Dbfetch

ID   CU468231; SV 1; circular; genomic DNA; STD; PRO; 6106 BP.
XX
AC   CU468231;
XX
PR   Project:PRJNA13001;
XX
DT   26-FEB-2008 (Rel. 94, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 5)
XX
DE   Acinetobacter baumannii SDF plasmid p1ABSDF, complete genome.
XX
KW   .
XX
OS   Acinetobacter baumannii SDF
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Moraxellaceae; Acinetobacter;
OC   Acinetobacter calcoaceticus/baumannii complex.
OG   Plasmid p1ABSDF
XX
RN   [1]
RP   1-6106
RA   Genoscope - CEA;
RT   ;
RL   Submitted (25-FEB-2008) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-6106
RX   DOI; 10.1371/journal.pone.0001805.
RX   PUBMED; 18350144.
RA   Vallenet D., Nordmann P., Barbe V., Poirel L., Mangenot S., Bataille E.,
RA   Dossat C., Gas S., Kreimeyer A., Lenoble P., Oztas S., Poulain J.,
RA   Segurens B., Robert C., Abergel C., Claverie J.-M., Raoult D., Medigue C.,
RA   Weissenbach J., Cruveiller S.;
RT   "Comparative analysis of Acinetobacters: three genomes for three
RT   lifestyles";
RL   PLoS One 3(3):e1805-e1805(2008).
XX
DR   MD5; 7c847558450003a6b3dc764a07ac66a9.
DR   BioSample; SAMEA3138277.
DR   PubMed; 16415984.
DR   PubMed; 18350144.
XX
CC   Annotation data relative to BLAST similarities, COG assignations,
CC   enzymatic function prediction (PRIAM software), TMHMM and SignalP
CC   predictions, and synteny results (Syntonizer software) are available in
CC   BaumannoScope database via the MaGe annotation system
CC   http://www.genoscope.cns.fr/agc/mage/baumannoscope.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6106
FT                   /organism="Acinetobacter baumannii SDF"
FT                   /plasmid="p1ABSDF"
FT                   /strain="SDF"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:509170"
FT   gene            469..1413
FT                   /locus_tag="ABSDF_p10001"
FT   CDS             469..1413
FT                   /transl_table=11
FT                   /locus_tag="ABSDF_p10001"
FT                   /product="putative replication protein"
FT                   /function="2.1.1 : DNA replication"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF_p10001"
FT                   /db_xref="EnsemblGenomes-Tr:CAP02936"
FT                   /db_xref="GOA:B0VVA6"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0VVA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP02936.1"
FT                   /translation="MKKICVLMKKELVVKDNALINASYNLDLSEQRLILLAILEARQSN
FT                   TPNDKDLTIHAESYINHFNVHRNTAYKVLKDACKSLFDRRFSYQKLTQKGNIENVISRW
FT                   VQRISYVENEALVRIKFSDDVVPLITNLEKHFTSYELEQVSSLTSVYAIRLYELLIAWR
FT                   STGKVILVELEELRLKLGIESHEYKRMGQFKEKVLHLAIDQINKYTDIKAEYEQHKRGR
FT                   SIIGFSFKFKQKQQPQKADSKRAPNTPDFFVKMTDAQRHLFANKMSEMPEMSKYSQGTE
FT                   SYQQFAIRIADMLLEPEKFRELYPILEKAGFKG"
FT   gene            complement(1403..1702)
FT                   /locus_tag="ABSDF_p10002"
FT   CDS             complement(1403..1702)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF_p10002"
FT                   /product="putative mobilization protein (mobS-like)"
FT                   /function="2.1.2 : DNA restriction/modification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF_p10002"
FT                   /db_xref="EnsemblGenomes-Tr:CAP02937"
