spacer

EBI Dbfetch

ID   CP002779; SV 1; circular; genomic DNA; STD; PRO; 1716818 BP.
XX
AC   CP002779;
XX
PR   Project:PRJNA66055;
XX
DT   08-JUN-2011 (Rel. 109, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Pyrococcus yayanosii CH1, complete genome.
XX
KW   .
XX
OS   Pyrococcus yayanosii CH1
OC   Archaea; Euryarchaeota; Thermococci; Thermococcales; Thermococcaceae;
OC   Pyrococcus.
XX
RN   [1]
RP   1-1716818
RX   DOI; 10.1128/JB.05345-11.
RX   PUBMED; 21705594.
RA   Jun X., Lupeng L., Minjuan X., Oger P., Fengping W., Jebbar M., Xiang X.;
RT   "Complete genome sequence of the obligate piezophilic hyperthermophilic
RT   archaeon Pyrococcus yayanosii CH1";
RL   J. Bacteriol. 193(16):4297-4298(2011).
XX
RN   [2]
RP   1-1716818
RA   Xu J., Liu L., Xu M., Oger P., Wang F., Zhai X., Jebbar M., Xiang X.;
RT   ;
RL   Submitted (09-MAY-2011) to the INSDC.
RL   Shanghai Jiao Tong Univ., #800, Dongchuan Road, Shanghai, China
XX
DR   MD5; 5837ad86e1cae75ec1ceb0e9456c11b5.
DR   BioSample; SAMN02603867.
DR   EnsemblGenomes-Gn; PYCH_r0.
DR   EnsemblGenomes-Gn; PYCH_r10.
DR   EnsemblGenomes-Gn; PYCH_r15.
DR   EnsemblGenomes-Gn; PYCH_r5.
DR   EnsemblGenomes-Gn; PYCH_t00.
DR   EnsemblGenomes-Gn; PYCH_t05.
DR   EnsemblGenomes-Gn; PYCH_t10.
DR   EnsemblGenomes-Gn; PYCH_t100.
DR   EnsemblGenomes-Gn; PYCH_t105.
DR   EnsemblGenomes-Gn; PYCH_t110.
DR   EnsemblGenomes-Gn; PYCH_t115.
DR   EnsemblGenomes-Gn; PYCH_t120.
DR   EnsemblGenomes-Gn; PYCH_t125.
DR   EnsemblGenomes-Gn; PYCH_t130.
DR   EnsemblGenomes-Gn; PYCH_t135.
DR   EnsemblGenomes-Gn; PYCH_t140.
DR   EnsemblGenomes-Gn; PYCH_t145.
DR   EnsemblGenomes-Gn; PYCH_t15.
DR   EnsemblGenomes-Gn; PYCH_t150.
DR   EnsemblGenomes-Gn; PYCH_t155.
DR   EnsemblGenomes-Gn; PYCH_t160.
DR   EnsemblGenomes-Gn; PYCH_t165.
DR   EnsemblGenomes-Gn; PYCH_t170.
DR   EnsemblGenomes-Gn; PYCH_t175.
DR   EnsemblGenomes-Gn; PYCH_t180.
DR   EnsemblGenomes-Gn; PYCH_t185.
DR   EnsemblGenomes-Gn; PYCH_t190.
DR   EnsemblGenomes-Gn; PYCH_t195.
DR   EnsemblGenomes-Gn; PYCH_t20.
DR   EnsemblGenomes-Gn; PYCH_t200.
DR   EnsemblGenomes-Gn; PYCH_t205.
DR   EnsemblGenomes-Gn; PYCH_t210.
DR   EnsemblGenomes-Gn; PYCH_t215.
DR   EnsemblGenomes-Gn; PYCH_t220.
DR   EnsemblGenomes-Gn; PYCH_t225.
DR   EnsemblGenomes-Gn; PYCH_t25.
DR   EnsemblGenomes-Gn; PYCH_t30.
DR   EnsemblGenomes-Gn; PYCH_t35.
DR   EnsemblGenomes-Gn; PYCH_t40.
