radical SAM FT superfamily,score 3.1e-08" FT /inference="protein motif:Pfam:PF04055" FT CDS complement(161232..162194) FT /transl_table=11 FT /gene="moaA" FT /locus_tag="Cj0161c" FT /product="putative molybdenum cofactor biosynthesis protein FT A" FT /note="Original (2000) note: Cj0161c, moaA, probable FT molybdenum cofactor biosynthesis protein A, len: 320 aa; FT similar to many e.g. MOAA_ECOLI molybdenum cofactor FT biosynthesis protein A (329 aa), fasta scores; opt: 590 FT z-score: 824.3 E(): 0, 32.4% identity in 312 aa overlap. FT 51.7% identity to HP0768. Also similar to Cj1244 (29.8% FT identity in 178 aa overlap). Contains PS01305 moaA / nifB / FT pqqE family signature" FT /note="Updated (2006) note: Pfam domains PF06463 Molybdenum FT Cofactor Synthesis C and PF04055 Radical SAM superfamily FT were identified within CDS. Further support given to FT product funtion. Characterisation work carried out within FT Escherichia coli with marginal identity score. Putative FT kept within product function. Functional classification - FT Biosynthesis of cofactors, prosthetic groups and carriers - FT Molybdopterin" FT /note="PMID:8361352" FT /db_xref="GOA:Q9PIW6" FT /db_xref="InterPro:IPR007197" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIW6" FT /inference="protein motif:Pfam:PF04055" FT /inference="protein motif:Pfam:PF06463" FT /inference="protein motif:Prosite:PS01305" FT /protein_id="CAL34332.1" FT /translation="MLIDQFGRKINYLRISVTQRCNFRCLYCMPKIPFDYQPKENLLSF FT EELFLFVKAAIDEGIEKIRITGGEPLLRKDLSIFIKMISDYKSDIDLAITTNGFLLKDF FT AKDLKNAGLKRLNISLDTLDHKKAKTLAQKDVLDSVLSGIDEALNLDLKVKLNTVALKN FT LNDDELISLLEFAKSKKAQIRFIEFMENTHAYGKLQGLKRDEIIQILSQKYQIQLIKKD FT EKAPVSIYKADDYEFGIIDPHSHEFCDSCNRIRLSAEGLLIPCLYFDEALSIKEAVRKG FT DIKAAVEILQEVLRNKPEKNKWSVVDNETSSRAFYQTGG" FT misc_feature complement(161286..161654) FT /note="HMMPfam hit to PF06463, Molybdenum Cofactor FT Synthesis C, score 1.5e-47" FT /inference="protein motif:Pfam:PF06463" FT misc_feature complement(161667..162152) FT /note="HMMPfam hit to PF04055, Radical SAM FT superfamily,score 5.8e-38" FT /inference="protein motif:Pfam:PF04055" FT misc_feature complement(162111..162146) FT /note="PS01305 moaA / nifB / pqqE family signature" FT /inference="protein motif:Prosite:PS01305" FT CDS complement(162207..162722) FT /transl_table=11 FT /locus_tag="Cj0162c" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0162c, probable periplasmic FT protein, len: 171 aa; no Hp match. Contains probable FT N-terminal signal sequence. Functional classification FT -Miscellaneous periplasmic proteins" FT /db_xref="GOA:Q0PBX5" FT /db_xref="UniProtKB/TrEMBL:Q0PBX5" FT /protein_id="CAL34333.1" FT /translation="MSDDVLYLVFIIVLLIAMLAYMNIKERENNAKIAKLQNVIEDITK FT ELHYFRKELGVKDDSEEDEDYKTSLLKEEIMIELDKQISSKITPVLRTLKTMEHIIEDF FT QNEQQNRLLNLEQKAQSMAKLTPNYDTEEQKIENLFKEGKSIEQIAKDLRIGTGNVELV FT LKFKKLIK" FT misc_feature complement(162651..162710) FT /note="1 probable transmembrane helix predicted for Cj0162c FT by TMHMM2.0 at aa 5-24" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(162719..163216) FT /transl_table=11 FT /locus_tag="Cj0163c" FT /product="hypothetical protein Cj0163c" FT /note="Original (2000) note: Cj0163c, unknown, len: 165 aa; FT no Hp match. Functional classification - Unknown" FT /db_xref="GOA:Q0PBX4" FT /db_xref="UniProtKB/TrEMBL:Q0PBX4" FT /protein_id="CAL34334.1" FT /translation="MELALFKAGFEAHLECCEIENNRFLGEYLKLGAISQILKWKKLAL FT RIDFDEGEKIIFDLLLSLKEDILRLENSLDKNKELIPLKQKGVIESLNFEYLNFLDTIL FT EEDKEYYLRFDLNNQKIAIFIKAQSQTLAKIIKIKPEDKMAFDAFVVEIQRNMIRNKKG FT QE" FT CDS complement(163207..164091) FT /transl_table=11 FT /gene="ubiA" FT /locus_tag="Cj0164c" FT /product="putative 4-hydroxybenzoate octaprenyltransferase" FT /EC_number="2.5.1.-" FT /note="Original (2000) note: Cj0164c, ubiA, possible FT 4-hydroxybenzoate octaprenyltransferase, len: 294 aa; FT similar to e.g. UBIA_ECOLI 4-hydroxybenzoate FT octaprenyltransferase (EC 2.5.1.