P-FPMI-115 - P-FPMI-115

Type
specified_biomaterial_action
Description
The cationic peptide, human LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFFRNLVPRTES), was synthesized using F-moc chemistry at the Nucleic Acid/Protein Synthesis Unit, University of British Columbia (Vancouver, BC, Canada). The synthetic peptide was re-suspended in endotoxin-free water and stored at -20 degree Celsius until further use. Primed THP-1 cells were stimulated with LL-37 (5 ug/ml) for 4 hours.
Links
Experiment E-FPMI-6