DR   EnsemblGenomes-Gn; PYCH_t45.
DR   EnsemblGenomes-Gn; PYCH_t50.
DR   EnsemblGenomes-Gn; PYCH_t55.
DR   EnsemblGenomes-Gn; PYCH_t60.
DR   EnsemblGenomes-Gn; PYCH_t65.
DR   EnsemblGenomes-Gn; PYCH_t70.
DR   EnsemblGenomes-Gn; PYCH_t75.
DR   EnsemblGenomes-Gn; PYCH_t80.
DR   EnsemblGenomes-Gn; PYCH_t85.
DR   EnsemblGenomes-Gn; PYCH_t90.
DR   EnsemblGenomes-Gn; PYCH_t95.
DR   EnsemblGenomes-Tr; PYCH_r0.
DR   EnsemblGenomes-Tr; PYCH_r10.
DR   EnsemblGenomes-Tr; PYCH_r15.
DR   EnsemblGenomes-Tr; PYCH_r5.
DR   EnsemblGenomes-Tr; PYCH_t00.
DR   EnsemblGenomes-Tr; PYCH_t05.
DR   EnsemblGenomes-Tr; PYCH_t10.
DR   EnsemblGenomes-Tr; PYCH_t100.
DR   EnsemblGenomes-Tr; PYCH_t105.
DR   EnsemblGenomes-Tr; PYCH_t110.
DR   EnsemblGenomes-Tr; PYCH_t115.
DR   EnsemblGenomes-Tr; PYCH_t120.
DR   EnsemblGenomes-Tr; PYCH_t125.
DR   EnsemblGenomes-Tr; PYCH_t130.
DR   EnsemblGenomes-Tr; PYCH_t135.
DR   EnsemblGenomes-Tr; PYCH_t140.
DR   EnsemblGenomes-Tr; PYCH_t145.
DR   EnsemblGenomes-Tr; PYCH_t15.
DR   EnsemblGenomes-Tr; PYCH_t150.
DR   EnsemblGenomes-Tr; PYCH_t155.
DR   EnsemblGenomes-Tr; PYCH_t160.
DR   EnsemblGenomes-Tr; PYCH_t165.
DR   EnsemblGenomes-Tr; PYCH_t170.
DR   EnsemblGenomes-Tr; PYCH_t175.
DR   EnsemblGenomes-Tr; PYCH_t180.
DR   EnsemblGenomes-Tr; PYCH_t185.
DR   EnsemblGenomes-Tr; PYCH_t190.
DR   EnsemblGenomes-Tr; PYCH_t195.
DR   EnsemblGenomes-Tr; PYCH_t20.
DR   EnsemblGenomes-Tr; PYCH_t200.
DR   EnsemblGenomes-Tr; PYCH_t205.
DR   EnsemblGenomes-Tr; PYCH_t210.
DR   EnsemblGenomes-Tr; PYCH_t215.
DR   EnsemblGenomes-Tr; PYCH_t220.
DR   EnsemblGenomes-Tr; PYCH_t225.
DR   EnsemblGenomes-Tr; PYCH_t25.
DR   EnsemblGenomes-Tr; PYCH_t30.
DR   EnsemblGenomes-Tr; PYCH_t35.
DR   EnsemblGenomes-Tr; PYCH_t40.
DR   EnsemblGenomes-Tr; PYCH_t45.
DR   EnsemblGenomes-Tr; PYCH_t50.
DR   EnsemblGenomes-Tr; PYCH_t55.
DR   EnsemblGenomes-Tr; PYCH_t60.
DR   EnsemblGenomes-Tr; PYCH_t65.
DR   EnsemblGenomes-Tr; PYCH_t70.
DR   EnsemblGenomes-Tr; PYCH_t75.
DR   EnsemblGenomes-Tr; PYCH_t80.
DR   EnsemblGenomes-Tr; PYCH_t85.
DR   EnsemblGenomes-Tr; PYCH_t90.
DR   EnsemblGenomes-Tr; PYCH_t95.