FT                   /db_xref="UniProtKB/TrEMBL:B0VVA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP02937.1"
FT                   /translation="MVFYIPKLDVMTKSTENIEKKIEAQLEKIKQLKAQKQAIEARERT
FT                   KQKEQERKDDTRRKILLGSYLIKKMNANEANREKILAEFNEYLTDERDRKLFNL"
FT   gene            complement(1979..2683)
FT                   /locus_tag="ABSDF_p10003"
FT   CDS             complement(1979..2683)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF_p10003"
FT                   /product="hypothetical protein; putative signal peptide"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF_p10003"
FT                   /db_xref="EnsemblGenomes-Tr:CAP02938"
FT                   /db_xref="GOA:B0VVA8"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:B0VVA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP02938.1"
FT                   /translation="MKDFLFLFAFLLAIGKPVTSHADTTYETFDVHFVILTSNPSAQLV
FT                   ATLNQMQEEVNILNNYFVKEDRSPVVKFRFKSVSFYNDVKNSTCSFVSTVNSATPYDSD
FT                   GWATLFNSCNDPKVRDKNALNFYVYDGYSEANGFNEADSHGKRNSNRPYVMLDWQRINH
FT                   NTQSPEVHEMGHAFGLEHVCAPGATYNTSTNIMTTVCTGSSGGKRDIGFNAAQVNTIMY
FT                   YVPLIKAKLSKL"
FT   gene            2833..3057
FT                   /locus_tag="ABSDF_p10004"
FT   CDS             2833..3057
FT                   /transl_table=11
FT                   /locus_tag="ABSDF_p10004"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF_p10004"
FT                   /db_xref="EnsemblGenomes-Tr:CAP02939"
FT                   /db_xref="GOA:B0VVA9"
FT                   /db_xref="UniProtKB/TrEMBL:B0VVA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP02939.1"
FT                   /translation="MYSAIFIGLVVLVVMFLHFFVPSWDEIKQRRELAERYNMEIQSCL
FT                   VDGVSKPCVRIMRNQCNYDGGDLCVIDPK"
FT   gene            complement(3142..3564)
FT                   /locus_tag="ABSDF_p10005"
FT   CDS             complement(3142..3564)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF_p10005"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF_p10005"
FT                   /db_xref="EnsemblGenomes-Tr:CAP02940"
FT                   /db_xref="GOA:B0VVB0"
FT                   /db_xref="UniProtKB/TrEMBL:B0VVB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP02940.1"
FT                   /translation="MNKLLFFIHTKPLVFIGISSLFLFFLLYLIQYIYISLNLKEICKI
FT                   IFNDEKHFRLPLEPFNCFFISVLPIVFWRETLHLKYGTSFKKMYGKEFYYPIRKNQLKK
FT                   LLENFPLFFYVQYVIYLSGIFFLIFGGLAYIIDKNF"
FT   gene            complement(3573..4970)
FT                   /locus_tag="ABSDF_p10006"
FT   CDS             complement(3573..4970)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF_p10006"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF_p10006"
FT                   /db_xref="EnsemblGenomes-Tr:CAP02941"
FT                   /db_xref="UniProtKB/TrEMBL:B0VVB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP02941.1"
FT                   /translation="MHYSRLKLTVQTPLKLKDLTYKFVVTNNSTKKKTEFEGRFDDQGL
FT                   TGWTEIYNLNTSLIYEVYLRGEILQKIAVKAYPNKKTHSVFTIKVTSEITKNVKENIKE
FT                   IYLNDGEVAWYLIKKTETMLDWSKRVFKKPLNVSDWDTLKANNPHIPNMAPIRLLSPGM
FT                   VVVLSNSTTAKELPRYKKEAQEAQKRLEEMKKDKDFDAEFFAQNYEFFYDALNDSRTEI
FT                   TNENIFTNNDHPLIYQLDGSENESGVAWGSIGKGGIDATLAFHEGTVTRMNQIHGELAL
