Dbfetch

ID   K03455; SV 1; linear; genomic RNA; STD; VRL; 9719 BP.
XX
AC   K03455; M38432;
XX
DT   09-MAR-1987 (Rel. 11, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 18)
XX
DE   Human immunodeficiency virus type 1 (HXB2), complete genome;
DE   HIV1/HTLV-III/LAV reference genome.
XX
KW   acquired immune deficiency syndrome; complete genome; env protein;
KW   gag protein; long terminal repeat (LTR); pol protein; polyprotein;
KW   proviral gene; reverse transcriptase; TAR protein; transactivator.
XX
OS   Human immunodeficiency virus 1
OC   Viruses; Retro-transcribing viruses; Retroviridae; Orthoretrovirinae;
OC   Lentivirus; Primate lentivirus group.
XX
RN   [1]
RP   493-674,9577-9718
RX   DOI; 10.1038/313277a0.
RX   PUBMED; 2578615.
RA   Ratner L., Haseltine W., Patarca R., Livak K.J., Starcich B., Josephs S.F.,
RA   Doran E.R., Rafalski J.A., Whitehorn E.A., Baumeister K., Ivanoff L.,
RA   Petteway S.R.Jr., Pearson M.L., Lautenberger J.A., Papas T.S., Ghrayeb J.,
RA   Chang N.T., Gallo R.C., Wong-Staal F.;
RT   "Complete nucleotide sequence of the AIDS virus, HTLV-III";
RL   Nature 313(6000):277-284(1985).
XX
RN   [2]
RP   1-653
RX   DOI; 10.1126/science.2981438.
RX   PUBMED; 2981438.
RA   Starcich B., Ratner L., Josephs S.F., Okamoto T., Gallo R.C.,
RA   Wong-Staal F.;
RT   "Characterization of long terminal repeat sequences of HTLV-III";
RL   Science, e1252229 227(4686):538-540(1985).
XX
RN   [3]
RA   van Beveren C.P., Coffin J., Hughes S.;
RT   "Appendix B: HTLV-3/LAV genome";
RL   (in) Weiss R.L., Teich N., Varmus H., Coffin J. (Eds.);
RL   RNA TUMOR VIRUSES, SECOND EDITION, 2, Vol. 2:1102-1123;
RL   Cold Spring Harbor Laboratory, Cold Spring Harbor (1985)
XX
RN   [4]
RX   DOI; 10.1126/science.2986290.
RX   PUBMED; 2986290.
RA   Allan J.S., Coligan J.E., Barin F., McLane M.F., Sodroski J.G., Rosen C.A.,
RA   Haseltine W.A., Lee T.H., Essex M.;
RT   "Major glycoprotein antigens that induce antibodies in AIDS patients are
RT   encoded by HTLV-III";
RL   Science, e1252229 228(4703):1091-1094(1985).
XX
RN   [5]
RX   DOI; 10.1016/S0092-8674(85)80062-3.
RX   PUBMED; 2988790.
RA   Rosen C.A., Sodroski J.G., Haseltine W.A.;
RT   "The location of cis-acting regulatory sequences in the human T cell
RT   lymphotropic virus type III (HTLV-III/LAV) long terminal repeat";
RL   Cell 41(3):813-823(1985).
XX
RN   [6]
RX   DOI; 10.1126/science.2990040.
RX   PUBMED; 2990040.
RA   Arya S.K., Guo C., Josephs S.F., Wong-Staal F.;
RT   "Trans-activator gene of human T-lymphotropic virus type III (HTLV-III)";
RL   Science, e1252229 229(4708):69-73(1985).
XX
RN   [7]
RX   DOI; 10.1126/science.2990041.
RX   PUBMED; 2990041.
RA   Sodroski J., Patarca R., Rosen C., Wong-Staal F., Haseltine W.;
RT   "Location of the trans-activating region on the genome of human T-cell
RT   lymphotropic virus type III";
RL   Science, e1252229 229(4708):74-77(1985).
XX
RN   [8]
RX   DOI; 10.1126/science.2994220.
RX   PUBMED; 2994220.
RA   Rabson A.B., Daugherty D.F., Venkatesan S., Boulukos K.E., Benn S.I.,
RA   Folks T.M., Feorino P., Martin M.A.;
RT   "Transcription of novel open reading frames of AIDS retrovirus during
RT   infection of lymphocytes";
RL   Science, e1252229 229(4720):1388-1390(1985).
XX
RN   [9]
RX   DOI; 10.1126/science.2997921.
RX   PUBMED; 2997921.
RA   Allan J.S., Coligan J.E., Lee T.H., McLane M.F., Kanki P.J., Groopman J.E.,
RA   Essex M.;
RT   "A new HTLV-III/LAV encoded antigen detected by antibodies from AIDS
RT   patients";
RL   Science, e1252229 230(4727):810-813(1985).
XX
RN   [10]
RX   DOI; 10.1038/319555a0.
RX   PUBMED; 3003584.
RA   Rosen C.A., Sodroski J.G., Goh W.C., Dayton A.I., Lippke J.,
RA   Haseltine W.A.;
RT   "Post-transcriptional regulation accounts for the trans-activation of the
RT   human T-lymphotropic virus type III";
RL   Nature 319(6054):555-559(1986).
XX
RN   [11]
RX   DOI; 10.1126/science.2418504.
RX   PUBMED; 2418504.
RA   di Marzo Veronese F., Copeland T.D., DeVico A.L., Rahman R., Oroszlan S.,
RA   Gallo R.C., Sarngadharan M.G.;
RT   "Characterization of highly immunogenic p66/p51 as the reverse
RT   transcriptase of HTLV-III/LAV";
RL   Science, e1252229 231(4743):1289-1291(1986).
XX
RN   [12]
RX   DOI; 10.1126/science.2420008.
RX   PUBMED; 2420008.
RA   Kramer R.A., Schaber M.D., Skalka A.M., Ganguly K., Wong-Staal F.,
RA   Reddy E.P.;
RT   "HTLV-III gag protein is processed in yeast cells by the virus
RT   pol-protease";
RL   Science, e1252229 231(4745):1580-1584(1986).
XX
RN   [13]
RX   DOI; 10.1016/0092-8674(86)90017-6.
RX   PUBMED; 2420471.
RA   Dayton A.I., Sodroski J.G., Rosen C.A., Goh W.C., Haseltine W.A.;
RT   "The trans-activator gene of the human T cell lymphotropic virus type III
RT   is required for replication";
RL   Cell 44(6):941-947(1986).
XX
RN   [14]
RX   DOI; 10.1126/science.3006243.
RX   PUBMED; 3006243.
RA   Lee T.H., Coligan J.E., Allan J.S., McLane M.F., Groopman J.E., Essex M.;
RT   "A new HTLV-III/LAV protein encoded by a gene found in cytopathic
RT   retroviruses";
RL   Science, e1252229 231(4745):1546-1549(1986).
XX
RN   [15]
RX   DOI; 10.1126/science.3006244.
RX   PUBMED; 3006244.
RA   Sodroski J., Goh W.C., Rosen C., Tartar A., Portetelle D., Burny A.,
RA   Haseltine W.;
RT   "Replicative and cytopathic potential of HTLV-III/LAV with sor gene
RT   deletions";
RL   Science, e1252229 231(4745):1549-1553(1986).
XX
RN   [16]
RX   DOI; 10.1126/science.3006245.
RX   PUBMED; 3006245.
RA   Kan N.C., Franchini G., Wong-Staal F., DuBois G.C., Robey W.G.,
RA   Lautenberger J.A., Papas T.S.;
RT   "Identification of HTLV-III/LAV sor gene product and detection of
RT   antibodies in human sera";
RL   Science, e1252229 231(4745):1553-1555(1986).
XX
RN   [17]
RX   DOI; 10.1073/pnas.83.7.2209.
RX   PUBMED; 3008154.
RA   Arya S.K., Gallo R.C.;
RT   "Three novel genes of human T-lymphotropic virus type III: immune
RT   reactivity of their products with sera from acquired immune deficiency
RT   syndrome patients";
RL   Proc. Natl. Acad. Sci. U.S.A. 83(7):2209-2213(1986).
XX
RN   [18]
RX   DOI; 10.1126/science.3008338.
RX   PUBMED; 3008338.
RA   Jones K.A., Kadonaga J.T., Luciw P.A., Tjian R.;
RT   "Activation of the AIDS retrovirus promoter by the cellular transcription
RT   factor, Sp1";
RL   Science, e1252229 232(4751):755-759(1986).
XX
RN   [19]
RX   DOI; 10.1038/321412a0.
RX   PUBMED; 3012355.
RA   Sodroski J., Goh W.C., Rosen C., Dayton A., Terwilliger E., Haseltine W.;
RT   "A second post-transcriptional trans-activator gene required for HTLV-III
RT   replication";
RL   Nature 321(6068):412-417(1986).
XX
RN   [20]
RX   DOI; 10.1016/0092-8674(86)90778-6.
RX   PUBMED; 2423250.
RA   Starcich B.R., Hahn B.H., Shaw G.M., McNeely P.D., Modrow S., Wolf H.,
RA   Parks E.S., Parks W.P., Josephs S.F., Gallo R.C., Wong-Staal F.;
RT   "Identification and characterization of conserved and variable regions in
RT   the envelope gene of HTLV-III/LAV, the retrovirus of AIDS";
RL   Cell 45(5):637-648(1986).
XX
RN   [21]
RX   DOI; 10.1073/pnas.83.14.5038.