DR   EuropePMC; PMC3147706; 21705594.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00058; HgcF.
DR   RFAM; RF00060; HgcE.
DR   RFAM; RF00062; HgcC.
DR   RFAM; RF00063; SscA.
DR   RFAM; RF00064; HgcG.
DR   RFAM; RF00065; snoR9.
DR   RFAM; RF00095; snoPyro_CD.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01119; sR32.
DR   RFAM; RF01121; sR38.
DR   RFAM; RF01122; sR39.
DR   RFAM; RF01124; sR36.
DR   RFAM; RF01125; sR4.
DR   RFAM; RF01126; sR41.
DR   RFAM; RF01128; sR43.
DR   RFAM; RF01129; sR44.
DR   RFAM; RF01130; sR46.
DR   RFAM; RF01131; sR47.
DR   RFAM; RF01132; sR48.
DR   RFAM; RF01133; sR3.
DR   RFAM; RF01136; sR28.
DR   RFAM; RF01138; sR23.
DR   RFAM; RF01140; sR20.
DR   RFAM; RF01141; sR18.
DR   RFAM; RF01142; sR19.
DR   RFAM; RF01145; sR14.
DR   RFAM; RF01147; sR12.
DR   RFAM; RF01148; sR13.
DR   RFAM; RF01149; sR10.
DR   RFAM; RF01150; sR11.
DR   RFAM; RF01152; sR1.
DR   RFAM; RF01273; sR34.
DR   RFAM; RF01274; sR45.
DR   RFAM; RF01275; sR22.
DR   RFAM; RF01297; sR40.
DR   RFAM; RF01303; sR49.
DR   RFAM; RF01304; sR5.
DR   RFAM; RF01305; sR51.
DR   RFAM; RF01307; sR55.
DR   RFAM; RF01308; sR58.
DR   RFAM; RF01309; sR60.
DR   RFAM; RF01311; sR8.
DR   RFAM; RF01319; CRISPR-DR6.
DR   RFAM; RF01350; CRISPR-DR41.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002779.
DR   SILVA-SSU; CP002779.
XX
CC   The source DNA and the strain are available from Mohamed Jebbar
CC   (E-mail: Mohamed.Jebbar@univ-brest.fr) or Xiao Xiang (E-mail:
CC   xoxiang@sjtu.edu.cn).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1716818
FT                   /organism="Pyrococcus yayanosii CH1"
FT                   /strain="CH1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:529709"
FT   gene            complement(30..863)
FT                   /locus_tag="PYCH_00010"
FT   CDS             complement(30..863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00010"
FT                   /product="ferredoxin-NADP(+) reductase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00010"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23714"
FT                   /db_xref="GOA:F8AF40"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="UniProtKB/TrEMBL:F8AF40"
FT                   /protein_id="AEH23714.1"
FT                   /translation="MFPILRKERLAPGINLFEIKAPKIARHAKPSQFIILRLHERGERI
FT                   PLTIADHDPERGTITIVAQEVGKTTHELGTYEEGDAILDILGPLGRPSHIDRFGTVVMI
FT                   GGGVGVAEIYPVAKAMKEVGNYVISILGFRTKELVFWEDKLRNVSDEVIVTTNDGSYGM
FT                   KGFTTHALAKLIEEGKRIDLVHAVGPVVMMKAVAELTRQYGIKTVASLNPIMVDGSGMC
FT                   GACRVTVGGQVKFACVDGPEFDAHLVDWDELMKRLTYYRELEIMSFERWKGREGR"
FT   gene            1016..2029
FT                   /locus_tag="PYCH_00020"
FT   CDS             1016..2029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00020"
FT                   /product="NiFe hydrogenase II, subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00020"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23715"
FT                   /db_xref="GOA:F8AF41"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:F8AF41"
FT                   /protein_id="AEH23715.1"
FT                   /translation="MMRYVKLPSENLPEFFNRLKKLGKVYAPVQRGSTYSFEQVEYIDD
FT                   VALHYTRTVLPPKKFFVRPRDPMFKLRGSRWEEVKDGEPSVIFGIHACDIHGLKILDRV
