spacer

AltSplice - Mouse Release 3 (February 2006)

Introduction

The data in this release is generated for annotated genes from Ensembl 37.34e. The extracted nucleotide region includes the gene region as defined in Ensembl. Such a region is extended both at the 5' and 3' ends by 10000 bases. Mouse EST and mRNA (transcript) sequences are mapped to these extended gene regions. Transcript confirmed introns and exons are delineated from these alignments. The matching transcript sequences are further classified into groups in a manner that each of these groups represents an isoform splice pattern. Each group is represented by a transcript representative structure - called splice pattern. Isoform peptide sequences as expressed by the splice patterns have been delineated and are presented as part of the database.

Such isoform splice patterns are compared with one another to delineate the alternative events. Thus the presented data lists all the alternative splice events as seen in the observed transcripts for a gene. The basic events that are identified in this work are: exon isoforms (extension/truncation of an exon), cassette exons (an exon is present in one transcript but absent in an isoform of the transcript), alternating exons (exons are used in alternative transcripts in a mutually exclusive manner), and intron retention (a nucleotide region is used as an exon in a transcript while it is an intron in an alternative transcript). The latter three events (namely cassette exon, alternating exon, intron retention) are further characterised as 'complex' or 'simple' depending on whether the 5' or/and 3' flanking exons also undergo modifications (e.g. the flanking exon may be extended or truncated or the exon that flanks a retained intron is cassetted or alternated).

Introns/exons are annotated for splice signals such as strenth donor/acceptor sites, branch points, and polypyrimidine tracts. Conserved exons/introns/events in the orthologous genes from human and mouse have been identified and are annotated in the database. SNP positions and alleles used have been mapped to our data and we display them for isoform splice patterns as well as for individual events. We will carry out further work on this data towards annotating through various other features.

We have implemented, in this release, integration of AEdb with AltSplice (for both human and mouse entries). Entries that are common between AltSplice and AEdb are associated and are indicated so in the dispay pages that are resultant of queries to Altsplice and/or AEdb. Queries can be raised for common entries. AltSplice exons and splice events that have experimental evidence from AEdb are indicated so. In addition, we have built a wrapper that passes on queries to both the AEdb and AltSplice.

We have further implemented a SplicePatternViewer to visualise the isoform splice patterns. AltSplice data can also be seen from the geneview and contigview pages of Ensembl.

Documentation

Concise documentation of the procedure followed to produce this data and the naming conventions used is available in PDF format. The document is a work in progress and will be updated now and then to reflect now developments.

Statistics

Gene set
Start-up protein coding gene set after cleanup (Ensembl 37.34e) 24339  mouse genes
No. of genes with one or more confirmed intron/exon features 16020
Grand totals of genes, transcript sequences, transcript classes, and events
Genes 16020

EST/mRNA sequences


810689

   
Confirmed introns 161141

Confirmed exons

121441
   
Total number of transcript structures 800594
   
Genes with >1 splice pattern 12619
Genes with delineated events
8005
   
Total number of exon events 18436
Exon Isoform events 5078
Cassette exon events 9860
Alternating exon events 568
Intron retention events 2930
   
Intron Isoform events 9434
Total number of intron events 22792
Events per gene 2.8

Distribution statistics

Various distributions are located on the distribution statistics page (genes per classes, intron types, event types, length of retained introns and cassette exons, effective length change of exon isoforms).

 


Data files


In this release the following data files are available:


Copyright Notice
This ASD database has been generated within a research programme financed by the European Community1. ExonHit Therapeutics SA has been granted commercial exploitation rights to this database under the EU funded consortium, of which it is a member, and the database is protected by EC Directive2.

ExonHit currently holds an option to an exclusive license to the contents of the Alternative Splicing Database for commercial use including without limitation, providing services, and designing products (Commercial Rights). Consequently, such Commercial Rights are not currently available to anyone else. For up to date contact information for ExonHit Therapeutics SA, please see its website: www.exonhit.com.

The database is covered by paragraphs 2-17 of the EBI's normal terms of use, to be found at www.ebi.ac.uk/Information/termsofuse.html

By clicking the button below, or hyperlinking to pages beyond this notice, you indicate your agreement with these terms.