RX   PUBMED; 3014529.
RA   Willey R.L., Rutledge R.A., Dias S., Folks T., Theodore T., Buckler C.E.,
RA   Martin M.A.;
RT   "Identification of conserved and divergent domains within the envelope gene
RT   of the acquired immunodeficiency syndrome retrovirus";
RL   Proc. Natl. Acad. Sci. U.S.A. 83(14):5038-5042(1986).
XX
RN   [22]
RP   8761-9060
RX   DOI; 10.1126/science.3014663.
RX   PUBMED; 3014663.
RA   Fisher A.G., Ratner L., Mitsuya H., Marselle L.M., Harper M.E., Broder S.,
RA   Gallo R.C., Wong-Staal F.;
RT   "Infectious mutants of HTLV-III with changes in the 3' region and markedly
RT   reduced cytopathic effects";
RL   Science, e1252229 233(4764):655-659(1986).
XX
RN   [23]
RX   DOI; 10.1016/0092-8674(86)90062-0.
RX   PUBMED; 3638988.
RA   Feinberg M.B., Jarrett R.F., Aldovini A., Gallo R.C., Wong-Staal F.;
RT   "HTLV-III expression and production involve complex regulation at the
RT   levels of splicing and translation of viral RNA";
RL   Cell 46(6):807-817(1986).
XX
RN   [24]
RX   PUBMED; 2430111.
RA   Lightfoote M.M., Coligan J.E., Folks T.M., Fauci A.S., Martin M.A.,
RA   Venkatesan S.;
RT   "Structural characterization of reverse transcriptase and endonuclease
RT   polypeptides of the acquired immunodeficiency syndrome retrovirus";
RL   J. Virol. 60(2):771-775(1986).
XX
RN   [25]
RX   PUBMED; 3490583.
RA   Terwilliger E., Sodroski J.G., Rosen C.A., Haseltine W.A.;
RT   "Effects of mutations within the 3' orf open reading frame region of human
RT   T-cell lymphotropic virus type III (HTLV-III/LAV) on replication and
RT   cytopathogenicity";
RL   J. Virol. 60(2):754-760(1986).
XX
RN   [26]
RX   DOI; 10.1126/science.3490693.
RX   PUBMED; 3490693.
RA   Wright C.M., Felber B.K., Paskalis H., Pavlakis G.N.;
RT   "Expression and characterization of the trans-activator of HTLV-III/LAV
RT   virus";
RL   Science, e1252229 234(4779):988-992(1986).
XX
RN   [27]
RX   PUBMED; 2433466.
RA   Modrow S., Hahn B.H., Shaw G.M., Gallo R.C., Wong-Staal F., Wolf H.;
RT   "Computer-assisted analysis of envelope protein sequences of seven human
RT   immunodeficiency virus isolates: prediction of antigenic epitopes in
RT   conserved and variable regions";
RL   J. Virol. 61(2):570-578(1987).
XX
RN   [28]
RX   PUBMED; 3543401.
RA   Goh W.C., Sodroski J.G., Rosen C.A., Haseltine W.A.;
RT   "Expression of the art gene protein of human T-lymphotropic virus type III
RT   (HTLV-III/LAV) in bacteria";
RL   J. Virol. 61(2):633-637(1987).
XX
RN   [29]
RX   DOI; 10.1016/0092-8674(87)90247-9.
RX   PUBMED; 3643816.
RA   Muesing M.A., Smith D.H., Capon D.J.;
RT   "Regulation of mRNA accumulation by a human immunodeficiency virus
RT   trans-activator protein";
RL   Cell 48(4):691-701(1987).
XX
RN   [30]
RX   DOI; 10.1038/326711a0.
RX   PUBMED; 3031512.
RA   Nabel G., Baltimore D.;
RT   "An inducible transcription factor activates expression of human
RT   immunodeficiency virus in T cells";
RL   Nature 326(6114):711-713(1987).
XX
RN   [31]
RX   PUBMED; 3040054.
RA   Patarca R., Heath C., Goldenberg G.J., Rosen C.A., Sodroski J.G.,
RA   Haseltine W.A., Hansen U.M.;
RT   "Transcription directed by the HIV long terminal repeat in vitro";
RL   AIDS Res. Hum. Retroviruses 3(1):41-55(1987).
XX
RN   [32]
RP   1-9635
RX   PUBMED; 3040055.
RA   Ratner L., Fisher A., Jagodzinski L.L., Mitsuya H., Liou R.S., Gallo R.C.,
RA   Wong-Staal F.;
RT   "Complete nucleotide sequences of functional clones of the AIDS virus";
RL   AIDS Res. Hum. Retroviruses 3(1):57-69(1987).
XX
RN   [33]
RX   DOI; 10.1126/science.3497453.
RX   PUBMED; 3497453.
RA   Fisher A.G., Ensoli B., Ivanoff L., Chamberlain M., Petteway S., Ratner L.,
RA   Gallo R.C., Wong-Staal F.;
RT   "The sor gene of HIV-1 is required for efficient virus transmission in
RT   vitro";
RL   Science, e1252229 237(4817):888-893(1987).
XX
RN   [34]
RX   PUBMED; 3476127.
RA   Wong-Staal F., Chanda P.K., Ghrayeb J.;
RT   "Human immunodeficiency virus: the eighth gene";
RL   AIDS Res. Hum. Retroviruses 3(1):33-39(1987).
XX
RN   [35]
RP   6225-8795
RX   DOI; 10.1016/0092-8674(88)90179-1.
RX   PUBMED; 2838179.
RA   Reitz M.S.Jr., Wilson C., Naugle C., Gallo R.C., Robert-Guroff M.;
RT   "Generation of a neutralization-resistant variant of HIV-1 is due to
RT   selection for a point mutation in the envelope gene";
RL   Cell 54(1):57-63(1988).
XX
RN   [36]
RP   790-2292
RX   PUBMED; 2194551.
RA   Pal R., Reitz M.S.Jr., Tschachler E., Gallo R.C., Sarngadharan M.G.,
RA   Veronese F.D.;
RT   "Myristoylation of gag proteins of HIV-1 plays an important role in virus
RT   assembly";
RL   AIDS Res. Hum. Retroviruses 6(6):721-730(1990).
XX
RN   [37]
RX   PUBMED; 1761538.
RA   Ido E., Han H.P., Kezdy F.J., Tang J.;
RT   "Kinetic studies of human immunodeficiency virus type 1 protease and its
RT   active-site hydrogen bond mutant A28S";
RL   J Biol Chem 266(36):24359-24366(1991).
XX
DR   MD5; c66838498aab02f786a6ec2f2d62cdc1.
DR   EuropePMC; PMC103883; 9847382.
DR   EuropePMC; PMC104119; 10074209.
DR   EuropePMC; PMC104175; 10196292.
DR   EuropePMC; PMC104192; 10196309.
DR   EuropePMC; PMC104217; 10196334.
DR   EuropePMC; PMC1087220; 15839752.
DR   EuropePMC; PMC109661; 9557721.
DR   EuropePMC; PMC110135; 9733838.
DR   EuropePMC; PMC111740; 10684266.
DR   EuropePMC; PMC112002; 10775618.
DR   EuropePMC; PMC112007; 10775623.
DR   EuropePMC; PMC112010; 10775626.
DR   EuropePMC; PMC112045; 10823865.
DR   EuropePMC; PMC113953; 11134270.
DR   EuropePMC; PMC113955; 11134272.
DR   EuropePMC; PMC114253; 11312370.
DR   EuropePMC; PMC1143671; 15919889.
DR   EuropePMC; PMC1143677; 15919928.
DR   EuropePMC; PMC1143723; 15956574.
DR   EuropePMC; PMC1143763; 15956585.
DR   EuropePMC; PMC114623; 11581417.
DR   EuropePMC; PMC114708; 11602768.
DR   EuropePMC; PMC114808; 11160728.
DR   EuropePMC; PMC115150; 11160703.
DR   EuropePMC; PMC115900; 11222699.
DR   EuropePMC; PMC1170712; 9649446.
DR   EuropePMC; PMC123057; 12060770.
DR   EuropePMC; PMC125679; 11598017.
DR   EuropePMC; PMC1262568; 16227248.
DR   EuropePMC; PMC133666; 11884594.
DR   EuropePMC; PMC1346845; 16379001.
DR   EuropePMC; PMC1346878; 16378985.
DR   EuropePMC; PMC135892; 11799165.
DR   EuropePMC; PMC136074; 11907217.
DR   EuropePMC; PMC136319; 12072500.
DR   EuropePMC; PMC136380; 12097556.
DR   EuropePMC; PMC136462; 12186930.
DR   EuropePMC; PMC136536; 12239324.
DR   EuropePMC; PMC136752; 12388731.
DR   EuropePMC; PMC136766; 12388687.
DR   EuropePMC; PMC136799; 12388734.
DR   EuropePMC; PMC136996; 12163596.
DR   EuropePMC; PMC137015; 11991964.
DR   EuropePMC; PMC137027; 11991972.
DR   EuropePMC; PMC1370347; 12458794.
DR   EuropePMC; PMC137970; 12466532.
DR   EuropePMC; PMC140365; 11923351.
DR   EuropePMC; PMC1421411; 16524459.
DR   EuropePMC; PMC148441; 10219094.
DR   EuropePMC; PMC149881; 12574502.
DR   EuropePMC; PMC150628; 12634388.
DR   EuropePMC; PMC153342; 12709359.