FT                   YLGEPPDPYYKARREKAFIVGISCMPDEYCFCKSLGTDFAMDGFDLFLHELPDGWLVRV
FT                   GSVRGHEVVWENEGLFEEVTDEDIRHFREFEDRRAKAFKRSLNREGLADILDLAFHSPV
FT                   WKKYAEICLGCGNCNVVCPTCRCYEVCDKWINAYEAVRERRYDSCFMESHGLVAGGHNF
FT                   RPTRLDRFRHRYYCKSYFGTEGFNCVGCGRCDEFCPARIEHVKVLDDVRGVSYEPV"
FT   gene            2016..2882
FT                   /locus_tag="PYCH_00030"
FT   CDS             2016..2882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00030"
FT                   /product="cytochrome-c3 hydrogenase subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00030"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23716"
FT                   /db_xref="GOA:F8AF42"
FT                   /db_xref="InterPro:IPR001221"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="UniProtKB/TrEMBL:F8AF42"
FT                   /protein_id="AEH23716.1"
FT                   /translation="MNPFKSHDVRILEVRELTPREKLFTLRFLDPEVEENFTFRPGQFV
FT                   IVDVRGFGEFPISICSPPTRKPLQLCIRKAGRMTRFIHGMTEGDVVGIRGPYGNGFPVE
FT                   KMEGSNLILVAGGLGMAPLRSILWYAIDTGRFEKTYLFYGTKSYEDILFKDEILYLLKH
FT                   GEKLNCHVKLAYEVETPSCIYLERGFSEKVCRGVVTDLFRGEEFDVHNTYALICGPPIM
FT                   YRFVIRELLNRGLSPGRIYMTLERRMRCGVGKCGHCIVGTSTSIKYVCRDGPVFNYWDA
FT                   LSTRGLI"
FT   gene            2879..3616
FT                   /locus_tag="PYCH_00040"
FT   CDS             2879..3616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00040"
FT                   /product="NiFe hydrogenase II, subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00040"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23717"
FT                   /db_xref="GOA:F8AF43"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="UniProtKB/TrEMBL:F8AF43"
FT                   /protein_id="AEH23717.1"
FT                   /translation="MMEKLRLGVFELTDCGGCALNLLFLYEKFFDVLEFYEITEFHMAT
FT                   SIKEKGPLDIALVTGTVSTQRDLDLLREARNRAKYLIALGTCATHGSLQASVEGRIRDR
FT                   LERVYGTRANPMKALESKPVTDYVPVDYALPGCPYDKEELFQVLMEIAKGVEPVRKDYP
FT                   VCLECKLNEYECVFLKRNIPCLGPVTYGGCNAPCVRSGLGCIGCRGPLPGANLPGHVEV
FT                   LRSLGLDDEEIARKLRTFARWEP"
FT   gene            3613..4857
FT                   /locus_tag="PYCH_00050"
FT   CDS             3613..4857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00050"
FT                   /product="NiFe hydrogenase II, catalytic subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00050"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23718"
FT                   /db_xref="GOA:F8AF44"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:F8AF44"
FT                   /protein_id="AEH23718.1"
FT                   /translation="MIIEIGEFTRVEGNGRAEVIVEDGEVRKVKLKIIEGPRFFELLTL
FT                   GRHFYDVPDLEARICAICYLAHSTASVMAIERAFDVEVPEEIQLLRELGLLGEFLESHA
FT                   LHLYLLAMPDLFGYPDAIRMATRHGELVREGLAIKAFGNYIRELIGGREIHGINVKPGG
FT                   FGRYPSVRELETIERRSESLIRFARRAASTFASQEPMGAKAELFVATDGYLFGDELVAS
FT                   DGERFHYTEIEEHSLEYSFAKQSLYRGKPFFVGALARLIIKGDQLTPIARKLLEEHWEK
FT                   LSTGYVTYNNLAQAIELVYALERVAEIARTLLDRGIQGENVPIEVREGEGIGYVEAPRG
FT                   VLVHHYRIDSGGRVTFSNIITPTAFNHAMIELSLFEEAKRRYGELPEMEFVQRLEEVVR
FT                   AFDPCISCSVHVVRL"
FT   gene            4899..5363