1. DIRECTIVE 96/9/EC OF THE EUROPEAN PARLIAMENT AND OF THE COUNCIL of 11 March 1996 on the legal protection of databases.

2. DIRECTIVE 96/9/EC OF THE EUROPEAN PARLIAMENT AND OF THE COUNCIL of 11 March 1996 on the legal protection of databases.

Examples and formats of the data files.

Gene file

The gene file has a standard FASTA format with a header, and a section right after the header that lists the sequence. The header will show the Ensembl gene identifier, and various flags. The important flag is the 'ext' flag which indicates how many bases we have added up- and downstream to the listed sequence.

Example:

>ENSMUSG00000053600 chrom: 17 strand: 1 orientation: same ext: 3000 map_start: 3001(local)=>31583594(ensembl) map_e
nd: 16219(local)=>31596813(ensembl)
GTGAGCTCTTCTGGAAGGTACAAGAACAAAAGAGATTTGTTTTCCTTTGTAAAAAATGAGAGGGTGAGTG
ACATTGGGGGTCTAAGAATGAATGTGACTCGCTGATTCTTTTTATCCTTTCTAGTTTTTGGACTTCTCTT
TCTTCTCCTTTCTTTCTCTCTTCTCTTCATTGCCCCCCAACCCCAGATGACAAAACTCAGTTGGAATACC

 
Reference transcript structure file

The reference transcript structure file lists the transcript structure from the Ensembl annotation that we chose to be the point of reference with regard to numbering the features and comparing the new features that we found. Each gene only has one reference transcript structure; in the file Ensembl gene ID, Ensembl Transcript ID, and the complete reference transcript structure are given. UFR and UDR features are added features by us that denote the upstream and downsteam flanking region that was added to the gene sequence.

Example:

>ENSMUSG00000053600     ENSMUST00000039132      UFR(1..3000 3000),e1(3001..3088 88),i1(3089..13073 9985),e2(13074..
13200 127),i2(13201..13386 186),e3(13387..13444 58),i3(13445..14318 874),e4(14319..16220 1902),DFR(16221..19220 300
0)

Transcript file

The transcript file lists all those EST's and mRNA's that were used in determining the individual introns and exons. Besides listing the transcript identifier and version, it also gives a pointer to the gene where it confirmed a feature, the description of the transcript, and the alignment as we found it.

Example:

AY195875.1      [ENSMUSG00000053600]    Mus musculus KRAB box containing zinc finger protein mRNA, complete cds.  g(13073..13200)e(34..161),g(13387..13444)e(162..219),g(14319..16157)e(220..2057)


Intron file

The file lists all the introns that were determined by matching the EST/mRNA's against the genes listed in the gene file.

Example:

>ENSMUSG00000053600 (3089..13073)
TYPE:   GT-AG
ELM:    i1(1..9985 9985)
NUMT:   18
FSDE:   ttcccggtgcctgttctgccgactgccgctcagtaggaagaacgcctggatgcatcagaagcaggaaatg
FSDI:   GTGAGTGTGCCCTGGACTCTTGGAAGGTGGGCGGAGGGTTCTGACACTGCCACGGCTTTGCTGTAAGGTG
FSAI:   CTATGCCCGAGACTATAGATCTCTTGTGTTTCCCACTATTCTTCCTGTAAATGTATGTGGATTCTTTTAG
FSAE:   gagccagtgacctttgaggatgtggctgtgaacttcactctaggagagtggactatgttggattccagtc
CNTX:   ~2973..3088,13074..13200,13387..13444,14319..~14352
BPPPT:  BP(-91,3.42), PPT(-51, -23), PPT(-9, -3)
SSIS:   10.76,7.68 (U12 -7.57)
END


The first line lists the Ensembl id and the start/end of the intron. TYPE indicates the type of the intron, which can be any of the three GT-AG, GC-AG, or AT-AC. ELM shows how this feature relates to the reference feature - in the above example the intron covers part of the upstream flanking region and the first exon. NUMT is the number of transcripts that confirmed this intron. FSDE and FSAE are the up- and downstream 70 bases into the flanking exons of this intron, respectively. FSDI and FSAI are the 70 bases intronic sequence on the donor and acceptor side of the intron, respectively.
The CNTX lines show in which context (read: isoform splice pattern) this intron was observed. BPPPT indicates the branchpoint position and scores and the polypyrimidine tract positions within the intron.