-) (290 aa), fasta scores; FT opt: 250 z-score: 303.5 E(): 1.2e-09, 23.8% identity in 227 FT aa overlap. 51.2% identity to HP1360. Contains Pfam match FT to entry PF01040 CytC_assmbly_fac, Cytochrome c oxidase FT assembly factor, score 209.90, E-value 3.7e-59" FT /note="Updated (2006) note: Eight probable transmembrane FT helices predicted by TMHMM2.0. Characterised within FT Escherichia coli, however, identity score was FT unnacceptable. Thus, putative kept within product function. FT Functional classification - Biosynthesis of cofactors, FT prosthetic groups and carriers - Menaquinone and FT ubiquinine" FT /note="PMID:15597200" FT /db_xref="GOA:Q0PBX3" FT /db_xref="InterPro:IPR006371" FT /db_xref="UniProtKB/TrEMBL:Q0PBX3" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF01040" FT /protein_id="CAL34335.1" FT /translation="MNTFWIKFKDILELVVFKHSIFALPFLFSSMIVASKLANDTAWFG FT FKALILGIICAVSARNFAMATNRLMDEDIDKDNPRCANRPNVSGKIGRKSVWIFIIINA FT LIFISCSYFINTLAFYLSFPVLLVLAIYSAFKRFSSLAHLVLGFCLGLAPIAGSVIIMG FT EIHIYSVILCLGVTFWTAGFDLLYSLQDMEYDKKIGLHSIPAKFGSKATLFISSFCHIL FT AVLFWLLFVWEVWGVALGKIALIGVIISGIILALEHKIVHKNFAHIDRAFFTLNGYLSI FT IFFIFIWIDLLWN" FT misc_feature complement(order(163990..164058,163903..163962, FT 163738..163806,163612..163680,163531..163599, FT 163405..163473,163324..163392,163213..163281)) FT /note="8 probable transmembrane helices predicted for FT Cj0164c by TMHMM2.0 at aa 12-34, 44-63, 96-118, FT 138-160,165-187, 207-229, 234-256 and 271-293" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(163219..164034) FT /note="HMMPfam hit to PF01040, UbiA prenyltransferase FT family, score 3.1e-52" FT /inference="protein motif:Pfam:PF01040" FT misc_feature complement(163762..163794) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 164162..165031 FT /transl_table=11 FT /gene="miaA" FT /locus_tag="Cj0166" FT /product="tRNA delta(2)-isopentenylpyrophosphate FT transferase" FT /EC_number="2.5.1.8" FT /note="Original (2000) note: Cj0166, miaA, probable tRNA FT delta(2)-isopentenylpyrophosphate transferase, len: 289 aa; FT similar to many e.g. MIAA_ECOLI tRNA FT delta(2)-isopentenylpyrophosphate transferase (316 FT aa),fasta scores; opt: 185 z-score: 464.4 E(): 1.3e-18, FT 29.2% identity in 277 aa overlap. 38.4% identity to HP1415. FT Contains PS00017 ATP/GTP-binding site motif A (P-loop)" FT /note="Updated (2006) note: Pfam domain PF01715 IPP FT transferase identified within CDS. Further support given to FT product function. Characterised within Escherichia coli FT with marginal identity score. Putative not added to product FT function. Functional classification - Aminoacyl tRNA FT synthetases and their modification" FT /note="PMID:1999389" FT /db_xref="GOA:Q9PIW2" FT /db_xref="InterPro:IPR018022" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIW2" FT /inference="protein motif:Pfam:PF01715" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34336.1" FT /translation="MFFEIALIGTTASGKTYIANTLAREFNAVVLSLDSLCVYKEINIA FT SAKPSQDDLASIKYFGVNLLSVNEHFNVELFIREYQKAKEFALARNLPLIIVGGTGFYL FT KTMIDGLSEKTLESKSSLNNDEIYALLLNIDPNYKIEKNDTYRLKKWLGIYEQTREIPS FT EFLKRTQKTGVLKDIEIYELAWDKEILKKRIKTRTKEMLDNGLLDEAKILFSKFDHKLK FT ALNSIGLKECKEYLDGEISFKELENLITIHTTQLAKRQRTFNKKFQSKALEFDKALATL FT RMKFSIEK" FT misc_feature 164186..164209 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 164267..164986 FT /note="HMMPfam hit to PF01715, IPP transferase, score FT 5.9e-46" FT /inference="protein motif:Pfam:PF01715" FT CDS complement(165017..165580) FT /transl_table=11 FT /locus_tag="Cj0167c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0167c, probable integral FT membrane protein, len: 187 aa; similar to hypothetical FT proteins e.g. YEBN_ECOLI (206 aa), fasta scores; opt: 451 FT z-score: 792.0 E(): 0, 38.1% identity in 197 aa overlap. No FT Hp