FT                   /locus_tag="PYCH_00060"
FT   CDS             4899..5363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00060"
FT                   /product="hydrogenase-specific maturation endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00060"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23719"
FT                   /db_xref="GOA:F8AF45"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:F8AF45"
FT                   /protein_id="AEH23719.1"
FT                   /translation="MSGKTLIIALGNDVMGDDGFGLRVGRILMERGHNVLEVGTDIFKL
FT                   AQYYEGEERLIIIDAILSDELEPGTLVHLSGEEVFERLKGEIRSAHFMGAIDALRLLMA
FT                   LDERLARAEIHFVGVVVRRIELGMELSSEVEAAVPRAVELIERIVRGKVR"
FT   gene            5360..5605
FT                   /locus_tag="PYCH_00070"
FT   CDS             5360..5605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00070"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23720"
FT                   /db_xref="UniProtKB/TrEMBL:F8AF46"
FT                   /protein_id="AEH23720.1"
FT                   /translation="MNILAPLAVGILLGYLLRGRISLDTEKLMGISIILLVFLMGVEAG
FT                   NVEVNALNIAGMAAAFALATTAGSLLMAALLRRAME"
FT   gene            5602..6189
FT                   /locus_tag="PYCH_00080"
FT   CDS             5602..6189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00080"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23721"
FT                   /db_xref="InterPro:IPR005642"
FT                   /db_xref="UniProtKB/TrEMBL:F8AF47"
FT                   /protein_id="AEH23721.1"
FT                   /translation="MRFTYAVIAALLLGFAAGRLGLRTGDTYELALYFLIFVIGLDIGK
FT                   EGRLSELRKVGRLSLVLPFSTLVGSILGGTIVSVAFGIPILWGLAVASGVGWYSLTGPV
FT                   LAQHSPFYGLLGFFANFLREVLTIVAYPLLVRVLPPEVALSIGGATTMDSTLPIIAKFG
FT                   GRDVVLLAFIHGFILSLLVPFVVPLLAGLAAG"
FT   gene            6235..7500
FT                   /locus_tag="PYCH_00090"
FT   CDS             6235..7500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00090"
FT                   /product="ribulose bisophosphate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00090"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23722"
FT                   /db_xref="GOA:F8AF48"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR017444"
FT                   /db_xref="InterPro:IPR017712"
FT                   /db_xref="UniProtKB/TrEMBL:F8AF48"
FT                   /protein_id="AEH23722.1"
FT                   /translation="MSKVEWYLDFVDLDYTPGRDELIVEYYFEPNGVSPEEAAGRIASE
FT                   SSIGTWTTLWKLPDMAKRSMAKVFSLEKSGEGYIAKIAYPLTLFEEGNLVQLFSAIAGN
FT                   IFGMKALKNLRLLDFHPPYEYLRHFKGPQYGVKGIREFMGIEDRPLTATVPKPKMGWSV
FT                   DEYAEIAYELWSGGIDLLKDDENFTSFPFNRFEERVRKLYAVRDRVEAETGETKEYLIN
FT                   ITGPAHVMEKRAQLVAAEGGQYIMIDIVVVGWSALQYMREVAEDLGLAIHAHRAMHAAF
FT                   TRNPRHGISMFVLAKAARMVGVDQIHTGTAVGKMAGDYEEVKRINGFLLSEWEHIKPIF
FT                   PVASGGLHPGLMPELIRLFGRDLVIQVGGGVMGHPDGPRAGAKALRDAIEAAIEGVSLE
FT                   EKAKESPELKKALEKWGYLKPK"
FT   gene            7547..7735
FT                   /locus_tag="PYCH_00100"
FT   CDS             7547..7735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00100"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23723"
FT                   /db_xref="UniProtKB/TrEMBL:F8AF49"
