![]() |
Table of Contents
SOAPpyInstallationThe SOAPpy module can be installed by:
Note: SOAPpy depends on the following modules, which also need to be installed:
For an overview of how to install a module see Installing Python Modules. Accessing a ServiceThere are two ways to use SOAPpy to access a SOAP Web Service:
Dynamic Interface from a WSDLSOAPpy provides a simple interface to services which provide a WSDL description. For example using the WSDbfetch service (examples/SOAP/SOAPpy/dbfetch_soaplite.py): # Import SOAPpy WSDL package. from SOAPpy import WSDL # WSDbfetch WSDL URL. wsdlUrl = 'http://www.ebi.ac.uk/ws/services/WSDbfetch?wsdl'; # Default option values. query = 'uniprot:wap_rat' format = 'fasta' style = 'raw' # Create a service proxy from the WSDL. dbfetchSrv = WSDL.Proxy(wsdlUrl) # Perform the query. result = dbfetchSrv.fetchData(query, format, style) # Output the result. print result Direct SOAP CallsIf a WSDL is not available for the Web Service, then direct calls can be made to the service using the call method. For example using WSDbfetch by performing direct calls (examples/SOAP/SOAPpy/dbfetch_soappy_call.pl): # Import SOAPpy WSDL package. from SOAPpy import SOAPProxy # WSDbfetch endpoint URL. endpointUrl = 'http://www.ebi.ac.uk/ws/services/WSDbfetch'; # WSDbfetch XML namespace. xmlNamespace = 'http://www.ebi.ac.uk/ws/services/WSDbfetch' # Default option values. query = 'uniprot:wap_rat' format = 'fasta' style = 'raw' # Create a service interface. dbfetchSrv = SOAPProxy(endpointUrl, namespace=xmlNamespace) # Perform the query. result = dbfetchSrv.fetchData(query, format, style) # Output the result. print result Complex Data Structures
The methods in the WSDbfetch all use simple string parameters. Many of the other EBI services use more complex input structures. For example WSWUBlast requires a structure containing the various parameters and the input sequence to be passed to the # Import WSDL package from SOAPpy import WSDL # Create service interface wsdlUrl = 'http://www.ebi.ac.uk/Tools/webservices/wsdl/WSWUBlast.wsdl' server = WSDL.Proxy(wsdlUrl) # Query sequence seq = """>Q8E5Q5_STRA3 MKLSKRYRFWQKVIKALGVLALIATLVLVVYLYKLGILNDSNELKDLVHKYEFWGPMIFI VAQIVQIVFPVIPGGVTTVAGFLIFGPTLGFIYNYIGIIIGSVILFWLVKFYGRKFVLLF MDQKTFDKYESKLETSGYEKFFIFCMASPISPADIMVMITGLSNMSIKRFVTIIMITKPI SIIGYSYLWIYGGDILKNFLN""" # Structure containing parameters blast_params = { 'program':'blastp', # Protein vs. protein search 'database':'swissprot', # Database to search 'email':'your@email', # User e-mail address 'async':1 # Async submission } # Structure containing the sequence data blast_data = [{'type':'sequence', 'content':seq}] # Submit the job to the service passing the data structures jobId = server.runWUBlast(params=blast_params,content=blast_data) print jobId
The # Poll till job finishes status = 'PENDING' while status == 'RUNNING' or status == 'PENDING': status = server.checkStatus(jobId) print status if status == 'RUNNING' or status == 'PENDING': time.sleep(15) # Get the result result = server.poll(jobId, 'tooloutput') print result SOAP Message TraceIt is useful when debugging a client to be able to see the actual SOAP messages exchanged. SOAPpy provides a trace option which can be used to enable output of these messages: server = WSDL.Proxy(wsdlUrl) server.soapproxy.config.dumpSOAPOut = 1 server.soapproxy.config.dumpSOAPIn = 1
Alternatively the underlying HTTP library import httplib httplib.HTTPConnection.debuglevel = 1 SOAP FaultsSOAPpy maps SOAP faults into Python exceptions which can be handled in the usual way: try: # Perform the query. result = dbfetchSrv.fetchData(query, format, style) # Output the result. print result except SOAPpy.Types.faultType, ex: print ex ProxiesIn some environments it is necessary to configure a proxy before a client can connect to external services. To use a HTTP proxy with SOAPpy: server = WSDL.Proxy(wsdlUrl) # Configure an HTTP proxy server.soapproxy.http_proxy = 'proxy.example.com:8080'
To support the use of the server = WSDL.Proxy(wsdlUrl) # Configure HTTP proxy from OS environment (e.g. http_proxy="http://proxy.example.com:8080") if os.environ.has_key('http_proxy'): http_proxy_conf = os.environ['http_proxy'].replace('http://', '') elif os.environ.has_key('HTTP_PROXY'): http_proxy_conf = os.environ['HTTP_PROXY'].replace('http://', '') else: http_proxy_conf = None server.soapproxy.http_proxy = http_proxy_conf User-Agent
HTTP clients usually provide information about what they are, this allows services to handle specific clients differently if necessary, and gives service providers information about how their services are being used. By default SOAPpy sets the HTTP User-Agent header (see RFC2616 section 14.43) to something like # Modify the user-agent to add a more specific prefix (see RFC2616 section 14.43) import SOAPpy import os # User-agent string to use: # Example-Client/1.0 (Linux) SOAPpy 0.12.0 (pywebsvcs.sf.net) userAgent = 'Example-Client/1.0 (' + os.uname()[0] + ') ' + SOAPpy.Client.SOAPUserAgent() # Function to return User-agent. def SOAPUserAgent(): return userAgent # Redefine default User-agent function to return custom User-agent. SOAPpy.Client.SOAPUserAgent = SOAPUserAgent Sample ClientsMost SOAP Web Services at EMBL-EBI have sample clients which provide command-line access to the service and example code. For Python some of the clients are based on SOAPpy. Document/literal SOAP
RPC/encoded SOAP
Further Reading![]() |