DR   EuropePMC; PMC1538796; 16845050.
DR   EuropePMC; PMC1563905; 16940537.
DR   EuropePMC; PMC1569883; 16984218.
DR   EuropePMC; PMC1570495; 16916442.
DR   EuropePMC; PMC1570496; 16959032.
DR   EuropePMC; PMC1617272; 16973562.
DR   EuropePMC; PMC16330; 10200260.
DR   EuropePMC; PMC1641764; 17041228.
DR   EuropePMC; PMC167238; 12885892.
DR   EuropePMC; PMC1762437; 17205139.
DR   EuropePMC; PMC1797267; 17050594.
DR   EuropePMC; PMC1797771; 17116674.
DR   EuropePMC; PMC1821094; 17113201.
DR   EuropePMC; PMC1847453; 17376229.
DR   EuropePMC; PMC184838; 2275531.
DR   EuropePMC; PMC1866003; 17202219.
DR   EuropePMC; PMC1866085; 17229705.
DR   EuropePMC; PMC187406; 12915557.
DR   EuropePMC; PMC1900219; 17329328.
DR   EuropePMC; PMC190036; 8627733.
DR   EuropePMC; PMC190367; 8676457.
DR   EuropePMC; PMC1904471; 17616974.
DR   EuropePMC; PMC190900; 8892951.
DR   EuropePMC; PMC190909; 8892960.
DR   EuropePMC; PMC191184; 8995653.
DR   EuropePMC; PMC191667; 9151839.
DR   EuropePMC; PMC191719; 9188551.
DR   EuropePMC; PMC191784; 9188616.
DR   EuropePMC; PMC191839; 9223473.
DR   EuropePMC; PMC192318; 9343212.
DR   EuropePMC; PMC1949996; 11713366.
DR   EuropePMC; PMC2100143; 18052601.
DR   EuropePMC; PMC21304; 9689046.
DR   EuropePMC; PMC2170516; 18183300.
DR   EuropePMC; PMC2193337; 11148221.
DR   EuropePMC; PMC2193638; 10330433.
DR   EuropePMC; PMC2200298; 18024124.
DR   EuropePMC; PMC2204037; 17996047.
DR   EuropePMC; PMC2211468; 17963512.
DR   EuropePMC; PMC2224600; 17977970.
DR   EuropePMC; PMC229256; 14557631.
DR   EuropePMC; PMC2292743; 18328091.
DR   EuropePMC; PMC230700; 7623851.
DR   EuropePMC; PMC231515; 8756672.
DR   EuropePMC; PMC2327360; 18367719.
DR   EuropePMC; PMC232750; 9114428.
DR   EuropePMC; PMC2365971; 18462013.
DR   EuropePMC; PMC236797; 7512159.
DR   EuropePMC; PMC240643; 1707986.
DR   EuropePMC; PMC240902; 1738205.
DR   EuropePMC; PMC2423217; 16831085.
DR   EuropePMC; PMC2428071; 17109335.
DR   EuropePMC; PMC2447050; 18448538.
DR   EuropePMC; PMC249182; 2296085.
DR   EuropePMC; PMC249660; 2370678.
DR   EuropePMC; PMC253768; 14576105.
DR   EuropePMC; PMC2546878; 18614631.
DR   EuropePMC; PMC2575487; 18936487.
DR   EuropePMC; PMC2593279; 18945845.
DR   EuropePMC; PMC262562; 14610198.
DR   EuropePMC; PMC2652827; 19279683.
DR   EuropePMC; PMC2666660; 19105834.
DR   EuropePMC; PMC2668364; 19193839.
DR   EuropePMC; PMC2681549; 19223634.
DR   EuropePMC; PMC2692653; 19073216.
DR   EuropePMC; PMC2696282; 17651754.
DR   EuropePMC; PMC2708512; 19420165.
DR   EuropePMC; PMC2716299; 19580659.
DR   EuropePMC; PMC2723923; 19690614.
DR   EuropePMC; PMC2734975; 17331041.
DR   EuropePMC; PMC2746939; 19552592.
DR   EuropePMC; PMC2764199; 19651917.
DR   EuropePMC; PMC2765414; 19876401.
DR   EuropePMC; PMC2767427; 19559110.
DR   EuropePMC; PMC2769074; 11897790.
DR   EuropePMC; PMC2812320; 19906908.
DR   EuropePMC; PMC2822863; 20174661.
DR   EuropePMC; PMC2833191; 20221448.
DR   EuropePMC; PMC2834596; 20804564.
DR   EuropePMC; PMC284441; 7514856.
DR   EuropePMC; PMC2853838; 19327053.
DR   EuropePMC; PMC2855529; 20307309.
DR   EuropePMC; PMC2859377; 20398371.
DR   EuropePMC; PMC2879232; 20426823.
DR   EuropePMC; PMC2880236; 20414690.
DR   EuropePMC; PMC2882320; 20544014.
DR   EuropePMC; PMC2898805; 20628644.
DR   EuropePMC; PMC2918528; 20646276.
DR   EuropePMC; PMC2924372; 20808850.
DR   EuropePMC; PMC2924856; 20696039.
DR   EuropePMC; PMC2931544; 20812894.
DR   EuropePMC; PMC2935022; 20479206.
DR   EuropePMC; PMC2937644; 20610725.
DR   EuropePMC; PMC2950005; 20800070.
DR   EuropePMC; PMC2950592; 20702636.
DR   EuropePMC; PMC2953504; 20967271.
DR   EuropePMC; PMC296044; 14645592.
DR   EuropePMC; PMC2964586; 20932333.
DR   EuropePMC; PMC29680; 11139617.
DR   EuropePMC; PMC298220; 2813380.
DR   EuropePMC; PMC3004330; 20881047.
DR   EuropePMC; PMC3005778; 20737578.
DR   EuropePMC; PMC3019647; 20956600.
DR   EuropePMC; PMC3034674; 21232091.
DR   EuropePMC; PMC3041826; 21365013.
DR   EuropePMC; PMC310644; 8255782.
DR   EuropePMC; PMC3122788; 21270223.
DR   EuropePMC; PMC3126116; 21289112.
DR   EuropePMC; PMC3141379; 21718537.
DR   EuropePMC; PMC3147877; 21593266.
DR   EuropePMC; PMC3156105; 21844303.
DR   EuropePMC; PMC3170306; 21871090.
DR   EuropePMC; PMC3177950; 21388344.
DR   EuropePMC; PMC3196395; 21775446.
DR   EuropePMC; PMC3203388; 21791652.
DR   EuropePMC; PMC3204757; 21291604.
DR   EuropePMC; PMC3206918; 22073290.
DR   EuropePMC; PMC3206936; 22073263.
DR   EuropePMC; PMC3227654; 22140574.
DR   EuropePMC; PMC3232804; 21896904.
DR   EuropePMC; PMC3265637; 21326075.
DR   EuropePMC; PMC3274565; 22324021.
DR   EuropePMC; PMC3275924; 21770741.
DR   EuropePMC; PMC3285029; 22171785.
DR   EuropePMC; PMC3292747; 21790471.
DR   EuropePMC; PMC3302240; 22190723.
DR   EuropePMC; PMC3302311; 22258250.
DR   EuropePMC; PMC3302781; 22427821.
DR   EuropePMC; PMC3308903; 22357663.
DR   EuropePMC; PMC3308925; 22333070.
DR   EuropePMC; PMC3341194; 22458358.
DR   EuropePMC; PMC3346622; 22290950.
DR   EuropePMC; PMC3349708; 22590588.
DR   EuropePMC; PMC3372133; 22403431.
DR   EuropePMC; PMC3392544; 22549382.
DR   EuropePMC; PMC3399557; 21916749.
DR   EuropePMC; PMC3416166; 22696649.
DR   EuropePMC; PMC3427460; 22592583.
DR   EuropePMC; PMC3440395; 22984489.
DR   EuropePMC; PMC344439; 14766818.
DR   EuropePMC; PMC3457319; 22837215.
DR   EuropePMC; PMC3464125; 22889273.
DR   EuropePMC; PMC3498126; 23166702.
DR   EuropePMC; PMC3502977; 22993180.
DR   EuropePMC; PMC3503140; 23055555.
DR   EuropePMC; PMC3505049; 22482735.
DR   EuropePMC; PMC3506197; 22903393.
DR   EuropePMC; PMC3511177; 23131071.
DR   EuropePMC; PMC3511259; 23153325.
DR   EuropePMC; PMC3524699; 21278684.
DR   EuropePMC; PMC3532711; 23178437.
DR   EuropePMC; PMC3536386; 23097440.
DR   EuropePMC; PMC3551811; 23349632.
DR   EuropePMC; PMC3567018; 23409150.
DR   EuropePMC; PMC3571356; 23255784.
DR   EuropePMC; PMC3578754; 23436985.
DR   EuropePMC; PMC3586799; 23385524.
DR   EuropePMC; PMC3592391; 22962364.
DR   EuropePMC; PMC3592801; 23520522.
DR   EuropePMC; PMC3661054; 23645815.
DR   EuropePMC; PMC369571; 1545819.
DR   EuropePMC; PMC3706403; 23874917.
DR   EuropePMC; PMC3739955; 23968204.
DR   EuropePMC; PMC3745356; 23839990.
DR   EuropePMC; PMC37465; 11447278.
DR   EuropePMC; PMC3754003; 23824804.
DR   EuropePMC; PMC3763554; 23804764.
DR   EuropePMC; PMC3776835; 24058534.