match" FT /note="Updated (2006) note: Six probable transmembrane FT helices predicted by TMHMM2.0. Also, Pfam domains x2 FT PF02659 Domain of unknown function DUF were identified FT within CDS. This family consists of hypothetical FT transmembrane proteins with unknown function. Further FT support given to product function. No specific FT characterisation yet, so putative included in product FT function. Functional classification - FT Membranes,lipoproteins and porins" FT /db_xref="GOA:Q9PIW1" FT /db_xref="InterPro:IPR003810" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIW1" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF02659" FT /protein_id="CAL34337.1" FT /translation="MDFYSLIFLSCALGMDAFAVSLCKGFSVKKLHLKHYLIVGIYFGG FT FQALMPTIGYFIGITFASFIASIDHWIAFILLSLIGLKMIKESLENENCDSNANQFGFK FT TMLALAIATSIDALAVGVSFAFLNVNLLLAIFLIGIITFILCIIALKIGNKFGIYLKNK FT AELLGGLVLIILGVKILIEHLFFD" FT misc_feature complement(order(165512..165571,165407..165475, FT 165326..165394,165200..165268,165122..165190, FT 165026..165085)) FT /note="6 probable transmembrane helices predicted for FT Cj0167c by TMHMM2.0 at aa 4-23, 36-58, 63-85, FT 105-127,131-153 and 166-185" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(165050..165265) FT /note="HMMPfam hit to PF02659, Domain of unknown function FT DUF, score 1.5e-17" FT /inference="protein motif:Pfam:PF02659" FT misc_feature complement(165335..165565) FT /note="HMMPfam hit to PF02659, Domain of unknown function FT DUF, score 4.5e-15" FT /inference="protein motif:Pfam:PF02659" FT tRNA 165728..165802 FT /gene="tRNA-Glu" FT /note="tRNA Glu anticodon TTC, Cove score 66.15" FT CDS complement(165938..166105) FT /transl_table=11 FT /locus_tag="Cj0168c" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0168c, probable periplasmic FT protein, len: 55 aa; No Hp ortholog. Some similarity in FT C-term to Cj0909 (35.0% identity in 40 aa overlap). FT Contains probable N-terminal signal sequence" FT /note="Updated (2006) note: Literature search identified FT paper giving further support to product function. FT N-terminal matches to Yersinia pestis, acid shock protein 2 FT precursor. Functional classification - Miscellaneous FT periplasmic proteins" FT /note="PMID:15632442" FT /db_xref="GOA:Q0PBX0" FT /db_xref="UniProtKB/TrEMBL:Q0PBX0" FT /protein_id="CAL34338.1" FT /translation="MKKVVLISALLGAFAANVFAANTPSDVNQTHTKAKADKKHEAKTH FT KKTKEQTPAQ" FT misc_feature complement(166043..166096) FT /note="1 probable transmembrane helix predicted for Cj0168c FT by TMHMM2.0 at aa 4-21" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(166046..166105) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000084_165938_166105 by SignalP 2.0 FT HMM (Signal peptide probability 1.000) with cleavage site FT probability 0.552 between residues 20 and 21" FT CDS 166373..167035 FT /transl_table=11 FT /gene="sodB" FT /locus_tag="Cj0169" FT /product="superoxide dismutase (Fe)" FT /EC_number="1.15.1.1" FT /note="Original (2000) note: Cj0169, sodB, superoxide FT dismutase (Fe), len: 220 aa; 99.1% identical to SODF_CAMJE, FT and highly simlar to many e.g. SODF_ECOLI superoxide FT dismutase (Fe) (EC 1.15.1.1) (192 aa), fasta scores; opt: FT 740 z-score: 1209.9 E(): 0, 57.9% identity in 195 aa FT overlap. 61.6% identity to HP0389. Contains PS00088 FT Manganese and iron superoxide dismutases signature and Pfam FT match to entry PF00081 sodfe, Iron/manganese superoxide FT dismutases (SODM), score 275.90, E-value 5.2e-79" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni, so putative not added. Paper FT identified linking protein to glycoprotein (PMID:12186869). FT Functional classification -Detoxification" FT /note="PMID:12186869, PMID:8025686, PMID:8005660" FT /db_xref="GOA:Q0PBW9" FT /db_xref="HSSP:1ISC" FT /db_xref="InterPro:IPR019831" FT /db_xref="UniProtKB/Swiss-Prot:Q0PBW9" FT /inference="protein