Exon file

The exon file lists all exons that were confirmed by the EST/mRNA's in the transcript file.

Example:

>ENSMUSG00000053600 (13074..13200)
TYPE:   GT-AG
ELM:    e2(1..127 127)
NUMT:   19
FSAI:   ctatgcccgagactatagatctcttgtgtttcccactattcttcctgtaaatgtatgtggattcttttag
FSAE:   GAGCCAGTGACCTTTGAGGATGTGGCTGTGAACTTCACTCTAGGAGAGTGGACTATGTTGGAT
FSDE:   TCCAGTCAAAAGAAGCTCTACAGAGATGTGATGAAGGAGACCTTTTTGAACCTGATCTCTATAG
FSDI:   gtaacaacaaaactactaagattcctttacttggatgacaacagttgtttcttgctcatctgtgtggttg
CNTX:   ~2973..3088,13074..13200,13387..13444,14319..~14352
CNTX:   ~3004..3088,8773..8885,13074..13200,13387..~13442
END


The first line lists the Ensembl id and the start/end of the exon. The second line gives the dinucleotides from the introns at the donor (3' end of exon) and acceptor (5' end of exon) sites. FSAI lists 70 bases of intronic sequence at the acceptor site. FSAE lists 70 bases of exonic sequence at the acceptor site. FSDE lists 70 bases of exonic sequence at the donor site. FSDI lists 70 bases of intronic sequence at the donor site. CNTX lines show in which context (read: isoform splice pattern) this exon was 
observed.


Splice pattern file

The different EST/mRNAs sequences that map to a gene are grouped into classes. The longest EST/mRNA sequence in each class is chosen as a representative. A class is  composed of all the EST/mRNAs confirming the same splice pattern. The region of overlapping between classes may contain different introns. If this happens, the respective classes represent alternative splice patterns. Classes that do not overlap with one another  represent different regions of the gene and do not represent alternative splice  patterns. Every EST/mRNA identifier is followed by the identifiers of the classes to which the sequence belong. It is possible, for non-representative EST/mRNAs, to belong to more than one class.

>ENSMUSG00000020604
CLASS 1
BC084731-1    ~2728..3498,30090..30277,34505..34552,38231..38342,40594..40731,46757..46953,48105..48185,60862..60970,70799..70919,76030..76120,85067..~86178
AK173082-1    ~3319..3498,30090..30277,34505..34552,38231..38342,40594..40731,46757..46953,48105..48185,60862..60970,70799..70919,76030..76120,85067..~86175
BC022158-1    ~30179..30277,34505..34552,38231..38342,40594..40731,46757..46953,48105..48185,60862..60970,70799..70919,76030..76120,85067..~86161
BE375165-1    ~30171..30277,34505..34552,38231..38342,40594..40731,46757..~46928
BI414565-1    ~34507..34552,38231..38342,40594..40731,46757..46953,48105..~48186
BU057653-1    ~48093..48185,60862..60970,70799..70919,76030..76120,85067..~85129
BQ887651-1    ~48093..48185,60862..60970,70799..70919,76030..76120,85067..~85383
BI331480-1    ~30180..30277,34505..34552,38231..38342,40594..~40731
CK626709-1,2    ~60876..60970,70799..70919,76030..76120,85067..~85380
AA798337-1,2,4    ~76035..76120,85067..~85294
AA823099-1,2,4    ~76068..76120,85067..~85445
CLASS 2
BC039629-2    ~56602..56676,60862..60970,70799..70919,76030..76120,85067..~86174
BI101709-2    ~56603..56676,60862..60970,70799..70919,76030..76120,85067..~85501
BY095625-2    ~56577..56676,60862..60970,70799..70919,76030..~76078
AI304194-2    ~56620..56676,60862..60970,70799..70919,76030..~76122
CLASS 3
BB652948-3    ~38178..38342,40594..40731,46757..46953,48105..~48186
CLASS 4
CA495201-4    ~56547..56676,60862..60970,76030..76120,85067..~85518

Splice pattern sequence file

This FASTA formatted file lists all the sequences of the observed splice patterns, together with the structure of the splice pattern.