FT                   KMAEERAKGSGLANPKNFKAFRQKYKDLYKALDHEYSKGVFKWDRSIKTNNMRRIINQS
FT                   SLARGVTYKGGMKEYVEKMGELGKMSKVIKGGGYLFLALDIYNASDAIANAKPEEKAKT
FT                   AVVETSKIAGGLAGGAVGAFIVLTVATGGTSLIVLGVAAGASALVGWAGGEVGGYLGKE
FT                   GYELISK"
FT   gene            complement(4980..5345)
FT                   /locus_tag="ABSDF_p10007"
FT   CDS             complement(4980..5345)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF_p10007"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF_p10007"
FT                   /db_xref="EnsemblGenomes-Tr:CAP02942"
FT                   /db_xref="UniProtKB/TrEMBL:B0VVB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP02942.1"
FT                   /translation="MAGGSQIIISSDGITIKTPNEFKVFAGQHQFKSGAKVNATLPSLP
FT                   DAENPYILQYLVKNKDNLAVSNKPYILMDEDGNVQRGLTTDEGFIKLKTTPSAQTVVTR
FT                   VMMNEIEEANEEQTGEE"
FT   gene            5403..6071
FT                   /locus_tag="ABSDF_p10008"
FT   CDS             5403..6071
FT                   /transl_table=11
FT                   /locus_tag="ABSDF_p10008"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF_p10008"
FT                   /db_xref="EnsemblGenomes-Tr:CAP02943"
FT                   /db_xref="UniProtKB/TrEMBL:B0VVB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP02943.1"
FT                   /translation="MNMTFIVAVQLKDSIVVAVDNKYLTLKDKEKDHFEEHFSSKLYAW
FT                   HSGIITGTGEHYVIDKAVRLFINSADADIEKLPLCLNISRQIREMEVGQHEQIQSSKLL
FT                   YSQYSENGAKLFAIEPTEETGKYQRTEFKENDLIIWLFNPNIQSISGNLKTLYSNPRPK
FT                   VSFDRIEDWLDYYISAIAEIYEKQSCIDSWMSGSFDIFFQTEGEYFYKHIQNNPTVHLE
FT                   "
XX
SQ   Sequence 6106 BP; 2013 A; 1136 C; 973 G; 1984 T; 0 other;
     acagtatcaa aatttccacc ccgccttttc cctgattaca aagtttcctt ttacacctta        60
     acgagattaa ccgagcaaag cgacggtata acctttgcga aatgaccgag cgtaagcgag       120
     aaaaaataca tgagcgaagc gaattcatag ttgctttttc ttttggattt cccaactaaa       180
     attaaccaaa aactgcccct cgaatcgagc aaagcgagat tcaatagagt acgaacaaag       240
     tgagtaccaa gggcggtttt aagcactccc cctattttta atatttttta tttttttatt       300
     ttttagtgct cataatacta tgataaatat ataaaaaaat atcaataagt acacctttat       360
     cttgcaataa gtacaccttt atcttgcaat aagtacacct ttatcttgca ataagtacac       420
     ctttatcttg taaaatgaca cttaattaaa taaagtgtac ttataacctt gaaaaaaata       480
     tgtgtactta tgaagaagga acttgttgtc aaagacaatg cactaataaa tgccagttat       540
     aatttagacc tttcagaaca acgtctaata ttgttagcaa tccttgaagc tagacaatca       600
     aacacaccca atgataaaga tttaacaatt catgctgaaa gctatatcaa ccattttaac       660
     gttcatagaa atacagccta taaagtcctt aaagatgcat gtaagagtct atttgatcgt       720
     agattcagct atcaaaaact aactcagaag ggcaacattg aaaatgtaat aagccgatgg       780
     gtacaacgca tatcttatgt tgagaatgaa gctcttgttc gtattaagtt ttctgatgat       840
     gttgtaccgt tgattacaaa cttagaaaaa cacttcacca gttatgaatt agaacaagtc       900
     agtagtttaa ccagtgttta cgctatacgc ttatatgaat tgcttattgc atggcgtagt       960
     actggtaaag tcattttggt agagctagaa gaacttagat taaaactagg tatagaatcc      1020
     catgaatata agagaatggg gcaatttaaa gaaaaagttt tacaccttgc tattgatcaa      1080
     ataaacaaat acaccgatat aaaagcagag tatgaacaac acaaacgtgg ccgttcgatt      1140
     attggctttt catttaagtt taaacagaaa caacaacccc aaaaagcaga ttccaagcga      1200