motif:Pfam:PF00081" FT /inference="protein motif:Prosite:PS00088" FT /protein_id="CAL34339.1" FT /translation="MFELRKLPYDTNAFGDFLSAETFSYHHGKHHNTYVTNLNNLIKDT FT EFAGKDLVSIIKTSNGGVFNNAAQVYNHDFYFDCIKPSTGCGCGGSCQSIDANLQAALE FT KEFGSLENFKAEFIKGATGVFGSGWFWLVYNTKNQKLEFVGTSNAATPITEDKVPLLVV FT DVWEHAYYVDHRNARPAYLEKFYAHINWEFVAKAYEWALKEGMGSVSFYANELHPVK" FT misc_feature 166373..166615 FT /note="HMMPfam hit to PF00081, Iron/manganese superoxide FT dismutases, alpha-, score 2.8e-30" FT /inference="protein motif:Pfam:PF00081" FT misc_feature 166637..166966 FT /note="HMMPfam hit to PF02777, Iron/manganese superoxide FT dismutases, C-term, score 3.3e-45" FT /inference="protein motif:Pfam:PF02777" FT misc_feature 166862..166885 FT /note="PS00088 Manganese and iron superoxide dismutases FT signature" FT /inference="protein motif:Prosite:PS00088" FT CDS join(167050..167295,167297..167794) FT /transl_table=11 FT /locus_tag="Cj0170" FT /product="hypothetical protein Cj0170" FT /note="Original (2000) note: Cj0171, unknown, len: 166 aa; FT no Hp match. Contains polyporphic sequence G(9,11) at FT N-terminus; G11 allows translation from the upstream CDS FT Cj0170, G9 (consensus) would only allow this CDS to start FT at aa 47. Similar to Cj1326 (51.9% identity in 135 aa FT overlap), which also contains a polymorphic sequence FT allowing possible translation from Cj1325" FT /note="Original (2000) note: Cj0170, unknown, len: 90 aa; FT no Hp match. Contains polyporphic sequence G(9,11) at FT C-terminus; G9 (consensus) gives this translation stop,G11 FT allows translation into the downstream CDS Cj0171. Similar FT to Cj1325 (73.8% identity in 61 aa overlap), which also FT contains a polymorphic sequence allowing possible FT translation into Cj1326" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Coding sequences have been FT merged to reflect the complete amino acid sequence for this FT gene regardless of phase. Previous annotation gave Cj0170 FT and Cj0171 as seperate CDS. Merging of these CDSs has lead FT to loss of the downstream CDS. Functional classification - FT Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PBW8" FT /protein_id="CAL34340.1" FT /translation="MLEWILTLSQHSTQKGAKMDNSLSAYTQKYDKEGYGLQYPDGHVI FT RFYERILKYKLSKTSGKLLDFGCGNGVHSKYFKNITGGGIEPYGIDIVPSLKKVWEKDP FT CLDSKNFHIISPNSSFKKLFNTKMDFIFANQSLYYLTKQAFKEAVQEFYELCNEGAIIF FT ATMMSDKGYSMYERGELMDNSLREVKGCPSGRLSGSSYIRFTKDIEELKEDFKPFKPLF FT WGDYELINLYNFEGSVEHFIYIGQK" FT CDS complement(167807..169012) FT /transl_table=11 FT /locus_tag="Cj0172c" FT /product="putative saccharopine dehydrogenase" FT /EC_number="1.5.1.7" FT /note="Original (2000) note: Cj0172c, unknown, len: 401 aa; FT similar to hypothetical proteins e.g. TR:Q55131 FT (EMBL:D64001) Synechocystis sp. SLR0049 (398 aa), fasta FT scores; opt: 1534 z-score: 2324.2 E(): 0, 55.7% identity in FT 397 aa overlap. 63.8% identity to HP1507 conserved FT hypothetical ATP-binding protein" FT /note="Updated (2006) note: Pfam domain PF03435 FT Saccharopine dehydrogenase was identified within CDS. FT Product modified to more specific family member due to FT motif match. No specific characterisation has yet been FT carried out. Putative kept within product function. FT Functional classification - Misc" FT /db_xref="GOA:Q0PBW7" FT /db_xref="InterPro:IPR005097" FT /db_xref="UniProtKB/TrEMBL:Q0PBW7" FT /inference="protein motif:Pfam:PF03435" FT /protein_id="CAL34341.1" FT /translation="MKNLLIIGAGGVSRVATVKCAMNSDTFSKITLASRTKSKCDEIAA FT FIKERLGVQIETAQIDADDSNAVVELIKKTEAQILLNVALPYQDLSLMDACIKAGIDYI FT DTANYEHPDLAKFEYKEQWARNDEFKQAGILGLLGSGFDPGVTNVFCAYAQQNLFDEIS FT YIDILDCNAGDHGYAFATNFNPEINLREVSAKGRYWENGKWIETQPMEIKMEWDYPEVG FT VKDSYLLYHEELESLVKNIKGLKRIRFFMTFGQSYLTHMKCLENVGMLGIKPVIHQGKE FT IIPIEFLKTLLPDPASLGPRTKGYTNIGCVIRGKKDGKDKQVYIYNVCNHEECYKETGA FT QAVSYTTGVPAMIGTKLIAKGIWQGKGVFNMEEFDAKPFMEELNSQGLPWKIIEMTPSL FT GE" FT