![]() |
Table of Contents
Apache AxisIntroductionApache Axis 1) is an implementation of the SOAP 2) submission to W3C 3) and follows-on from the Apache SOAP project. Apache Axis is an implementation of the JAX-RPC standard 4). An important feature of Apache Axis is support for both RPC/encoded and Document/literal style SOAP services and the inclusion of a WSDL to Java code generator supporting both styles. Please note: Apache Axis2 5) is not the version of Apache Axis described here. InstallationApache Axis 1.x is available for download from: http://ws.apache.org/axis/ Apache IvyIf using Apache Ivy 6) the following dependency declarations can be used: <!-- Apache Axis 1.x --> <dependency org="commons-logging" name="commons-logging" rev="1.1.1" /> <dependency org="wsdl4j" name="wsdl4j" rev="1.6.2" /> <dependency org="commons-discovery" name="commons-discovery" rev="0.2" /> <dependency org="org.apache.axis" name="axis" rev="1.4" /> <dependency org="org.apache.axis" name="axis-jaxrpc" rev="1.4" /> Apache MavenIf using Apache Maven 7) the following dependency declarations can be used: <dependency> <groupId>commons-logging</groupId> <artifactId>commons-logging</artifactId> <version>1.1.1</version> <scope>compile</scope> </dependency> <dependency> <groupId>axis</groupId> <artifactId>axis</artifactId> <version>1.4</version> <scope>compile</scope> </dependency> <dependency> <groupId>org.apache.axis</groupId> <artifactId>axis-jaxrpc</artifactId> <version>1.4</version> <scope>compile</scope> </dependency> <dependency> <groupId>org.apache.axis</groupId> <artifactId>axis-saaj</artifactId> <version>1.4</version> <scope>compile</scope> </dependency> <dependency> <groupId>axis</groupId> <artifactId>axis-wsdl4j</artifactId> <version>1.5.1</version> <scope>compile</scope> </dependency> <dependency> <groupId>commons-discovery</groupId> <artifactId>commons-discovery</artifactId> <version>0.4</version> <scope>compile</scope> </dependency> EMBL-EBI Sample Client Dependencies
For the Apache Axis 1.x based sample clients we provide an archive containing all the required dependencies:
This includes the development tools and can be used via the java -Djava.ext.dirs=lib -jar WSDbfetch_Axis1.jar Creating Stubs Using WSDL2Java
The Axis WSDL2Java tool generates client classes representing the service interface from a WSDL interface definition. By default the generated For details of the WSDL documents available for EBI Web Services see the service page for the service of interest. Note: the stubs generated by Axis WSDL2Java are version specific. If you want to use a different version of Axis with the sample clients, you will have to regenerate and recompile the stubs. Command-lineGenerate stubs from a WSDL, in this case for WSDbfetch: java org.apache.axis.wsdl.WSDL2Java http://www.ebi.ac.uk/ws/services/WSDbfetch?wsdl
To force the stubs into the java org.apache.axis.wsdl.WSDL2Java -p uk.ac.ebi.webservices.wsdbfetch http://www.ebi.ac.uk/ws/services/WSDbfetch?wsdl
Apache ant: generic taskTo build stubs using the Apache ant 8) build tool, without having to install additional tasks, a generic target can be defined which generates code stubs from a WSDL document: <!-- Generate Axis 1.x stubs from a WSDL --> <target name="genAxis1Stubs" description="Axis 1.x: generate stubs from a WSDL using WSDL2Java class"> <echo message="${stubPkg}" /> <echo message="${wsdlUrl}" /> <java classname="org.apache.axis.wsdl.WSDL2Java" classpathref="classpath" fork="yes" dir="${src.dir}"> <arg value="-p" /> <arg value="${stubPkg}" /> <arg value="${wsdlUrl}" /> </java> </target> This assumes that the org.apache.axis.wsdl.WSDL2Java class in available in the classpath.
The <!-- Generate Axis 1.x stubs for WSDbfetch --> <target name="axis1-stubs-wsdbfetch" description="Axis 1.x: generate stubs for WSDbfetch"> <antcall target="genAxis1Stubs"> <param name="stubPkg" value="uk.ac.ebi.webservices.axis1.stubs.wsdbfetch" /> <param name="wsdlUrl" value="http://www.ebi.ac.uk/ws/services/WSDbfetch?wsdl" /> </antcall> </target> The target can then be referenced when invoking ant to generate the stubs: ant axis1-stubs-wsdbfetch
An Apache ant Exercise 1: Generate the service stubs.
Examine the Apache ant build file (
To run the tasks described in the ant build file in Eclipse right-click on the To build the Apache Axis examples we need to run two targets:
To run these in Eclipse:
To run these targets from the command-line: ant axis1-stubs ant axis1-compile Apache ant: Axis-wsdl2java taskApache ant allows the addition of specific tasks via a plug-in mechanism. The Axis-wsdl2java task (http://ws.apache.org/axis/java/ant/axis-wsdl2java.html) supports the generation of Axis stubs from a WSDL document and, if installed, can be used as an alternative to the generic task above. Apache mavenA Maven plug-in is also available to generate Axis code stubs from a WSDL document, see http://maven-plugins.sourceforge.net/maven-axis-plugin/index.html for details. Using the StubsThe stubs generated by Axis WSDL2Java are direct mappings of the interface and data types described in the WSDL into their Java equivalents. You may find looking at the generated code, WSDbfetch service documentation and http://www.ebi.ac.uk/ws/services/WSDbfetch?wsdl useful in the following section.