     gcccctaaca ccccagactt ctttgtcaaa atgaccgatg cacaacgcca tctattcgcc      1260
     aataaaatgt ctgagatgcc tgaaatgagc aaatattcac aaggcacaga aagctatcaa      1320
     cagtttgcta tccgtatcgc tgacatgctt ttagagcctg aaaagtttag agagctttat      1380
     ccaatcttag aaaaagcagg gtttaaaggt taaagagctt ccgatctcgt tcgtctgtta      1440
     ggtactcatt gaattcagcc agtatttttt ctctattggc ttcattggca ttcatctttt      1500
     taatcaaata agaaccgagc aaaattttac gtcgggtgtc atctttgcgt tcctgctctt      1560
     tctgcttggt tctttctctg gcttcaattg cctgtttctg tgcttttaac tgcttaattt      1620
     tttctaactg cgcttcaatt ttcttttcaa tattttctgt agatttcgtc ataacgtcca      1680
     atttaggaat gtagaaaacc actcaagcat aaaactccat gaactagagt tcaagcgggc      1740
     tatatgctat cgtgtttttc atgaaatgcg cacttacgac ttggatttca tccaagtcaa      1800
     agttgcgtaa ggggaaaccc cttaacccca aaatgggctt gtgaaaagtt tggggtgttt      1860
     atttcaaata gccactctgg aggcattggt ctaactggaa catgaaagcc gacttcattt      1920
     ttcatatttc acccataaaa aaatccccat ataacgggga ttctaatcaa gaaaaaaatt      1980
     aaagcttcga taacttcgct tttattaatg gcacgtagta cataattgta ttaacttgcg      2040
     ctgcattaaa tcctatatcc ctcttgccac cagatgatcc agtgcaaaca gtagtcataa      2100
     tatttgtaga agtattatag gtagccccgg gagcacatac atgttccaaa ccaaaagcat      2160
     gtcccatttc atgcacttca ggtgattgag tattgtgatt aattctttgc cagtccaaca      2220
     ttacatatgg tcgattagag tttctctttc catgactatc tgcttcattg aagccatttg      2280
     cttcagaata accatcataa acataaaaat ttaaagcatt tttatctcta actttaggat      2340
     cattgcaact attaaacaat gttgcccacc catcagaatc atatggtgta gcagaattaa      2400
     ctgttgaaac aaatgaacat gttgaatttt ttacatcatt ataaaaagat acacttttga      2460
     agcgaaactt tactacagga gatcgatctt ctttgacaaa gtaattattt aaaatattaa      2520
     cttcttcttg catttgattt aatgttgcga ccagttgggc cgagggatta gaagtaagaa      2580
     taacaaaatg tacatcaaaa gtttcgtaag ttgtatcagc atgtgaggta actggtttac      2640
     cgatagccaa taaaaaagca aacaaaaaca aaaagtcctt catttcaatt taaccttaaa      2700
     ttcaaattaa tataaggtta acgatatata aaagcagatt ataaaaaagc aaaaaaaata      2760
     gatttccact tatccatata gtccagccta atataattaa agactcaacc atactaaatt      2820
     cacgttattt taatgtattc cgctattttt attggcttag tggtattggt ggtgatgttc      2880
     ttacacttct ttgtacccag ttgggatgaa attaaacaac gtagagaatt ggctgaacgc      2940
     tacaatatgg aaatacaaag ctgtcttgtt gatggcgtga gtaaaccttg tgtccgcatc      3000
     atgcgaaatc agtgcaacta tgatggtgga gatttgtgtg tgattgatcc taaatagttt      3060
     agggggatgt acttttcaag ataaaagggt aaatgaccta taaagagttg taatcctgag      3120
     tttcaagtgt aatattttta cttaaaaatt tttatctata atataagcaa gacctccgaa      3180
     tataaggaaa aaaattcctg ataggtaaat tacatattga acataaaaaa ataatggaaa      3240
     gttttccaat agttttttta gttgattttt tcttatagga taataaaact cttttccata      3300
     catcttttta aaagaggtgc cgtattttaa atgtagtgtt tcacgccaaa aaacaatagg      3360
     taaaacacta ataaaaaaac aattaaatgg ctctagtggc aacctaaagt gtttttcatc      3420
     attaaaaatg attttacata tctcttttaa atttaaagat atataaatat attgaattaa      3480
     ataaagtaaa aaaaatagaa atagacttga aataccaata aacaccaaag gcttagtatg      3540
     aataaaaaat aataatttat tcatagtgtt ttttacttgc tgataagttc ataaccctct      3600
     ttccctaagt agccgccaac ttctccccct gcccacccaa ctaaagcaga agcccctgca      3660