misc_feature complement(167837..169003) FT /note="HMMPfam hit to PF03435, Saccharopine FT dehydrogenase,score 2e-236" FT /inference="protein motif:Pfam:PF03435" FT CDS complement(169054..169962) FT /transl_table=11 FT /gene="cfbpC" FT /locus_tag="Cj0173c" FT /product="putative iron-uptake ABC transport system FT ATP-binding protein" FT /note="Original (2000) note: Cj0173c, possible iron-uptake FT ABC transport system ATP-binding protein, len: 302 aa; FT similar to many e.g. HITC_HAEIN iron(iii)-transport FT ATP-binding protein hitC (356 aa), fasta scores; opt: 389 FT z-score: 783.2 E(): 0, 38.0% identity in 250 aa overlap. FT Contains PS00017 ATP/GTP-binding site motif A FT (P-loop),PS00211 ABC transporters family signature and Pfam FT match to entry PF00005 ABC_tran, ABC transporters, score FT 163.10,E-value 4.9e-45. No Hp ortholog" FT /note="Updated (2006) note: Literature search identified FT many supporting papers within Campylobacter jejuni FT (PMID:12069882) and also paper carrying out the original FT work within Serratia marcescens. Designated as FT Campylobacter ferric binding protein (Cfbp) system. FT Characterisation with acceptable identity score yet to be FT carried out. Thus, putative kept within product function. FT Functional classification - Transport/binding proteins FT -Cations" FT /note="PMID:15231804, PMID:12069882, FT PMID:15731081,PMID:2644190, PMID:7927717" FT /db_xref="GOA:Q0PBW6" FT /db_xref="InterPro:IPR017871" FT /db_xref="UniProtKB/TrEMBL:Q0PBW6" FT /inference="protein motif:Pfam:PF00005" FT /inference="protein motif:Prosite:PS00211" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34342.1" FT /translation="MMLEIKNLSKNFGKIQALENINLHVKEGEFLSILGGSGSGKSTLL FT RIIAKLEQASSYDLFSCKGEVALMFQNYALFPHLNVEKNILFALYDKKDKNQILNHLLK FT TFEIEDLRYKKIDEISGGQAQRVAFARAMARGCKLLLLDEPFSNLDQNLKQDLRRELKK FT MIENQGITAIMVTHDIEDAYCMSDQIAFLEKGKILAHANPKELYFKPDFKSAQILPDLN FT IIEEKLDLEDEFFAWIASKNYIFGYAELKIGNRFEAKILQKEFLGAFCRLKLLYKNIIF FT FILVSSSYDLEEKISFDIINF" FT misc_feature complement(169378..169881) FT /note="HMMPfam hit to PF00005, ABC transporter, score FT 2.3e-45" FT /inference="protein motif:Pfam:PF00005" FT misc_feature complement(169564..169608) FT /note="PS00211 ABC transporters family signature" FT /inference="protein motif:Prosite:PS00211" FT misc_feature complement(169837..169860) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(169946..171562) FT /transl_table=11 FT /gene="cfbpB" FT /locus_tag="Cj0174c" FT /product="putative iron-uptake ABC transport system FT permease protein" FT /note="Original (2000) note: Cj0174c, possible iron-uptake FT ABC transport system permease protein, len: 538 aa; similar FT to e.g. SFUB_SERMA iron(iii)-transport system permease FT protein (527 aa), fasta scores; opt: 333 z-score: 335.6 FT E(): 1.9e-11, 21.5% identity in 522 aa overlap. No Hp FT match. Contains Pfam match to entry PF00528 FT BPD_transp,Binding-protein-dependent transport systems FT inner membrane component, score 27.90, E-value 0.00024" FT /note="Updated (2006) note: Literature search identified FT many supporting papers within Campylobacter jejuni FT (PMID:12069882) and also paper carrying out the original FT work within Serratia marcescens. Designated as FT Campylobacter ferric binding protein (Cfbp) system. FT Characterisation with acceptable identity score yet to be FT carried out. Thus, putative kept within product function. FT Functional classification - Transport/binding proteins FT -Cations" FT /note="PMID:15231804, PMID:12069882, FT PMID:15731081,PMID:2644190, PMID:7927717" FT /db_xref="GOA:Q0PBW5" FT /db_xref="InterPro:IPR000515" FT /db_xref="UniProtKB/TrEMBL:Q0PBW5" FT /inference="protein motif:Pfam:PF00528" FT /protein_id="CAL34343.1" FT /translation="MYKTLKYYKLGAILLALFLALPIFGIFAELFYILFQNFNTSDLTQ FT FSSIKENLSHFFDYLFLKFIKDTFIISMGVLCLSLILGVSSAYLIANYDFYFCKILEKL FT