Example (some sequence deleted for brevity):

>ENSMUSG00000053600 SP:1 STRUCTURE:~2973..3088,13074..13200,13387..13444,14319..~14352 KRIM1
ATATTTGAGTTCCGGGTAGCTGGAGGGAGGAGAGTTGTGCTTGAGCTTCCCGGTGCCTGTTCTGCCGACTGCCGCTCAGTAGGAAGAACGCCTGGATGCATCAGAAGCAGGAAAT
GGAGCCAGTGACCTTTGAGGATGTGGCTGTGAACTTCACTCTAGGAGAGTGGACTATGTTGGATTCCAGTCAAAAGAAGCTCTACAGAGATGTGATGAAGGAGACCTTTTTGAAC
CTGATCTCTATAGGGAAAACAGAAGAAGAAGATACTGAAGAAGAGTACCAAAATCCTAAGGGAAACCTGAGAACCCTGATGGTTGAGAGACTCTGTAAATATGAT


Peptide sequence file

This FASTA formatted file lists all the peptide sequences that could be derived from the observed splice patterns, together with indication of the splice pattern number (e.g. SP2; see events file) and a gene symbol if known.

Example (some sequence deleted for brevity):

>ALTS_MUS_PP:ENSMUSG00000000001_SP1_5928        GNAI3
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGESARADDARQLFVL
AGSAEEGVMTSELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVKTTGIVETHFTFKELYFKMFDVGGQRSERKKWIHCFEGVTA
IIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEVYTHFTCATDTK
NVQFVFDAVTDVIIKNNLKECGLY

Events file

The events file lists for every gene all the events that were observed among the transcript classes (see documentation). Every event is annotated with (i) the splice patterns of isoform transcript classes (from which the event is delineated); (ii) the different manipulations of the event as seen between all combinations of di-transcript classes; and (iii) the participating introns/exons in the event.

For each gene, the Ensembl identifier is given, followed by a listing of representatives of the transcript classes, any possible relation between the classes, and the grouped events themselves.

Example:

>ENSMUSG00000053600
Class 1         ~2973..3088,13074..13200,13387..13444,14319..~14352
Class 2         ~3004..3088,8773..8885,13074..13200,13387..~13442


Type    :       CASSETTE EXON (SCE)
Cassette exons: 8773..8885 [113 b]
Occurs in:       (2 & 1) is Complete SCE

(2 & 1)  SCE:
                        3089..8772,8886..13073 (introns)        <=>     3089..13073 (intron) [~-82]
                        e1 (~3004..3088)        <=>     e1' (~2973..3088) [31, 0]
                        e3 (13074..13200)       <=>     e3 (13074..13200) [0, 0]
                        1 Confirm. EST's        <=>     18 Confirm. EST's

TRPT-ISO1: ~3004..3088,8773..8885,13074..13200,13387..~13442
TRPT-ISO2: ~2973..3088,13074..13200,13387..13444,14319..~14352


Each event block consists of:

  • a basic type (e.g. EXON ISOFORM, CASSETTE EXON, etc) and a list of all detailed forms in which such a basic type exists
  • an event specific structure, e.g. location changes for an exon isoform, or a list of cassette exons.
  • for exon and intron isoforms a length change (donor/acceptor side and total)
  • between which transcript class combinations this event occurs, and exactly in which form. Exon isoforms can be part of another event (e.g. CCE complex cassette exon) as the flanking exons, part of none if they flank only an intron isoform, or part of unknown if the intron it flanks is not completely defined in the other transcript class.
  • a (grouped) list of flanking features and class combinations
  • a list of transcript isoforms, with the reference (isoform 1) pertaining to the left-hand side of the structure relationship (listed as part of the above flanking features or as part of the event specific structure in case of exon/intron isoforms).