     gcgacaccaa gtactatgag tgaggttcct cctgttgcca cagtaagaac aataaatgct      3720
     ccaactgctc caccagccaa accacctgca atcttagaag tttccactac ggctgttttt      3780
     gctttttctt ctggctttgc attagcaatc gcatcactag cattataaat atctaaggct      3840
     aaaaataaat atccaccacc ttttataact ttactcattt ttccgagttc acccattttt      3900
     tctacatact ctttcatccc tcctttgtaa gtcactcctc tagctaatga agattgatta      3960
     atgattcttc tcatattgtt ggttttaata gacctatccc atttaaaaac accttttgaa      4020
     tattcgtggt ctaatgcttt gtataaatct ttatattttt gtcgaaaagc cttaaagttt      4080
     ttaggattgg cgagacctga acctttagcc ctctcctcag ccatcttcaa agctagttca      4140
     ccatgaattt gattcattct tgtaacggtt ccctcatgaa atgctagggt tgcatcaatc      4200
     cctcctttgc caatagatcc ccaagctacc ccactttcat tttctgaacc atcaagctga      4260
     taaatcaagg gatgatcatt attcgtaaat atattttcat tggtaatttc agttcgactg      4320
     tcattcaacg catcataaaa aaactcatag ttttgagcga agaattctgc atcaaagtcc      4380
     ttatccttct tcatttcttc taatcgtttt tgggcttctt gagcttcttt tttataccgt      4440
     ggtagttctt ttgctgttgt cgagtttgaa agaacaacaa ccattccagg gcttagtaat      4500
     ctaattggtg ccatattcgg tatatgaggg ttattggctt tcagcgtatc ccagtcagaa      4560
     acattgagtg gttttttaaa gactctttta gaccagtcta gcattgtttc tgttttctta      4620
     attaaatacc acgccacctc accatcattt aaataaattt ctttaatatt ttcttttaca      4680
     tttttggtaa tttcagatgt tactttaatg gtgaaaacac tatgcgtttt cttattggga      4740
     taagctttta cagcaatctt ttgaagaatt tcaccccgta aatagacctc ataaattagg      4800
     ctagtattta agttgtatat ttcagtccat cccgttaaac cttgatcatc gaaacgtcct      4860
     tcgaactctg tttttttctt agtagaatta ttggtcacaa caaatttata agttaaatct      4920
     tttaatttca aaggtgtttg tacggtaagt tttaagcgac tgtaatgcat attttaaacc      4980
     tattcttcgc ctgtctgttc ttcgttggct tcttcaatct cattcatcat cacccttgtg      5040
     acaactgttt gagcggatgg agttgtttta agtttgataa agccttcatc agtggttaaa      5100
     ccacgctgaa cattaccgtc ttcatccatt aaaatataag gcttatttga tacagctaaa      5160
     ttatctttat ttttcacaag atattgtaaa atatatgggt tttctgcatc gggtagtgat      5220
     ggcaaggtgg catttacttt agcaccgctt ttaaactgat gttgcccagc gaaaacttta      5280
     aattcattgg gtgtttttat ggttatacca tcagaagaaa tgataatttg tgaaccgcca      5340
     gccatgacta taccaattat aattttatca ataagctata cttaacatac aattcacgtt      5400
     ctatgaatat gactttcatt gtcgctgttc agttgaaaga tagtattgtc gttgcggtag      5460
     acaacaaata tttgaccctt aaagacaaag agaaagacca ctttgaagaa cactttagtt      5520
     ctaaattata cgcttggcac agtggaatta tcacaggaac aggtgaacac tatgttattg      5580
     acaaagcggt acgccttttt atcaatagtg ccgatgcaga cattgaaaaa ctaccgcttt      5640
     gcttaaacat atcaagacag attagagaaa tggaagtcgg acaacatgaa caaattcagt      5700
     cctcaaaact tttgtattca caatatagtg aaaacggagc aaaactattt gctatagaac      5760
     cgacagaaga aacgggaaaa tatcaaagaa cagaatttaa agaaaacgat ctcatcattt      5820
     ggctattcaa ccccaatatt caaagcattt caggaaacct aaagacgcta tattctaatc      5880
     cacgacccaa agtatccttt gatcgaattg aagactggct tgactactac atttcagcca      5940
     ttgccgagat ttatgaaaaa caaagttgta tagactcatg gatgagcggt agctttgata      6000
     tattttttca aacggaaggc gaatatttct ataaacacat tcaaaacaac ccaacggtcc      6060
     atttggaata gacacaagca ccgagcgagt ggctacgagc gattga                     6106
//