DR   EuropePMC; PMC3789152; 24089188.
DR   EuropePMC; PMC3807376; 23885083.
DR   EuropePMC; PMC3817037; 24223904.
DR   EuropePMC; PMC3867361; 24367533.
DR   EuropePMC; PMC387546; 15071000.
DR   EuropePMC; PMC3882871; 24432018.
DR   EuropePMC; PMC3900473; 24422906.
DR   EuropePMC; PMC3917854; 24516589.
DR   EuropePMC; PMC3918463; 19524069.
DR   EuropePMC; PMC3938922; 24025024.
DR   EuropePMC; PMC3938947; 24059291.
DR   EuropePMC; PMC3976149; 24655349.
DR   EuropePMC; PMC3988561; 24671765.
DR   EuropePMC; PMC3993807; 24522911.
DR   EuropePMC; PMC3999910; 24646213.
DR   EuropePMC; PMC4003292; 24758333.
DR   EuropePMC; PMC4010167; 24392780.
DR   EuropePMC; PMC4023761; 24468782.
DR   EuropePMC; PMC4059647; 24932692.
DR   EuropePMC; PMC4076986; 24446780.
DR   EuropePMC; PMC4093844; 24648453.
DR   EuropePMC; PMC4117599; 25080100.
DR   EuropePMC; PMC4118705; 24773167.
DR   EuropePMC; PMC4132706; 24972832.
DR   EuropePMC; PMC4135944; 24850730.
DR   EuropePMC; PMC4155129; 19918099.
DR   EuropePMC; PMC4159329; 25203725.
DR   EuropePMC; PMC4177671; 25254639.
DR   EuropePMC; PMC4196989; 25314293.
DR   EuropePMC; PMC4198772; 25280529.
DR   EuropePMC; PMC4215848; 24941220.
DR   EuropePMC; PMC4234413; 25401747.
DR   EuropePMC; PMC4249069; 25210191.
DR   EuropePMC; PMC4252486; 24954787.
DR   EuropePMC; PMC4273423; 25453107.
DR   EuropePMC; PMC427844; 15184457.
DR   EuropePMC; PMC427845; 15184461.
DR   EuropePMC; PMC4281083; 25551558.
DR   EuropePMC; PMC4295846; 25590131.
DR   EuropePMC; PMC4306839; 25609303.
DR   EuropePMC; PMC4313400; 25411830.
DR   EuropePMC; PMC4319483; 25336166.
DR   EuropePMC; PMC4324769; 25671421.
DR   EuropePMC; PMC4336490; 28561075.
DR   EuropePMC; PMC434100; 15220422.
DR   EuropePMC; PMC4348371; 25417788.
DR   EuropePMC; PMC4351365; 25312037.
DR   EuropePMC; PMC4379572; 25803098.
DR   EuropePMC; PMC4398475; 25637519.
DR   EuropePMC; PMC4400772; 25694526.
DR   EuropePMC; PMC4403036; 25914449.
DR   EuropePMC; PMC4415056; 25637585.
DR   EuropePMC; PMC4427332; 25961283.
DR   EuropePMC; PMC4427455; 25962088.
DR   EuropePMC; PMC4438479; 25966986.
DR   EuropePMC; PMC446276; 15243037.
DR   EuropePMC; PMC4466260; 26068869.
DR   EuropePMC; PMC4468501; 25903342.
DR   EuropePMC; PMC4472691; 26087118.
DR   EuropePMC; PMC4482814; 26115688.
DR   EuropePMC; PMC4520458; 26226348.
DR   EuropePMC; PMC4580167; 26246562.
DR   EuropePMC; PMC4586510; 26483796.
DR   EuropePMC; PMC4604392; 26282425.
DR   EuropePMC; PMC4645636; 26355081.
DR   EuropePMC; PMC4647519; 26572485.
DR   EuropePMC; PMC4665939; 26626277.
DR   EuropePMC; PMC4684184; 25649507.
DR   EuropePMC; PMC4706613; 26862570.
DR   EuropePMC; PMC4710461; 26756901.
DR   EuropePMC; PMC4719594; 26559841.
DR   EuropePMC; PMC4719604; 26581981.
DR   EuropePMC; PMC4724089; 26800882.
DR   EuropePMC; PMC4725846; 26807922.
DR   EuropePMC; PMC4746247; 26903989.
DR   EuropePMC; PMC4786936; 26775808.
DR   EuropePMC; PMC4809961; 26699702.
DR   EuropePMC; PMC4829083; 19005273.
DR   EuropePMC; PMC4865637; 26814962.
DR   EuropePMC; PMC4871359; 27186986.
DR   EuropePMC; PMC4878750; 27218259.
DR   EuropePMC; PMC4879252; 27212475.
DR   EuropePMC; PMC4913254; 27321866.
DR   EuropePMC; PMC4944274; 27194762.
DR   EuropePMC; PMC4961170; 27382162.
DR   EuropePMC; PMC4984628; 27226378.
DR   EuropePMC; PMC5011806; 27595568.
DR   EuropePMC; PMC5034182; 27688530.
DR   EuropePMC; PMC5042412; 27685447.
DR   EuropePMC; PMC5044815; 27466426.
DR   EuropePMC; PMC5044822; 27384654.
DR   EuropePMC; PMC5068275; 27681623.
DR   EuropePMC; PMC507117; 8609236.
DR   EuropePMC; PMC5094293; 27818787.
DR   EuropePMC; PMC5132210; 27907076.
DR   EuropePMC; PMC514752; 15328115.
DR   EuropePMC; PMC514996; 15331700.
DR   EuropePMC; PMC5154500; 27959928.
DR   EuropePMC; PMC5210024; 28058111.
DR   EuropePMC; PMC521086; 15363109.
DR   EuropePMC; PMC521816; 15452247.
DR   EuropePMC; PMC5221827; 28068413.
DR   EuropePMC; PMC5237259; 28086923.
DR   EuropePMC; PMC5237517; 28088235.
DR   EuropePMC; PMC5310230; 28167814.
DR   EuropePMC; PMC538538; 15613305.
DR   EuropePMC; PMC539197; 15630452.
DR   EuropePMC; PMC5415956; 28624190.
DR   EuropePMC; PMC5473534; 28622345.
DR   EuropePMC; PMC5475329; 28649306.
DR   EuropePMC; PMC54795; 2217190.
DR   EuropePMC; PMC549398; 15701759.
DR   EuropePMC; PMC84958; 10325329.
DR   EuropePMC; PMC85282; 10405401.
DR   EuropePMC; PMC85288; 10405405.
DR   EuropePMC; PMC86447; 10747109.
DR   EuropePMC; PMC87942; 11283059.
DR   EuropePMC; PMC88045; 11326010.
DR   EuropePMC; PMC88714; 10618106.
DR   EuropePMC; PMC90389; 11181376.
DR   EuropePMC; PMC90685; 11502522.
DR   GOA; P05919.
DR   InterPro; IPR008187; Vpu.
DR   InterPro; IPR009032; Vpu_cyt.
DR   PDB; 2N29; NMR.
DR   RFAM; RF00036; RRE.
DR   RFAM; RF00175; HIV-1_DIS.
DR   RFAM; RF00250; mir-TAR.
DR   RFAM; RF00375; HIV_PBS.
DR   RFAM; RF00376; HIV_GSL3.
DR   RFAM; RF00480; HIV_FE.
DR   RFAM; RF01380; HIV-1_SD.
DR   RFAM; RF01381; HIV-1_SL3.
DR   RFAM; RF01382; HIV-1_SL4.
DR   RFAM; RF01418; HIV_POL-1_SL.
DR   UniProtKB/Swiss-Prot; P05919; VPU_HV1H2.
XX
CC   On Mar 25, 1997 this sequence version replaced gi:327742.
CC   [6]  sites; tat mRNA and other transcript boundaries. [7]  sites;
CC   tat mRNA.
CC   [8]  sites; mRNA splice sites.
CC   [9]  sites; 27K antigen cds.
CC   [5]  sites; gp160 and gp120 coding sequences.
CC   [1]  sites; regulatory sequences in the LTR.
CC   [(in) Weiss,R., Teich,N., Varmus,H. and Coffin,J. (Eds.);RNA Tumor
CC   Viruses, Secon]  review; bases 1 to 9718.
CC   [15]  sites; trans-activator function and TAR sequence. [19]
CC   sites; pol coding sequence.
CC   [22]  sites; 23K sor gene product.
CC   [23]  sites; pol NH2-terminal region.
CC   [20]  sites; sor 23K protein.
CC   [21]  sites; sor 23K protein.
CC   [24]  sites; Sp1 binding sites in the promoter region. [17]  sites;
CC   acceptor and donor splice sites for tat and 27K. [10]  sites;
CC   deletion mutants in the tat gene.
CC   [18]  sites; env gene conserved/varable regions; separate entries.
CC   [16]  sites; trs cds boundaries.
CC   [12]  sites; trs cds boundaries.
CC   [11]  sites; env gene conserved/variable regions; separate entries.
CC   [26]  sites; tar or transactivator target.
CC   [13]  sites; 3' orf mutations.
CC   [14]  sites; pol p34 terminus.
CC   [31]  sites; promoter, TAR, tat-III mutants.
CC   [32]  sites; envelope protein epitopes.
CC   [33]  sites; trs/art protein.
CC   [34]  sites; inducible enhancer element.
CC   [27]  revises [30].
CC   [29]  sites; long terminal repeat.
CC   [28]  sites; R orf.