LILPLAIPAYILAFVYVGIMDFQGFFHENFGFRIDFFNHYGVIFVLAISLYPYIYLFAK FT TAFKSEAKEAYEVAKIMKYSEFRIFTRVALLSARPAIFSGALLVLMETLSDYGASAYLG FT VDTFSAGIFKLWYDLNDSYSSSVLSGILMLFVFLIMYVDYYYKNKHHYSFNQNLALFIK FT KRKLNPIKQILSCIYCFMIAFVGFILPFIWLVYWGLKDHKLFESQFYIISFQTIILALI FT TALITTFLAYFLMFSSRIVKNHFFNLFILKISSLGYSIPAAALGISIIVLFVFLDKFFH FT MSLLGNSLLVLVFAYIIRFLASAIYSLEGGYNKIHLNIDEASLNLRTSYFILFFKIHTP FT LMKHFLFLAFIIVFIDTIKELPLSRILAPFGFETLSVKAFWFASDERIYDAALPSLFIV FT FLSLMVVVWMDKITRKDDVRN" FT misc_feature complement(order(171458..171526,171290..171358, FT 171191..171253,171065..171133,170936..171004, FT 170774..170842,170621..170689,170510..170578, FT 170384..170452,170273..170341,170144..170212, FT 169982..170050)) FT /note="12 probable transmembrane helices predicted for FT Cj0174c by TMHMM2.0 at aa 13-35, 69-91, 104-124, FT 144-166,187-209, 241-263, 292-314, 329-351, 371-393, FT 408-430,451-473 and 505-527" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(170753..171382) FT /note="HMMPfam hit to PF00528, Binding-protein-dependent FT transport syst, score 5.4e-07" FT /inference="protein motif:Pfam:PF00528" FT sig_peptide complement(171473..171562) FT /note="Signal peptide predicted for cfbpB by SignalP 2.0 FT HMM (Signal peptide probability 0.942) with cleavage site FT probability 0.300 between residues 30 and 31" FT CDS complement(171562..172566) FT /transl_table=11 FT /gene="cfbpA" FT /locus_tag="Cj0175c" FT /product="putative iron-uptake ABC transport FT system,periplasmic iron-binding protein" FT /note="Original (2000) note: Cj0175c, possible iron-uptake FT ABC transport system periplasmic iron-binding protein,len: FT 334 aa; similar to e.g. HITA_HAEIN iron-utilization FT periplasmic protein precursor (332 aa), fasta scores; opt: FT 466 z-score: 500.8 E(): 1.2e-20, 29.8% identity in 332 aa FT overlap. No Hp match. Contains N-terminal signal sequence" FT /note="Updated (2006) note: Pfam domain PF01547 Bacterial FT extracellular solute-binding protein identified within CDS. FT Further support given to product function. Literature FT search identified many supporting papers within FT Campylobacter jejuni (PMID:12069882) and also paper FT carrying out the original work within Serratia marcescens. FT Designated as Campylobacter ferric binding protein (Cfbp) FT system. Characterisation with acceptable identity score yet FT to be carried out. Thus, putative kept within product FT function. Paper identified linked protein to glycoprotein FT (PMID:15231804). Functional classification FT -Transport/binding proteins - Cations" FT /note="PMID:15613474, PMID:15231804, FT PMID:12069882,PMID:12186869, PMID:2644190" FT /db_xref="GOA:Q0PBW4" FT /db_xref="InterPro:IPR006059" FT /db_xref="PDB:1Y4T" FT /db_xref="UniProtKB/TrEMBL:Q0PBW4" FT /inference="protein motif:Pfam:PF01547" FT /protein_id="CAL34344.1" FT /translation="MKKIFFMFLTAVSFLGASELNIYSARHYNADFEIIKKFEEKTGIK FT VNHTQAKASELIKRLSLEGSNSPADIFITADISNLTEAKNLGLLSPVSSKYLEEFIPAH FT LRDKDKEWFAITKRARIIAYNKNTNIDISKMKNYEDLAKAEFKGEIVMRSATAPYSKTL FT LASIIANDGNKEAKAWAKGVLENLATNPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKN FT SKNPKDVEVGNSLGIIFPNQDNRGTHINISGIAMTKSSKNQDAAKKFMEFMLSPEIQKI FT LTDSNYEFPIRNDVELSQTVKDFGTFKEDQIPVSKIAENIKEAVKIYDEVGFR" FT misc_feature complement(171727..172566) FT /note="HMMPfam hit to PF01547, Bacterial extracellular FT solute-binding prot, score 4.7e-14" FT /inference="protein motif:Pfam:PF01547" FT sig_peptide complement(172495..172566) FT /note="Signal peptide predicted for cfbpA by SignalP 2.0 FT HMM (Signal peptide probability 0.944) with cleavage site FT probability 0.410 between residues 24 and 25" FT CDS complement(172563..172694) FT /transl_table=11 FT /locus_tag="Cj0176c" FT /product="putative lipoprotein" FT /note="Original (2000) note: Cj0176c, probable lipoprotein, FT len: 43 aa; no Hp match. Contains N-terminal signal FT sequence with appropriately positioned PS00013 Prokaryotic FT membrane lipoprotein lipid attachment site" FT /note="Updated (2006) note: Literature search identified FT papers giving further clues to product function. Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PBW3" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34345.1" FT /translation="MSMKKIILFLLCVGFAFACSEHSHTDFKDLNKTEYNSQLKDKI" FT sig_peptide complement(172626..172694) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000086_172563_172694 by SignalP 2.0 FT HMM (Signal peptide probability 0.989) with cleavage site FT probability 0.509 between residues 23 and 24" FT misc_feature complement(172638..172670) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 172916..173767 FT /transl_table=11 FT /locus_tag="Cj0177" FT /product="putative iron transport protein" FT /note="Original (2000) note: Cj0177, probable FT lipoprotein,len: 283 aa; simlar to TR:O68876 FT (EMBL:AF055999) hypothetical protein PhuW from Pseudomonas FT aeruginosa hemin uptake locus (295 aa), fasta scores; opt: FT 375 z-score: 307.6 E(): 7.1e-10, 31.3% identity in 246 aa FT overlap. No Hp match. Contains N-terminal signal sequence FT with appropriately positioned PS00013 Prokaryotic membrane FT lipoprotein lipid attachment site" FT /note="Updated (2006) note: Pfam domain PF04187 Protein of FT unknown function, DUF399 identified within CDS. Literature FT search identified papers giving further clues to product FT function. Product function modified to putative iron FT transport protein based on information from literature. No FT specific characterisation with acceptable identity scores FT has been carried out yet. Thus, putative kept within FT product function. Functional classification FT -Transport/binding proteins - Cations" FT /note="PMID:12069882, PMID:15231804, PMID:15231804" FT /db_xref="InterPro:IPR007314" FT /db_xref="PDB:2G5G" FT /db_xref="UniProtKB/TrEMBL:Q0PBW2" FT /inference="protein motif:Pfam:PF04187" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34346.1" FT /translation="MKFYTILSILFISFMLSACAVLQKSSPLQENKDFYILDTHTQKKI FT SFEDMILELLKADVILLGEKHDEVKHKISQVMIFNALEGNLSSQNINFDVALEMLASTE FT QNHLDKAFKNKKTIKANELTNALNWDKVWKWKDYEQFVNVVFYSKSKILGANLSRSEIT FT SIYNGAQPLKGYVSTTNEVKKQLFDIISLSHKLNPEENKELLDKLVEIQQFKDRRMADV FT LVHHVNKVLLLAGSYHTSKKIGIPLHIQDFKSSKKIVVVNLSYGEIDLKDSDYVLIYKG FT EE" FT sig_peptide 172916..172999 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000087_172916_173767 by SignalP 2.0 FT HMM (Signal peptide probability 0.995) with cleavage site FT probability 0.342 between residues 28 and 29" FT misc_feature 172916..173764 FT /note="HMMPfam hit to PF04187, Protein of unknown function, FT DUF399, score 5e-164" FT /inference="protein motif:Pfam:PF04187" FT misc_feature 172940..172972 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 173764..176031 FT /transl_table=11 FT /locus_tag="Cj0178" FT /product="putative TonB-denpendent outer membrane receptor" FT /note="Original (2000) note: Cj0178, possible outer FT membrane siderophore receptor, len: 755 aa; similar to e.g. FT YC17_HAEIN probable tonB-dependent receptor HI1217 (913 FT aa), fasta scores; opt: 440 z-score: 1818.4 E(): 0,32.7% FT identity in 912 aa overlap, and TR:O68881 (EMBL:AF055999) FT outer membrane hemin receptor PhuR from Pseudomonas FT aeruginosa (764 aa), fasta scores; opt: 145 z-score: 207.4 FT E(): 0.00027 22.3% identity in 806 aa overlap. No Hp match. FT Contains N-terminal signal sequence" FT /note="Updated (2006) note: Pfam domains PF07715 FT TonB-dependent Receptor Plug Domain and PF00593 TonB FT dependent receptor identified within CDS. Literature search FT identified papers giving further clues to product function. FT Product function modified to more specific family member. FT No specific characterisation with acceptable identity FT scores has been carried out yet. Thus,putative kept within FT