Dbfetch

ID   X84793; SV 1; linear; genomic DNA; STD; PRO; 2147 BP.
XX
AC   X84793;
XX
DT   12-AUG-1997 (Rel. 52, Created)
DT   12-AUG-1997 (Rel. 52, Last updated, Version 9)
XX
DE   S.pyogenes sda gene
XX
KW   DNase; sda gene.
XX
OS   Streptococcus pyogenes
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
RN   [2]
RP   1-2147
RA   Podbeilski A.;
RT   ;
RL   Submitted (16-FEB-1995) to the INSDC.
RL   A. Podbielski, Institut f. Med. Mikrobiologie, an der Rhein.-Westf. Techn.
RL   Hochschule, Aachen, Pauwelsstr. Klinikum, 52057 Aachen, FRG
XX
RN   [4]
RP   1-2147
RX   PUBMED; 8945587.
RA   Podbielski A., Zarges I., Flosdorff A., Weber-Heynemann J.;
RT   "Molecular characterization of a major serotype M49 group A streptococcal
RT   DNase gene (sdaD)";
RL   Infect Immun 64(12):5349-5356(1996).
XX
DR   MD5; 37237dca93809c80630efe67998cd491.
DR   EuropePMC; PMC97958; 11159974.
XX
CC   Related sequences: X17241 and S65020
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2147
FT                   /organism="Streptococcus pyogenes"
FT                   /strain="serotype M49"
FT                   /isolate="CS101"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1314"
FT   regulatory      295..299
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             308..1465
FT                   /transl_table=11
FT                   /gene="sda"
FT                   /product="streptodornase"
FT                   /db_xref="GOA:O33735"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="UniProtKB/TrEMBL:O33735"
FT                   /protein_id="CAA59264.1"
FT                   /translation="MSKHWRHLIIHSALTILATLFLGILPITENTSSTIYAESATISNN
FT                   WSIEQHPNYYHVEGKAQLDIKNFPELYRTTERVYKKSGQSTKPVTVSNIHYSVLDGYGR
FT                   SGEAYGIITKDMIDMSAGYREKWESKPEPSGWYSYFFKNTNQRATESDYKHSPKNVSKI
FT                   SNNIKASILLSNGNVRNGYLFDRSHLIADSLGGRPFRNNLITGTRTQNVGNNDRKGGMQ
FT                   YIENKVLDHIKRNPKVHVYYKATPVYQGSELLPRAVLVSALSSDGFIDETVRVFNNVAG
FT                   FNIDYQNGGLLTESPVTETDNVEENVEDNIETIEDEVDTDTLKKDDENISLQKTVYVAS
FT                   SGLSNVYWYSKENMPKNVNLDKVVEMSEQTALARGKHHSAQEALE"
XX
SQ   Sequence 2147 BP; 749 A; 354 C; 369 G; 675 T; 0 other;
     gatcataact gtgtctcctg tgatatatcc gccatcgatt gcttgcttaa attcgccgta        60
     tgttagcata aagcacctcc ttatcttatt attcgtattt cacaggaaat aatataatta       120
     aatttaaagc ttatttaaaa ttaaataaca tctattttat gacaaactaa cttattaact       180
     attgacgaat attagataaa aagaaaattt agtatgctgt tagttataaa gtaattttat       240
     taatttcata tttttttaat ttaaaatggt atacttaatc tgtaaataac aaaaggagga       300
     catggatatg tctaaacatt ggagacatct aattattcac tctgctctga ccattctagc       360
     tacgttattt ttaggtatac taccaattac tgaaaatact agtagtacca tttacgctga       420
     atcggccact atttcaaata attggagtat cgagcaacac cccaattatt accatgttga       480
     aggtaaagcg caactggata ttaaaaattt tcccgaactt tatcgtacaa ccgaaagggt       540
     ctataagaaa agtgggcaaa gtactaaacc tgttacagtt tccaatatcc attactctgt       600
     acttgatggc tatggccgtt ctggagaagc ttatggtatt atcacaaaag atatgattga       660
     catgtctgct ggctatcgtg aaaaatggga aagcaaacca gagccaagtg ggtggtattc       720
     ttatttcttc aaaaatacta accagagagc cactgaatcc gactacaagc atagccccaa       780
     aaatgtgagt aagatttcga acaatatcaa agctagtatt ctcttaagta acggaaatgt       840
     tcgtaacggc tacctgtttg atagaagtca tttaatagcc gatagcttag gaggaagacc       900
     ttttagaaat aatttgatta cgggtacccg cacccaaaac gtaggtaata atgatcgtaa       960
     aggtgggatg cagtatattg aaaataaagt tttagatcac attaaaagaa atcctaaagt      1020
     ccatgtttac tataaagcaa ctcctgtata tcaaggatcc gaattgctac ctagagcagt      1080
     tttagtgtct gctttatcat ctgatggatt tattgacgag acagttcgtg tgtttaataa      1140
     tgtagcaggt tttaatattg attaccaaaa cggtggtctt ttaacagaga gccctgtaac      1200
     tgaaactgat aatgttgaag aaaatgtgga agataacatt gaaactattg aagatgaagt      1260
     tgacactgat acactaaaaa aagatgatga aaatatctct ttacaaaaaa ctgtatacgt      1320
     agcaagcagt gggctgtcta atgtatattg gtacagcaaa gaaaatatgc caaaaaatgt      1380
     aaatttagac aaagtcgtgg aaatgagtga acaaaccgct ttagctagag gtaagcatca      1440
     ttctgcacaa gaagctttag aataacagcc ttaacagacc aacaatgctc ggttggtctg      1500
     tttttttagc aagcaaaaag cccagccgca tgggctggga aaaatagctt ttatattttc      1560
     atggatgata actacatatt agcacacaac aaataaaaaa gcaagagccg ctagtgtcag      1620
     gcagttcttg ctaaaaattt ctattttttt gaatttgtaa aagcagtgca ctttattcca      1680
     ttaatcattg ccttaacaga atcataatct ttaaaaccta aaagctttgc cctactgtca      1740
     tcttctttac gaagagcctt caaactagac tgtatttttc tccattgata tttggagtta      1800
     atagtattta cgagatagac gacaatagca ataataacgg ataacttatt agaaggttta      1860
     gtcacgttat gtttaatttt tactgtatca agataatttc tccattctgg aacggaagtt      1920
     taggcttttg ttgtgatttg aatatccagt acatttgaat tatgagcaca tacatttctt      1980
     atgaaattca aacatttaag ccacgaaaca agttcttctg gtgtacaact gtaatattga      2040
     caaatctgtt taatattctt ctcgctcatg attgttaaga ttgaaacgat gtcaccaaac      2100
     atcaataaat caatagcaag ccacactgtt gggaatccat ctggatc                    2147
//