CC   [35]  sites; sor.
CC   Sequence for [25] kindly provided in computer-readable form by
CC   L.Ratner, 19-AUG-1986.
CC   The HXB2 sequence is being used as a reference genome for all the
CC   HIV entries because it has been derived from a demonstrably
CC   infectious clone.  Hence not all of the 'sites' references above
CC   were concerned with this isolate.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..9719
FT                   /organism="Human immunodeficiency virus 1"
FT                   /isolate="HXB2"
FT                   /mol_type="genomic RNA"
FT                   /proviral
FT                   /note="HTLV-III/LAV"
FT                   /db_xref="taxon:11676"
FT   repeat_region   1..634
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="5' LTR"
FT   repeat_region   454..551
FT                   /note="R repeat 5' copy"
FT   mRNA            455..9635
FT                   /product="HXB2 genomic mRNA"
FT   prim_transcript 455..9635
FT                   /note="tat, trs, 27K subgenomic mRNA"
FT   intron          744..5777
FT                   /note="tat, trs, 27K mRNA intron 1"
FT   CDS             790..2292
FT                   /codon_start=1
FT                   /note="gag polyprotein"
FT                   /db_xref="GOA:P04591"
FT                   /db_xref="InterPro:IPR000071"
FT                   /db_xref="InterPro:IPR000721"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR008916"
FT                   /db_xref="InterPro:IPR008919"
FT                   /db_xref="InterPro:IPR010999"
FT                   /db_xref="InterPro:IPR014817"
FT                   /db_xref="PDB:1TSQ"
FT                   /db_xref="PDB:1TSU"
FT                   /db_xref="PDB:5FJB"
FT                   /db_xref="PDB:5I1R"
FT                   /db_xref="PDB:5INC"
FT                   /db_xref="PDB:5IND"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04591"
FT                   /protein_id="AAB50258.1"
FT                   /translation="MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFA
FT                   VNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKI
FT                   EEEQNKSKKKAQQAAADTGHSNQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEEKA
FT                   FSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGP
FT                   IAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTS
FT                   ILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPA
FT                   ATLEEMMTACQGVGGPGHKARVLAEAMSQVTNSATIMMQRGNFRNQRKIVKCFNCGKEG
FT                   HTARNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSYKGRPGNFLQSRPEPTAP
FT                   PEESFRSGVETTTPPQKQEPIDKELYPLTSLRSLFGNDPSSQ"
FT   CDS             2358..5096
FT                   /codon_start=1
FT                   /note="pol polyprotein (NH2-terminus uncertain)"
FT                   /db_xref="GOA:P04585"
FT                   /db_xref="InterPro:IPR000071"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR000721"
FT                   /db_xref="InterPro:IPR001037"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR001995"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR003308"
FT                   /db_xref="InterPro:IPR008916"
FT                   /db_xref="InterPro:IPR008919"
FT                   /db_xref="InterPro:IPR010659"
FT                   /db_xref="InterPro:IPR010661"
FT                   /db_xref="InterPro:IPR010999"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR018061"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034170"
FT                   /db_xref="PDB:1A30"
FT                   /db_xref="PDB:1BV7"
FT                   /db_xref="PDB:1BV9"
FT                   /db_xref="PDB:1BVE"
FT                   /db_xref="PDB:1BVG"
FT                   /db_xref="PDB:1BWA"
FT                   /db_xref="PDB:1BWB"
FT                   /db_xref="PDB:1C0T"
FT                   /db_xref="PDB:1C0U"
FT                   /db_xref="PDB:1C1B"
FT                   /db_xref="PDB:1C1C"
FT                   /db_xref="PDB:1DMP"
FT                   /db_xref="PDB:1DTQ"
FT                   /db_xref="PDB:1DTT"
FT                   /db_xref="PDB:1E6J"
FT                   /db_xref="PDB:1EP4"
FT                   /db_xref="PDB:1ESK"
FT                   /db_xref="PDB:1EX4"
FT                   /db_xref="PDB:1EXQ"
FT                   /db_xref="PDB:1FB7"
FT                   /db_xref="PDB:1FK9"
FT                   /db_xref="PDB:1FKO"
FT                   /db_xref="PDB:1FKP"
FT                   /db_xref="PDB:1G6L"
FT                   /db_xref="PDB:1HIV"
FT                   /db_xref="PDB:1HVH"
FT                   /db_xref="PDB:1HVR"
FT                   /db_xref="PDB:1HWR"
FT                   /db_xref="PDB:1HXB"
FT                   /db_xref="PDB:1JKH"
FT                   /db_xref="PDB:1JLA"
FT                   /db_xref="PDB:1JLB"
FT                   /db_xref="PDB:1JLC"
FT                   /db_xref="PDB:1JLE"
FT                   /db_xref="PDB:1JLF"
FT                   /db_xref="PDB:1JLG"
FT                   /db_xref="PDB:1JLQ"
FT                   /db_xref="PDB:1KLM"
FT                   /db_xref="PDB:1LV1"
FT                   /db_xref="PDB:1LW0"
FT                   /db_xref="PDB:1LW2"
FT                   /db_xref="PDB:1LWC"
FT                   /db_xref="PDB:1LWE"
FT                   /db_xref="PDB:1LWF"
FT                   /db_xref="PDB:1NCP"
FT                   /db_xref="PDB:1O1W"
FT                   /db_xref="PDB:1ODW"
FT                   /db_xref="PDB:1ODY"
FT                   /db_xref="PDB:1QBR"
FT                   /db_xref="PDB:1QBS"
FT                   /db_xref="PDB:1QBT"
FT                   /db_xref="PDB:1QBU"
FT                   /db_xref="PDB:1REV"
FT                   /db_xref="PDB:1RT1"
FT                   /db_xref="PDB:1RT2"
FT                   /db_xref="PDB:1RT3"
FT                   /db_xref="PDB:1RT4"
FT                   /db_xref="PDB:1RT5"
FT                   /db_xref="PDB:1RT6"
FT                   /db_xref="PDB:1RT7"
FT                   /db_xref="PDB:1RTD"
FT                   /db_xref="PDB:1RTH"
FT                   /db_xref="PDB:1RTI"
FT                   /db_xref="PDB:1RTJ"
FT                   /db_xref="PDB:1S1T"
FT                   /db_xref="PDB:1S1U"
FT                   /db_xref="PDB:1S1V"
FT                   /db_xref="PDB:1S1W"
FT                   /db_xref="PDB:1S1X"
FT                   /db_xref="PDB:1T05"
FT                   /db_xref="PDB:1TAM"
FT                   /db_xref="PDB:1TKT"
FT                   /db_xref="PDB:1TKX"
FT                   /db_xref="PDB:1TKZ"
FT                   /db_xref="PDB:1TL1"
FT                   /db_xref="PDB:1TL3"
FT                   /db_xref="PDB:1VRT"
FT                   /db_xref="PDB:1VRU"
FT                   /db_xref="PDB:2HND"
FT                   /db_xref="PDB:2HNY"
FT                   /db_xref="PDB:2HNZ"
FT                   /db_xref="PDB:2KOD"
FT                   /db_xref="PDB:2NPH"
FT                   /db_xref="PDB:2OPP"
FT                   /db_xref="PDB:2OPQ"
FT                   /db_xref="PDB:2OPR"
FT                   /db_xref="PDB:2OPS"
FT                   /db_xref="PDB:2RF2"
FT                   /db_xref="PDB:2RKI"
FT                   /db_xref="PDB:2WHH"
FT                   /db_xref="PDB:2WOM"
FT                   /db_xref="PDB:2WON"
FT                   /db_xref="PDB:2YNF"
FT                   /db_xref="PDB:2YNG"
FT                   /db_xref="PDB:2YNH"
FT                   /db_xref="PDB:2YNI"
FT                   /db_xref="PDB:3AO2"
FT                   /db_xref="PDB:3C6T"
FT                   /db_xref="PDB:3C6U"
FT                   /db_xref="PDB:3DI6"
FT                   /db_xref="PDB:3DLE"
FT                   /db_xref="PDB:3DLG"
FT                   /db_xref="PDB:3DM2"
FT                   /db_xref="PDB:3DMJ"
FT                   /db_xref="PDB:3DOK"
FT                   /db_xref="PDB:3DOL"
FT                   /db_xref="PDB:3DOX"
FT                   /db_xref="PDB:3DRP"
FT                   /db_xref="PDB:3DRR"
FT                   /db_xref="PDB:3DRS"
FT                   /db_xref="PDB:3DYA"
FT                   /db_xref="PDB:3E01"
FT                   /db_xref="PDB:3FFI"
FT                   /db_xref="PDB:3I0R"
FT                   /db_xref="PDB:3I0S"
FT                   /db_xref="PDB:3KJV"