FT                   /protein_id="AEH23723.1"
FT                   /translation="MDRKLDDFINGAPKRKDVPRARPKKKLKATNLDDFLPEEHINFFR
FT                   NLRIGSKKIARKRVEEL"
FT   gene            complement(7865..9022)
FT                   /locus_tag="PYCH_00110"
FT   CDS             complement(7865..9022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00110"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00110"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23724"
FT                   /db_xref="GOA:F8AF50"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F8AF50"
FT                   /protein_id="AEH23724.1"
FT                   /translation="MLGEEHVRLAMELIRAGYDEKRIRQKLGLSKEEADEAIEVARARM
FT                   RARDKFSRDDLWLDLEGLRYATHELVADYRGKRLREQGVKSIADVSCGVGIQVIFFAKH
FT                   GIRAIGVDIDPKKVEYARRNAEKFGVKVEFIHGDALSPEVIGRIDAQVVFSDPARPPEV
FT                   PERSLEGLLPSPLKVYEVYKERVEAFIFDLPPQIRREKVPWKGEFEYIDLFGHLNRLTF
FT                   YTEPLAKAERSAVILPQGVRLESNPDLEPIVEWTNTPGHYLYEIPQAVDYADLINELFH
FT                   AVKGELKLLLREKRRVLATGEEELRSPYFKRAYVVVATMPFHPVRINDFLRKEGYGRAT
FT                   LRISVPDSEYWRIRKKIEAGLRGERRAFVFQVGNTAVIAEELGKV"
FT   gene            complement(9001..10281)
FT                   /locus_tag="PYCH_00120"
FT   CDS             complement(9001..10281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00120"
FT                   /product="glucose-1-phosphate thymidylyltransferase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00120"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23725"
FT                   /db_xref="GOA:F8AF51"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F8AF51"
FT                   /protein_id="AEH23725.1"
FT                   /translation="MKAVILAAGLGTRMGEKPKGLLKVAGREIIYRTMRILEELGVEEF
FT                   VIVTNPRYEPFYRAFVERNGFRAEIVINEHPERGNGYSLHLARGSVDGRFVLLMSDHVY
FT                   ERAFLERAIRGEGLIADRVGRFVDIDEATKVKVEGGRVKEIGKDLKEWDALDTGFFVLD
FT                   ASIFTVTEELAKEKDVVELKDVVKRAELPVTYVDGLFWMDVDTPQDVGRARKLLVMASI
FT                   KGTGDGFISRHLNRKISTRISALLVDRVTPNQMTVVTFFLGLFAALLNFVSMPLAGIMY
FT                   QIASILDGVDGEIARAAMKGSQFGGYLDSILDRYVDFAFLLTLAYVTLTEPFWWAIAAL
FT                   AMFSSAMVSYSTERYKGAYFSDAYKDIKRLRRLPGKRDERIFVTMLFLLFGLVKPLFAL
FT                   LAVWSTLRVAMTVYLVWREKGCSERST"
FT   gene            complement(10334..11554)
FT                   /locus_tag="PYCH_00130"
FT   CDS             complement(10334..11554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00130"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00130"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23726"
FT                   /db_xref="GOA:F8AF52"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015901"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="UniProtKB/TrEMBL:F8AF52"
FT                   /protein_id="AEH23726.1"
FT                   /translation="MFRLEDFDYSGKTVFLRADLNSPMKDGKIISDARFRAVLPTIRYL
FT                   LENGAKVVVATHQGKPYGEDYATTEEHARILGELLGQEVEYVEDIFGRYAREKIKTMKP
FT                   GDVIMLENLRFTAEEVKQKPLEDCEKTFLVKKLSPLIDYVVNDAFAAAHRSQPSLVGFA
FT                   RLKPMVMGRLMEREIKALSKAYESEERPRVYVLGGAKVDDSLRVAENVLKKGKADLILT
FT                   GGLVGHVFILAKGFDLGRVNVEFLERKGLLEFVDWAERILDEFYPYIRTPVDFAIDYKG