A more detailed description of the events file and our naming conventions can be found in the documentation.

Events file

The events file lists for every gene all the events that were observed among the transcript classes (see documentation). Every event is annotated with (i) the splice patterns of isoform transcript classes (from which the event is delineated); (ii) the different manipulations of the event as seen between all combinations of di-transcript classes; and (iii) the participating introns/exons in the event.

For each gene, the Ensembl identifier is given, followed by a listing of representatives of the transcript classes, any possible relation between the classes, and the grouped events themselves.

Example:

>ENSG00000170312
Class 1 ~3122..3191,4664..4725,9228..9384,10187..10310,12583..12753,16413..16576,16671..~16804
Class 2 ~3016..3093,4664..4725,9228..9384,10187..10310,12583..12753,16413..~16454
Class 3 ~9226..9384,10187..10310,12583..12753,16413..16576,16671..16812,18400..~18527
Class 4 ~9226..9384,10187..10310,16413..16576,16671..16812,18400..~18491
Class 5 ~12194..12753,16413..~16450
Class 6 ~9336..9384,10187..~10405
Classes with staggered overlap + same structure : (3 & 1), (3 & 2)
Classes with staggered overlap only : (2 & 1), (4 & 1), (4 & 2), (4 & 3)

Type : INTRON ISOFORM (II-5P)
Struct : 3094..4663 (intron) <=> 3192..4663 (intron)
Length change: -98, 0 (-98)
Occurs in: (2 & 1)

(2 & 1) :
3094..4663 (intron) <=> 3192..4663 (intron)
e2 (4664..4725) <=> e2 (4664..4725) [0, 0]
23 Confirm. EST's <=> 4 Confirm. EST's

TRPT-ISO1: ~3016..3093,4664..4725,9228..9384,10187..10310,12583..12753,16413..~16454
TRPT-ISO2: ~3122..3191,4664..4725,9228..9384,10187..10310,12583..12753,16413..16576,16671..~16804

Type : CASSETTE EXON (SCE)
Cassette exons: 12583..12753 [171 b]
Occurs in: (4 & 2) is Complete SCE, (4 & 1) is Complete SCE, (4 & 3) is Complete SCE

(4 & 2) (4 & 1) (4 & 3) :
10311..16412 (intron) <=> 10311..12582,12754..16412 (introns)
e1 (10187..10310) <=> e1 (10187..10310) [0, 0]
e2 (16413..16576) <=> e2'' (16413..~16454) [0, -122]
3 Confirm. EST's <=> 27 Confirm. EST's


TRPT-ISO1: ~9226..9384,10187..10310,16413..16576,16671..16812,18400..~18491
TRPT-ISO2: ~3122..3191,4664..4725,9228..9384,10187..10310,12583..12753,16413..16576,16671..~16804
TRPT-ISO2: ~3016..3093,4664..4725,9228..9384,10187..10310,12583..12753,16413..~16454
TRPT-ISO2: ~9226..9384,10187..10310,12583..12753,16413..16576,16671..16812,18400..~18527


Each event block consists of:

  • a basic type (e.g. EXON ISOFORM, CASSETTE EXON, etc) and a list of all detailed forms in which such a basic type exists
  • an event specific structure, e.g. location changes for an exon isoform, or a list of cassette exons.
  • for exon and intron isoforms a length change (donor/acceptor side and total)
  • between which transcript class combinations this event occurs, and exactly in which form. Exon isoforms can be part of another event (e.g. CCE complex cassette exon) as the flanking exons, part of none if they flank only an intron isoform, or part of unknown if the intron it flanks is not completely defined in the other transcript class.
  • a (grouped) list of flanking features and class combinations
  • a list of transcript isoforms, with the reference (isoform 1) pertaining to the left-hand side of the structure relationship (listed as part of the above flanking features or as part of the event specific structure in case of exon/intron isoforms).

A more detailed description of the events file and our naming conventions can be found in the documentation.

spacer
spacer