FT                   /db_xref="PDB:3KK1"
FT                   /db_xref="PDB:3KK2"
FT                   /db_xref="PDB:3KK3"
FT                   /db_xref="PDB:3KT2"
FT                   /db_xref="PDB:3KT5"
FT                   /db_xref="PDB:3LAK"
FT                   /db_xref="PDB:3LAL"
FT                   /db_xref="PDB:3LAM"
FT                   /db_xref="PDB:3LAN"
FT                   /db_xref="PDB:3LP0"
FT                   /db_xref="PDB:3LP1"
FT                   /db_xref="PDB:3LP2"
FT                   /db_xref="PDB:3M8P"
FT                   /db_xref="PDB:3M8Q"
FT                   /db_xref="PDB:3MEC"
FT                   /db_xref="PDB:3MED"
FT                   /db_xref="PDB:3MEE"
FT                   /db_xref="PDB:3MEG"
FT                   /db_xref="PDB:3MIM"
FT                   /db_xref="PDB:3N3I"
FT                   /db_xref="PDB:3NBP"
FT                   /db_xref="PDB:3PHV"
FT                   /db_xref="PDB:3QIN"
FT                   /db_xref="PDB:3QIO"
FT                   /db_xref="PDB:3QIP"
FT                   /db_xref="PDB:3T19"
FT                   /db_xref="PDB:3T1A"
FT                   /db_xref="PDB:3TAM"
FT                   /db_xref="PDB:4B3O"
FT                   /db_xref="PDB:4B3P"
FT                   /db_xref="PDB:4B3Q"
FT                   /db_xref="PDB:4I7F"
FT                   /db_xref="PDB:4KSE"
FT                   /db_xref="PDB:4KV8"
FT                   /db_xref="PDB:4NCG"
FT                   /db_xref="PDB:4Q1W"
FT                   /db_xref="PDB:4Q1X"
FT                   /db_xref="PDB:4Q1Y"
FT                   /db_xref="PDB:4Q5M"
FT                   /db_xref="PDB:4QLH"
FT                   /db_xref="PDB:4U1H"
FT                   /db_xref="PDB:4U1I"
FT                   /db_xref="PDB:4U1J"
FT                   /db_xref="PDB:4U7Q"
FT                   /db_xref="PDB:4U7V"
FT                   /db_xref="PDB:5DGU"
FT                   /db_xref="PDB:5DGW"
FT                   /db_xref="PDB:5EU7"
FT                   /db_xref="PDB:5HRN"
FT                   /db_xref="PDB:5HRP"
FT                   /db_xref="PDB:5HRR"
FT                   /db_xref="PDB:5HRS"
FT                   /db_xref="PDB:5IM7"
FT                   /db_xref="PDB:5J2M"
FT                   /db_xref="PDB:5J2N"
FT                   /db_xref="PDB:5J2P"
FT                   /db_xref="PDB:5J2Q"
FT                   /db_xref="PDB:5K14"
FT                   /db_xref="PDB:5T82"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04585"
FT                   /protein_id="AAB50259.1"
FT                   /translation="MSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT
FT                   PVNIIGRNLLTQIGCTLNFPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTE
FT                   MEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAG
FT                   LKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPA
FT                   IFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTP
FT                   DKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKV
FT                   RQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG
FT                   QWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQ
FT                   KETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLG
FT                   KAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQ
FT                   SESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVLFLDGIDKAQDE
FT                   HEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEG
FT                   KVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAA
FT                   CWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRK
FT                   GGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEG
FT                   AVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED"
FT   CDS             5041..5619
FT                   /codon_start=1
FT                   /note="sor 23K protein"
FT                   /db_xref="GOA:P69723"
FT                   /db_xref="InterPro:IPR000475"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69723"
FT                   /protein_id="AAB50260.1"
FT                   /translation="MENRWQVMIVWQVDRMRIRTWKSLVKHHMYVSGKARGWFYRHHYE
FT                   SPHPRISSEVHIPLGDARLVITTYWGLHTGERDWHLGQGVSIEWRKKRYSTQVDPELAD
FT                   QLIHLYYFDCFSDSAIRKALLGHIVSPRCEYQAGHNKVGSLQYLALAALITPKKIKPPL
FT                   PSVTKLTEDRWNKPQKTKGHRGSHTMNGH"
FT   CDS             5559..5795
FT                   /codon_start=1
FT                   /note="R (ORF) protein"
FT                   /db_xref="GOA:P69726"
FT                   /db_xref="InterPro:IPR000012"
FT                   /db_xref="PDB:4U1S"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69726"
FT                   /protein_id="AAB50261.1"
FT                   /translation="MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQH
FT                   IYETYGDTWAGVEAIIRILQQLLFIHFQNWVST"
FT   CDS             join(5831..6045,8379..8424)
FT                   /codon_start=1
FT                   /note="tat protein"
FT                   /db_xref="GOA:P04608"
FT                   /db_xref="InterPro:IPR001831"
FT                   /db_xref="PDB:3MI9"
FT                   /db_xref="PDB:3MIA"
FT                   /db_xref="PDB:4OR5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04608"
FT                   /protein_id="AAB50256.1"
FT                   /translation="MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGI
FT                   SYGRKKRRQRRRAHQNSQTHQASLSKQPTSQPRGDPTGPKE"
FT   exon            5831..6045
FT                   /number=2
FT                   /note="tat protein, first expressed exon"
FT   CDS             join(5970..6045,8379..8653)
FT                   /codon_start=1
FT                   /note="trs protein"
FT                   /db_xref="GOA:P04618"
FT                   /db_xref="InterPro:IPR000625"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04618"
FT                   /protein_id="AAB50257.1"
FT                   /translation="MAGRSGDSDEELIRTVRLIKLLYQSNPPPNPEGTRQARRNRRRRW
FT                   RERQRQIHSISERILGTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILV
FT                   ESPTVLESGTKE"
FT   exon            5970..6045
FT                   /number=2
FT                   /note="trs protein, first expressed exon"
FT   intron          6046..8378
FT                   /note="tat, trs, 27K mRNA intron 2"
FT   CDS             6225..8795
FT                   /codon_start=1
FT                   /note="envelope polyprotein"
FT                   /db_xref="GOA:P04578"
FT                   /db_xref="InterPro:IPR000328"
FT                   /db_xref="InterPro:IPR000777"
FT                   /db_xref="PDB:1AIK"
FT                   /db_xref="PDB:1DF4"
FT                   /db_xref="PDB:1DF5"
FT                   /db_xref="PDB:1DLB"
FT                   /db_xref="PDB:1G9M"
FT                   /db_xref="PDB:1GC1"
FT                   /db_xref="PDB:1GZL"
FT                   /db_xref="PDB:1K33"
FT                   /db_xref="PDB:1K34"
FT                   /db_xref="PDB:1MZI"
FT                   /db_xref="PDB:1OPN"
FT                   /db_xref="PDB:1OPT"
FT                   /db_xref="PDB:1OPW"
FT                   /db_xref="PDB:1RZJ"
FT                   /db_xref="PDB:2CMR"
FT                   /db_xref="PDB:2ME1"
FT                   /db_xref="PDB:2MG1"
FT                   /db_xref="PDB:2MG2"
FT                   /db_xref="PDB:2MG3"
FT                   /db_xref="PDB:2NY7"
FT                   /db_xref="PDB:2PV6"
FT                   /db_xref="PDB:2XRA"
FT                   /db_xref="PDB:3D0V"
FT                   /db_xref="PDB:3DNL"
FT                   /db_xref="PDB:3DNN"
FT                   /db_xref="PDB:3DNO"
FT                   /db_xref="PDB:3DRO"
FT                   /db_xref="PDB:3IDX"
FT                   /db_xref="PDB:3IDY"
FT                   /db_xref="PDB:3J70"
FT                   /db_xref="PDB:3TYG"
FT                   /db_xref="PDB:3VIE"
FT                   /db_xref="PDB:4JPJ"
FT                   /db_xref="PDB:4JPK"
FT                   /db_xref="PDB:4YDV"
FT                   /db_xref="PDB:4ZTO"
FT                   /db_xref="PDB:5BN0"
FT                   /db_xref="PDB:5C0R"
FT                   /db_xref="PDB:5C0S"