FT                   ERVEIDIISDEKRLFDEYPILDIGTRTVEKYREILLEAKVIVANGPMGVFEREEFALGT
FT                   VGVFRAIAESDAFSVIGGGHSIASLQRYNITGISHISTGGGAMLTFFSGEKLPVLEALR
FT                   VSYERFS"
FT   gene            11661..12437
FT                   /locus_tag="PYCH_00140"
FT   CDS             11661..12437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00140"
FT                   /product="ORFZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00140"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23727"
FT                   /db_xref="GOA:F8AF53"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="UniProtKB/TrEMBL:F8AF53"
FT                   /protein_id="AEH23727.1"
FT                   /translation="MRVAVITSDARVYYIAAKVLKEQRIPFYSLRVGEDIPFDVEVVLT
FT                   SEKDYEKVSFPVKIIVRDESFIDELLAKLEGRRFKRVYIAIDPGERPGVSVVADNRVLE
FT                   VYHLKSPKDIGVIIQLLEKYPKAKIKIGHGAKMHRILMLKALARVLGEDYPVIVVNERG
FT                   TTPRVGGIEGWGIQDIVASINIGLREGREVTIRELIRGDKVTKGEIEHIKSQSRILSGG
FT                   KITISSELAREVALGNLTLEEAIEIQKRRGRKDDTG"
FT   gene            12424..14934
FT                   /locus_tag="PYCH_00150"
FT   CDS             12424..14934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00150"
FT                   /product="cell division control protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00150"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23728"
FT                   /db_xref="GOA:F8AF54"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="UniProtKB/TrEMBL:F8AF54"
FT                   /protein_id="AEH23728.1"
FT                   /translation="MILGRGEEVKDEIKLRVAEALKRDVGRGIVRFDRKYQRMLGVEPG
FT                   DIVELEGERVTAAIVANAHPDDRGLDIIRMDGYIRRNAGVSIGDYVTVRKAEVKEAKKV
FT                   VLAPAQKGVIIQIPGEIVKNNLLGRPVVKGDVVVASSRGEFYTGSPFDELFRGFFESLP
FT                   LAFSELKFVVVNTIPKGIVQITYNTEVEVLPQAVEVREEKVPEVTYEDIGGLKDAIEKI
FT                   REMVELPLKHPELFERLGIEPPKGVLLYGPPGTGKTLLAKAVANEANAHFIAINGPEIM
FT                   SKYYGESEERLRQVFKEAEENAPSIIFIDEIDAIAPKREEVIGEVEKRVVSQLLTLMDG
FT                   LKSRGKVIVIAATNRPDAIDPALRRPGRFDREIEVGVPDKQGRKEILQIHTRGMPIEPD
FT                   FDKDTVLRILRELKLEDRLDGKRIEVLERKIQGAKTEEEVKEILKEYGEIYSEVKARLI
FT                   DRLLDELAERTHGFVGADLAALAREAAMVVLRRLIREGKINPEADSIPREVLEELKVTR
FT                   KDFYEALKMVEPSALREVLIEVPNVRWDDIGGLEEVKQELREAVEWPFKYPKAFKRLGI
FT                   TPPKGILLYGPPGTGKTLLAKAVATESQANFIAIRGPEVLSKWVGESEKRIREIFRKAR
FT                   QAAPAIIFIDEIDAIAPARGAVEGERVTDRLINQLLTEMDGIEENSGVVVIAATNRPDI
FT                   LDPALLRPGRFDRLILVPAPDERARLEIFRVHTRNMPLAKDVNLEELAKKTEGYTGADI
FT                   AALVREAALNAMRRVLLTLPKRLVEEENEEFLGKLVVTRKDFEEALKRVKPSVTKYMME
FT                   YYRQFEESRKRAAGETRELDYFTG"
FT   gene            complement(14995..16236)
FT                   /locus_tag="PYCH_00160"
FT   CDS             complement(14995..16236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00160"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase (rumA)"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00160"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23729"
FT                   /db_xref="GOA:F8AF55"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:F8AF55"
FT                   /protein_id="AEH23729.1"
FT                   /translation="MRGRVVDMDEEGLGILENGIRVPFTVVGDHVEVHRTVNRFGKVLA