Import the generated classes into the program (assuming the import uk.ac.ebi.webservices.wsdbfetch.*; To create a service proxy, with which you can interact with the service: WSDBFetchServerService service = new WSDBFetchServerServiceLocator(); WSDBFetchServer srvProxy = service.getWSDbfetch();
The methods of the service proxy ( String result = srvProxy.fetchData("UNIPROT:ADH1A_HUMAN", "default", "raw");
The System.out.println(result); Then compile in the usual way:
And then run the program, to check it works:
Exercise 2: WSDbfetch (SOAP)The WSDbfetch web service (http://www.ebi.ac.uk/Tools/webservices/services/dbfetch) provides the same basic functionality as dbfetch, but through a collection of SOAP interfaces. Using the example WSDbfetch client (examples/soap/axis1/Dbfetch.java) as a guide, use the service to fetch the UniProtKB entries with the accessions: P13569, P26361 and P35071, in fasta sequence format. Sample solution: solutions/soap/axis1/Q4Dbfetch.java Exercise 3: WSDbfetch meta-dataThe WSDbfetch service includes a number of meta-data methods which provide information about the service such as the names of the databases available, and the formats and styles which can be used with each database (see http://www.ebi.ac.uk/Tools/webservices/services/dbfetch).
Starting from the example client (examples/soap/axis1/Dbfetch.java), use the Sample solution: solutions/soap/axis1/Q5Dbfetch.java Complex Data Structures
The methods in the WSDbfetch service all use simple string parameters. Many of the other EBI services use more complex input structures. For example NCBI BLAST (SOAP) requires a structure containing the various parameters and the input sequence to be passed to the // Populate input parameters structure InputParameters params = new InputParameters(); params.setProgram("blastp"); String[] databaseList = { "uniprotkb_swissprot" }; params.setDatabase(databaseList); params.setStype("protein"); params.setSequence(">Seq1 Example search sequence\n" + "MKFLILLFNILCLFPVLAADNHGVGPQGASGVDPITFDINSNQTGPAFLTAVEMAGV"); String email = "email@example.org"; // Your e-mail address // Get the NCBI BLAST (SOAP) service proxy JDispatcherService_Service service = new JDispatcherService_ServiceLocator(); JDispatcherService_PortType ncbiblast = service.getJDispatcherServiceHttpPort(); // Submit the job String jobid = ncbiblast.run(email, "", params); System.out.println("Job Id: " + jobid);
The // Poll until job has finished String status = "RUNNING"; while (status.equals("RUNNING")) { Thread.sleep(3000); // Wait 3 seconds status = ncbiblast.getStatus(jobid); // check job status System.out.println(status); } // If the job completed successfully... if (status.equals("FINISHED")) { // Get the text result byte[] resultbytes = ncbiblast.getResult(jobid, "out", null); String result = new String(resultbytes); // Output the result System.out.println(result); } Exercise 4: NCBI BLAST (SOAP)So far all the services we have looked at have been able to return the result in a relatively short period of time. This is not the case when running analytical tools, which in extreme cases may take days to return a result. So for these tools asynchronous methods have to be used, where the submission returns a job identifier which can be then used to check on the status of the job, and once it completes retrieve the results. The NCBI BLAST (SOAP) service, uses the NCBI BLAST suite to perform a sequence similarity search requires this approach. Examine the example client (examples/soap/axis1/NcbiBlastSoap.java) and note the “run”, “getStatus” and “getResult” work flow.
Using the example client as a guide, perform an NCBI BLAST search with UniProtKB CFTR_MOUSE ( Sample solution: solutions/soap/axis1/Q8NcbiBlastSoap.java Exercise 5: NCBI BLAST (SOAP) meta-data
The NCBI BLAST (SOAP) service can return the result in a number of formats, modify your client to use the Sample solution: solutions/soap/axis1/Q9NcbiBlastSoap.java ProxiesIn some environments it is necessary to configure an HTTP proxy before a client can connect to external services. Apache Axis supports the normal Java mechanisms for the configuration of proxies:
For details and examples see:
User-Agent
HTTP clients usually provide information about what they are, allowing services to handle specific clients differently if necessary, and giving service providers some information about how their services are being used. By default Apache Axis sets the HTTP User-Agent header (see RFC2616 section 14.43) to something like
The user-agent string is set in the Service End-point and NamespaceIn cases where access is required to alternative instance of the web service, the end-point address for the service will need to be modified. In Apache Axis these can be overridden when getting the service proxy object by specifying the required end-point address: String srvEndpoint = "http://wwwdev.ebi.ac.uk/ws/services/WSDbfetchDoclit"; WSDBFetchDoclitServerService service = new WSDBFetchDoclitServerServiceLocator(); WSDBFetchServer srvProxy = service.getWSDbfetchDoclit(new java.net.URL(srvEndpoint)); Sample ClientsMost SOAP Web Services at EMBL-EBI have sample clients which provide command-line access to the service and example code. For Java some of the clients are based on Apache Axis 1.x. Document/literal SOAP
RPC/encoded SOAP
1)
Apache Axis - http://ws.apache.org/axis/
2)
SOAP - http://www.w3.org/TR/soap/
3)
W3C - http://www.w3.org/
4)
JAX-RPC - http://jcp.org/en/jsr/detail?id=101
5)
Apache Axis2/Java - http://axis.apache.org/axis2/java/core/
6)
Apache Ivy - http://ant.apache.org/ivy/
7)
Apache Maven - http://maven.apache.org/
8)
Apache ant - http://ant.apache.org/
![]() |