FT                   /db_xref="PDB:5CIL"
FT                   /db_xref="PDB:5CIN"
FT                   /db_xref="PDB:5CMU"
FT                   /db_xref="PDB:5CMZ"
FT                   /db_xref="PDB:5CN0"
FT                   /db_xref="PDB:5DD0"
FT                   /db_xref="PDB:5GHW"
FT                   /db_xref="PDB:5H0N"
FT                   /db_xref="PDB:5HFL"
FT                   /db_xref="PDB:5HM1"
FT                   /db_xref="PDB:5IVX"
FT                   /db_xref="PDB:5KA5"
FT                   /db_xref="PDB:5KA6"
FT                   /db_xref="PDB:5X08"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04578"
FT                   /protein_id="AAB50262.1"
FT                   /translation="MRVKEKYQHLWRWGWRWGTMLLGMLMICSATEKLWVTVYYGVPVW
FT                   KEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVEQM
FT                   HEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFNIST
FT                   SIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEPIPIHYCAPAG
FT                   FAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDNA
FT                   KTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNN
FT                   TLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNSTWFNST
FT                   WSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDG
FT                   GNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKRAVGIGA
FT                   LFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQL
FT                   QARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWNHTTWMEWDREI
FT                   NNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKLFIMIVGGLVG
FT                   LRIVFAVLSIVNRVRQGYSPLSFQTHLPTPRGPDRPEGIEEEGGERDRDRSIRLVNGSL
FT                   ALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAV
FT                   SLLNATAIAVAEGTDRVIEVVQGACRAIRHIPRRIRQGLERILL"
FT   exon            8379..8652
FT                   /number=3
FT                   /note="trs protein"
FT   exon            8379..8424
FT                   /number=3
FT                   /note="tat protein"
FT   CDS             8797..9168
FT                   /codon_start=1
FT                   /note="27K protein (premature termination)"
FT                   /db_xref="GOA:P04601"
FT                   /db_xref="InterPro:IPR001558"
FT                   /db_xref="InterPro:IPR027480"
FT                   /db_xref="InterPro:IPR027481"
FT                   /db_xref="PDB:3RL2"
FT                   /db_xref="PDB:4NEE"
FT                   /db_xref="PDB:4WU5"
FT                   /db_xref="PDB:4WU7"
FT                   /db_xref="PDB:5HGA"
FT                   /db_xref="PDB:5HGB"
FT                   /db_xref="PDB:5HGD"
FT                   /db_xref="PDB:5HGH"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04601"
FT                   /protein_id="AAB50263.1"
FT                   /translation="MGGKWSKSSVIGWPTVRERMRRAEPAADRVGAASRDLEKHGAITS
FT                   SNTAATNAACAWLEAQEEEEVGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIHSQ
FT                   RRQDILDLWIYHTQGYFPD"
FT   repeat_region   9086..9719
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="3' LTR"
FT   repeat_region   9540..9636
FT                   /note="R repeat 3' copy"
FT   regulatory      9612..9617
FT                   /note="HXB2 mRNA polyadenyation signal"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 9719 BP; 3411 A; 1772 C; 2373 G; 2163 T; 0 other;
     tggaagggct aattcactcc caacgaagac aagatatcct tgatctgtgg atctaccaca        60
     cacaaggcta cttccctgat tagcagaact acacaccagg gccagggatc agatatccac       120
     tgacctttgg atggtgctac aagctagtac cagttgagcc agagaagtta gaagaagcca       180
     acaaaggaga gaacaccagc ttgttacacc ctgtgagcct gcatggaatg gatgacccgg       240
     agagagaagt gttagagtgg aggtttgaca gccgcctagc atttcatcac atggcccgag       300
     agctgcatcc ggagtacttc aagaactgct gacatcgagc ttgctacaag ggactttccg       360
     ctggggactt tccagggagg cgtggcctgg gcgggactgg ggagtggcga gccctcagat       420
     cctgcatata agcagctgct ttttgcctgt actgggtctc tctggttaga ccagatctga       480
     gcctgggagc tctctggcta actagggaac ccactgctta agcctcaata aagcttgcct       540
     tgagtgcttc aagtagtgtg tgcccgtctg ttgtgtgact ctggtaacta gagatccctc       600
     agaccctttt agtcagtgtg gaaaatctct agcagtggcg cccgaacagg gacctgaaag       660
     cgaaagggaa accagaggag ctctctcgac gcaggactcg gcttgctgaa gcgcgcacgg       720
     caagaggcga ggggcggcga ctggtgagta cgccaaaaat tttgactagc ggaggctaga       780
     aggagagaga tgggtgcgag agcgtcagta ttaagcgggg gagaattaga tcgatgggaa       840
     aaaattcggt taaggccagg gggaaagaaa aaatataaat taaaacatat agtatgggca       900
     agcagggagc tagaacgatt cgcagttaat cctggcctgt tagaaacatc agaaggctgt       960
     agacaaatac tgggacagct acaaccatcc cttcagacag gatcagaaga acttagatca      1020
     ttatataata cagtagcaac cctctattgt gtgcatcaaa ggatagagat aaaagacacc      1080
     aaggaagctt tagacaagat agaggaagag caaaacaaaa gtaagaaaaa agcacagcaa      1140
     gcagcagctg acacaggaca cagcaatcag gtcagccaaa attaccctat agtgcagaac      1200
     atccaggggc aaatggtaca tcaggccata tcacctagaa ctttaaatgc atgggtaaaa      1260
     gtagtagaag agaaggcttt cagcccagaa gtgataccca tgttttcagc attatcagaa      1320
     ggagccaccc cacaagattt aaacaccatg ctaaacacag tggggggaca tcaagcagcc      1380
     atgcaaatgt taaaagagac catcaatgag gaagctgcag aatgggatag agtgcatcca      1440
     gtgcatgcag ggcctattgc accaggccag atgagagaac caaggggaag tgacatagca      1500
     ggaactacta gtacccttca ggaacaaata ggatggatga caaataatcc acctatccca      1560
     gtaggagaaa tttataaaag atggataatc ctgggattaa ataaaatagt aagaatgtat      1620
     agccctacca gcattctgga cataagacaa ggaccaaagg aaccctttag agactatgta      1680
     gaccggttct ataaaactct aagagccgag caagcttcac aggaggtaaa aaattggatg      1740
     acagaaacct tgttggtcca aaatgcgaac ccagattgta agactatttt aaaagcattg      1800
     ggaccagcgg ctacactaga agaaatgatg acagcatgtc agggagtagg aggacccggc      1860
     cataaggcaa gagttttggc tgaagcaatg agccaagtaa caaattcagc taccataatg      1920
     atgcagagag gcaattttag gaaccaaaga aagattgtta agtgtttcaa ttgtggcaaa      1980
     gaagggcaca cagccagaaa ttgcagggcc cctaggaaaa agggctgttg gaaatgtgga      2040
     aaggaaggac accaaatgaa agattgtact gagagacagg ctaatttttt agggaagatc      2100
     tggccttcct acaagggaag gccagggaat tttcttcaga gcagaccaga gccaacagcc      2160
     ccaccagaag agagcttcag gtctggggta gagacaacaa ctccccctca gaagcaggag      2220
     ccgatagaca aggaactgta tcctttaact tccctcaggt cactctttgg caacgacccc      2280
     tcgtcacaat aaagataggg gggcaactaa aggaagctct attagataca ggagcagatg      2340
     atacagtatt agaagaaatg agtttgccag gaagatggaa accaaaaatg atagggggaa      2400
     ttggaggttt tatcaaagta agacagtatg atcagatact catagaaatc tgtggacata      2460
     aagctatagg tacagtatta gtaggaccta cacctgtcaa cataattgga agaaatctgt      2520
     tgactcagat tggttgcact ttaaattttc ccattagccc tattgagact gtaccagtaa      2580
     aattaaagcc aggaatggat ggcccaaaag ttaaacaatg gccattgaca gaagaaaaaa      2640
     taaaagcatt agtagaaatt tgtacagaga tggaaaagga agggaaaatt tcaaaaattg      2700
     ggcctgaaaa tccatacaat actccagtat ttgccataaa gaaaaaagac agtactaaat      2760
     ggagaaaatt agtagatttc agagaactta ataagagaac tcaagacttc tgggaagttc      2820
     aattaggaat accacatccc gcagggttaa aaaagaaaaa atcagtaaca gtactggatg      2880
     tgggtgatgc atatttttca gttcccttag atgaagactt caggaagtat actgcattta      2940
     ccatacctag tataaacaat gagacaccag ggattagata tcagtacaat gtgcttccac      3000
     agggatggaa aggatcacca gcaatattcc aaagtagcat gacaaaaatc ttagagcctt      3060
     ttagaaaaca aaatccagac atagttatct atcaatacat ggatgatttg tatgtaggat      3120
     ctgacttaga aatagggcag catagaacaa aaatagagga gctgagacaa catctgttga      3180
     ggtggggact taccacacca gacaaaaaac atcagaaaga acctccattc ctttggatgg      3240
     gttatgaact ccatcctgat aaatggacag tacagcctat agtgctgcca gaaaaagaca      3300
     gctggactgt caatgacata cagaagttag tggggaaatt gaattgggca agtcagattt      3360
     acccagggat taaagtaagg caattatgta aactccttag aggaaccaaa gcactaacag      3420
     aagtaatacc actaacagaa gaagcagagc tagaactggc agaaaacaga gagattctaa      3480
     aagaaccagt acatggagtg tattatgacc catcaaaaga cttaatagca gaaatacaga      3540
     agcaggggca aggccaatgg acatatcaaa tttatcaaga gccatttaaa aatctgaaaa      3600