product function. Functional classification - FT Transport/binding proteins - Cations" FT /note="PMID:15731081, PMID:15632442, FT PMID:15231804,PMID:12069882" FT /db_xref="GOA:Q0PBW1" FT /db_xref="InterPro:IPR012910" FT /db_xref="UniProtKB/TrEMBL:Q0PBW1" FT /inference="protein motif:Pfam:PF00593" FT /inference="protein motif:Pfam:PF07715" FT /protein_id="CAL34347.1" FT /translation="MKKLSLFCAVGLCFASFAFSEELEFDSLEISGSKIKNDEKPFVTP FT GATSTREGIGSDTQSIDSIVRSIPGTYTNTDQAQGTVQVNIRGMSGFGRVNTMIDGVTQ FT TFYGSASDDPARFHSQTGTSAFGAVIDTNFLIGVDVTRGTFEGVGGANALMGSANFKTI FT GINDIVHDGNIFGFLGRFSYGSNGIGPSYMSAVAGKTELENNGYVGALFGYSAKRITQN FT YTVGGGGKIGSSMVDTDGDGIADTNIAPFDPDFLTQKPNSQLFKLEYVPNSFTNTIFSY FT RRYQNELAGRKIHNDNYQLDFWHNPNEWLNVNTLIAYNQGIQTYGSKSTFAANDAIANT FT KAKNTATTFDISDTLEGEWHRFNLNIRFGANILLNDYKNTLNTSIQGVNSIPFQPRGKQ FT NLFTYYLDNSLNYGIFTLDTNVNLLDWNIKGHRPACDEVNFMCFPKAATDIDKNGLRLN FT ASVMLSAAIHELITPFVSFARTNRAPNVQEMFFSNNEGNGINSFLKPEQANTWQIGFNS FT FKHGLLKDDDRFGFKAVYYHTKIKDYIYNEQFYLEDPSKDPPSSQFYMHLNSADDTIFK FT GVELELSYDLGFAYAKAMYSRQDTSSTISQTSGPLLGSFSASKIMELPKDYANVELGFR FT LNDKISFGGIAKYTGKAKRVNPNTDDWNKDPNNPYYPKPTTQDLPKIPIIVDLYWNIEW FT FKNLTMRAEVQNLFDKNYMDALNAYNSLDNQLQYNGAGDPIYLFSNSARGRTFIVSFEY FT KY" FT sig_peptide 173764..173823 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000088_173764_176031 by SignalP 2.0 FT HMM (Signal peptide probability 0.998) with cleavage site FT probability 0.873 between residues 20 and 21" FT misc_feature 173881..174234 FT /note="HMMPfam hit to PF07715, TonB-dependent Receptor Plug FT Domain, score 9.2e-13" FT /inference="protein motif:Pfam:PF07715" FT misc_feature 175135..176028 FT /note="HMMPfam hit to PF00593, TonB dependent FT receptor,score 1.5e-22" FT /inference="protein motif:Pfam:PF00593" FT CDS 176043..176804 FT /transl_table=11 FT /gene="exbB1" FT /locus_tag="Cj0179" FT /product="biopolymer transport protein" FT /note="Original (2000) note: Cj0179, exbB1, biopolymer FT transport protein, len: 253 aa; highly similar to e.g. FT EXBB_ECOLI biopolymer transport exbB protein (244 aa),fasta FT scores; opt: 537 z-score: 811.2 E(): 0, 46.3% identity in FT 216 aa overlap. No Hp ortholog" FT /note="Updated (2006) note: Pfam domain PF01618 FT MotA/TolQ/ExbB proton channel family identified within CDS. FT Also, three probable transmembrane helices predicted by FT TMHMM2.0. Further support given to product function. FT Characterised within Escherichia coli with acceptable FT identity score. Thus, putative not added. Cj0179-Cj0181 FT (exbB1, exbD1, tonB1) function as an outer-membrane energy FT transducer system. Functional classification FT -Transport/binding proteins - Other" FT /note="PMID:7642501, PMID:8437515, FT PMID:15632442,PMID:12069882" FT /db_xref="GOA:Q0PBW0" FT /db_xref="InterPro:IPR002898" FT /db_xref="UniProtKB/TrEMBL:Q0PBW0" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF01618" FT /protein_id="CAL34348.1" FT /translation="MLKKCFYFVFLLLNLNAEANATDTNLSFDSSKIETEAPKIELSLS FT SLYQNADEVVKGVIYILVLFSILAWAVFISKLMQFYFMKKNLDLSIQKIKELKNLNELD FT QTKDFAGVLSLEIQDELEKSEYKNDHIKERIELRLQNTISKQITASKNGLSLLASIGAS FT APFIGLFGTVWGIMNAFIGIANLGNASLAVVAPGIAEALFATAFGLIAAIPAVLFYNYL FT TRKNLKLMHHLDELANFVYILFHRSYFNDKN" FT sig_peptide 176043..176099 FT /note="Signal peptide predicted for exbB1 by SignalP 2.0 FT HMM (Signal peptide probability 0.911) with cleavage site FT probability 0.584 between residues 19 and 20" FT misc_feature order(176211..176264,176505..176573,176631..176699) FT /note="3 probable transmembrane helices predicted for FT Cj0179 by TMHMM2.0 at aa 57-74, 155-177 and 197-219" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 176322..176756 FT /note="HMMPfam hit to PF01618, MotA/TolQ/ExbB proton FT channel family, score 8.6e-47" FT /inference="protein motif:Pfam:PF01618" FT CDS 176791..177201 FT /transl_table=11 FT /gene="exbD1" FT /locus_tag="Cj0180" FT /product="biopolymer |