     caggaaaata tgcaagaatg aggggtgccc acactaatga tgtaaaacaa ttaacagagg      3660
     cagtgcaaaa aataaccaca gaaagcatag taatatgggg aaagactcct aaatttaaac      3720
     tgcccataca aaaggaaaca tgggaaacat ggtggacaga gtattggcaa gccacctgga      3780
     ttcctgagtg ggagtttgtt aatacccctc ccttagtgaa attatggtac cagttagaga      3840
     aagaacccat agtaggagca gaaaccttct atgtagatgg ggcagctaac agggagacta      3900
     aattaggaaa agcaggatat gttactaata gaggaagaca aaaagttgtc accctaactg      3960
     acacaacaaa tcagaagact gagttacaag caatttatct agctttgcag gattcgggat      4020
     tagaagtaaa catagtaaca gactcacaat atgcattagg aatcattcaa gcacaaccag      4080
     atcaaagtga atcagagtta gtcaatcaaa taatagagca gttaataaaa aaggaaaagg      4140
     tctatctggc atgggtacca gcacacaaag gaattggagg aaatgaacaa gtagataaat      4200
     tagtcagtgc tggaatcagg aaagtactat ttttagatgg aatagataag gcccaagatg      4260
     aacatgagaa atatcacagt aattggagag caatggctag tgattttaac ctgccacctg      4320
     tagtagcaaa agaaatagta gccagctgtg ataaatgtca gctaaaagga gaagccatgc      4380
     atggacaagt agactgtagt ccaggaatat ggcaactaga ttgtacacat ttagaaggaa      4440
     aagttatcct ggtagcagtt catgtagcca gtggatatat agaagcagaa gttattccag      4500
     cagaaacagg gcaggaaaca gcatattttc ttttaaaatt agcaggaaga tggccagtaa      4560
     aaacaataca tactgacaat ggcagcaatt tcaccggtgc tacggttagg gccgcctgtt      4620
     ggtgggcggg aatcaagcag gaatttggaa ttccctacaa tccccaaagt caaggagtag      4680
     tagaatctat gaataaagaa ttaaagaaaa ttataggaca ggtaagagat caggctgaac      4740
     atcttaagac agcagtacaa atggcagtat tcatccacaa ttttaaaaga aaagggggga      4800
     ttggggggta cagtgcaggg gaaagaatag tagacataat agcaacagac atacaaacta      4860
     aagaattaca aaaacaaatt acaaaaattc aaaattttcg ggtttattac agggacagca      4920
     gaaatccact ttggaaagga ccagcaaagc tcctctggaa aggtgaaggg gcagtagtaa      4980
     tacaagataa tagtgacata aaagtagtgc caagaagaaa agcaaagatc attagggatt      5040
     atggaaaaca gatggcaggt gatgattgtg tggcaagtag acaggatgag gattagaaca      5100
     tggaaaagtt tagtaaaaca ccatatgtat gtttcaggga aagctagggg atggttttat      5160
     agacatcact atgaaagccc tcatccaaga ataagttcag aagtacacat cccactaggg      5220
     gatgctagat tggtaataac aacatattgg ggtctgcata caggagaaag agactggcat      5280
     ttgggtcagg gagtctccat agaatggagg aaaaagagat atagcacaca agtagaccct      5340
     gaactagcag accaactaat tcatctgtat tactttgact gtttttcaga ctctgctata      5400
     agaaaggcct tattaggaca catagttagc cctaggtgtg aatatcaagc aggacataac      5460
     aaggtaggat ctctacaata cttggcacta gcagcattaa taacaccaaa aaagataaag      5520
     ccacctttgc ctagtgttac gaaactgaca gaggatagat ggaacaagcc ccagaagacc      5580
     aagggccaca gagggagcca cacaatgaat ggacactaga gcttttagag gagcttaaga      5640
     atgaagctgt tagacatttt cctaggattt ggctccatgg cttagggcaa catatctatg      5700
     aaacttatgg ggatacttgg gcaggagtgg aagccataat aagaattctg caacaactgc      5760
     tgtttatcca ttttcagaat tgggtgtcga catagcagaa taggcgttac tcgacagagg      5820
     agagcaagaa atggagccag tagatcctag actagagccc tggaagcatc caggaagtca      5880
     gcctaaaact gcttgtacca attgctattg taaaaagtgt tgctttcatt gccaagtttg      5940
     tttcataaca aaagccttag gcatctccta tggcaggaag aagcggagac agcgacgaag      6000
     agctcatcag aacagtcaga ctcatcaagc ttctctatca aagcagtaag tagtacatgt      6060
     aacgcaacct ataccaatag tagcaatagt agcattagta gtagcaataa taatagcaat      6120
     agttgtgtgg tccatagtaa tcatagaata taggaaaata ttaagacaaa gaaaaataga      6180
     caggttaatt gatagactaa tagaaagagc agaagacagt ggcaatgaga gtgaaggaga      6240
     aatatcagca cttgtggaga tgggggtgga gatggggcac catgctcctt gggatgttga      6300
     tgatctgtag tgctacagaa aaattgtggg tcacagtcta ttatggggta cctgtgtgga      6360
     aggaagcaac caccactcta ttttgtgcat cagatgctaa agcatatgat acagaggtac      6420
     ataatgtttg ggccacacat gcctgtgtac ccacagaccc caacccacaa gaagtagtat      6480
     tggtaaatgt gacagaaaat tttaacatgt ggaaaaatga catggtagaa cagatgcatg      6540
     aggatataat cagtttatgg gatcaaagcc taaagccatg tgtaaaatta accccactct      6600
     gtgttagttt aaagtgcact gatttgaaga atgatactaa taccaatagt agtagcggga      6660
     gaatgataat ggagaaagga gagataaaaa actgctcttt caatatcagc acaagcataa      6720
     gaggtaaggt gcagaaagaa tatgcatttt tttataaact tgatataata ccaatagata      6780
     atgatactac cagctataag ttgacaagtt gtaacacctc agtcattaca caggcctgtc      6840
     caaaggtatc ctttgagcca attcccatac attattgtgc cccggctggt tttgcgattc      6900
     taaaatgtaa taataagacg ttcaatggaa caggaccatg tacaaatgtc agcacagtac      6960
     aatgtacaca tggaattagg ccagtagtat caactcaact gctgttaaat ggcagtctag      7020
     cagaagaaga ggtagtaatt agatctgtca atttcacgga caatgctaaa accataatag      7080
     tacagctgaa cacatctgta gaaattaatt gtacaagacc caacaacaat acaagaaaaa      7140
     gaatccgtat ccagagagga ccagggagag catttgttac aataggaaaa ataggaaata      7200
     tgagacaagc acattgtaac attagtagag caaaatggaa taacacttta aaacagatag      7260
     ctagcaaatt aagagaacaa tttggaaata ataaaacaat aatctttaag caatcctcag      7320
     gaggggaccc agaaattgta acgcacagtt ttaattgtgg aggggaattt ttctactgta      7380
     attcaacaca actgtttaat agtacttggt ttaatagtac ttggagtact gaagggtcaa      7440
     ataacactga aggaagtgac acaatcaccc tcccatgcag aataaaacaa attataaaca      7500
     tgtggcagaa agtaggaaaa gcaatgtatg cccctcccat cagtggacaa attagatgtt      7560
     catcaaatat tacagggctg ctattaacaa gagatggtgg taatagcaac aatgagtccg      7620
     agatcttcag acctggagga ggagatatga gggacaattg gagaagtgaa ttatataaat      7680
     ataaagtagt aaaaattgaa ccattaggag tagcacccac caaggcaaag agaagagtgg      7740
     tgcagagaga aaaaagagca gtgggaatag gagctttgtt ccttgggttc ttgggagcag      7800
     caggaagcac tatgggcgca gcctcaatga cgctgacggt acaggccaga caattattgt      7860
     ctggtatagt gcagcagcag aacaatttgc tgagggctat tgaggcgcaa cagcatctgt      7920
     tgcaactcac agtctggggc atcaagcagc tccaggcaag aatcctggct gtggaaagat      7980
     acctaaagga tcaacagctc ctggggattt ggggttgctc tggaaaactc atttgcacca      8040
     ctgctgtgcc ttggaatgct agttggagta ataaatctct ggaacagatt tggaatcaca      8100
     cgacctggat ggagtgggac agagaaatta acaattacac aagcttaata cactccttaa      8160
     ttgaagaatc gcaaaaccag caagaaaaga atgaacaaga attattggaa ttagataaat      8220
     gggcaagttt gtggaattgg tttaacataa caaattggct gtggtatata aaattattca      8280
     taatgatagt aggaggcttg gtaggtttaa gaatagtttt tgctgtactt tctatagtga      8340
     atagagttag gcagggatat tcaccattat cgtttcagac ccacctccca accccgaggg      8400
     gacccgacag gcccgaagga atagaagaag aaggtggaga gagagacaga gacagatcca      8460
     ttcgattagt gaacggatcc ttggcactta tctgggacga tctgcggagc ctgtgcctct      8520
     tcagctacca ccgcttgaga gacttactct tgattgtaac gaggattgtg gaacttctgg      8580
     gacgcagggg gtgggaagcc ctcaaatatt ggtggaatct cctacagtat tggagtcagg      8640
     aactaaagaa tagtgctgtt agcttgctca atgccacagc catagcagta gctgagggga      8700
     cagatagggt tatagaagta gtacaaggag cttgtagagc tattcgccac atacctagaa      8760
     gaataagaca gggcttggaa aggattttgc tataagatgg gtggcaagtg gtcaaaaagt      8820
     agtgtgattg gatggcctac tgtaagggaa agaatgagac gagctgagcc agcagcagat      8880
     agggtgggag cagcatctcg agacctggaa aaacatggag caatcacaag tagcaataca      8940
     gcagctacca atgctgcttg tgcctggcta gaagcacaag aggaggagga ggtgggtttt      9000
     ccagtcacac ctcaggtacc tttaagacca atgacttaca aggcagctgt agatcttagc      9060
     cactttttaa aagaaaaggg gggactggaa gggctaattc actcccaaag aagacaagat      9120
     atccttgatc tgtggatcta ccacacacaa ggctacttcc ctgattagca gaactacaca      9180
     ccagggccag gggtcagata tccactgacc tttggatggt gctacaagct agtaccagtt      9240
     gagccagata agatagaaga ggccaataaa ggagagaaca ccagcttgtt acaccctgtg      9300
     agcctgcatg ggatggatga cccggagaga gaagtgttag agtggaggtt tgacagccgc      9360
     ctagcatttc atcacgtggc ccgagagctg catccggagt acttcaagaa ctgctgacat      9420
     cgagcttgct acaagggact ttccgctggg gactttccag ggaggcgtgg cctgggcggg      9480
     actggggagt ggcgagccct cagatcctgc atataagcag ctgctttttg cctgtactgg      9540
     gtctctctgg ttagaccaga tctgagcctg ggagctctct ggctaactag ggaacccact      9600
     gcttaagcct caataaagct tgccttgagt gcttcaagta gtgtgtgccc gtctgttgtg      9660
     tgactctggt aactagagat ccctcagacc cttttagtca gtgtggaaaa tctctagca       9719
//