FT                   KEFKVLEKSSLRQRPRCVHVGRCGGCLWGHVKYGEQLRLKRELFERITGISAEIKGSPK
FT                   VWSFRSVSNFIVTIRGMGLKEFGDPRTVVNLRECPVFSSRTPQYLHTLRAFLKETGLRP
FT                   WGPKGGDVHYLQVREGKFTGDIMINIIAHGEAKPEVLEAFRNYFSFASSLYWSIKADER
FT                   DDPKGEPLHVGGEPYIRERILGVTYLIHPASFFQTNSYALPLLLKAVEGFIDGSRVLDL
FT                   YSGVGTFGVYLAKRGFEVEGVEINPFAVEMANRNAKINDVQAEFKVGRAEDVLIGSYDT
FT                   VIVDPPRKGLKDGAKRLMKGPARIVYVSCNPRAFKLDYERHLSKVYRIEDVILIDMFPH
FT                   TPHVEAVVKLVRKF"
FT   gene            complement(16233..16952)
FT                   /locus_tag="PYCH_00170"
FT   CDS             complement(16233..16952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00170"
FT                   /product="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00170"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23730"
FT                   /db_xref="GOA:F8AF56"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR005237"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022427"
FT                   /db_xref="InterPro:IPR030662"
FT                   /db_xref="UniProtKB/TrEMBL:F8AF56"
FT                   /protein_id="AEH23730.1"
FT                   /translation="MGLTDAFSTGMRVAVLYSGGKDSNYALYWALEKGLDVRFLVTMVS
FT                   ENEESYMYHVPNVHLTELQARALGIPLVKGFTEGRKEEEVEDLKRVLEGLKVEGIVAGA
FT                   LASRYQRERIERVAEELGLKTFAPAWGRDPVEYMRELVRLGFDIVFVGVSAYGLDEGWL
FT                   GRRVNEEAIRELEKLRDKYGIHVAGEGGEFETFVRDMPYFRARVVFDEVERIWDGCTGS
FT                   GKLVVKAAHLEPKGGTR"
FT   gene            complement(17007..17201)
FT                   /locus_tag="PYCH_00180"
FT   CDS             complement(17007..17201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00180"
FT                   /product="zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00180"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23731"
FT                   /db_xref="GOA:F8AF57"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:F8AF57"
FT                   /protein_id="AEH23731.1"
FT                   /translation="MAVLKAIKIRDRDGEILFRCPRCGMVFRRSKDYIRHVNKAHGWLF
FT                   GRGKPKGKRLQKKYSKNAS"
FT   gene            complement(17260..17337)
FT                   /locus_tag="PYCH_t50"
FT   tRNA            complement(17260..17337)
FT                   /locus_tag="PYCH_t50"
FT                   /product="tRNA-Gly"
FT   gene            17451..18209
FT                   /locus_tag="PYCH_00190"
FT   CDS             17451..18209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00190"
FT                   /product="Carbohydrate kinase, putative, PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00190"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23732"
FT                   /db_xref="GOA:F8AF58"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:F8AF58"
FT                   /protein_id="AEH23732.1"
FT                   /translation="MKCIVVGHLTKDILNGRERIGGGAYYSSLALSELCKVTVITKVGP
FT                   DFPRKWLEGLRERGVDVRTLPSSATTTYKFTYRDGWRELTLLSKGDPFTDEELVGVKGD
FT                   LIILNPVAGEIAPRQVAFFDNPSLDVQGFIRGFENGRVVLRETDGSFLSAARVVHASVE
FT                   EFRVLKNISLPEVLLVTNGASEGFAVVRGRKYIIKPYRVDVRDTTGAGDVFLAFFSYLY
FT                   TRLPFTEALDGALRMTAEFLKGRDDDASIG"
FT   gene            18249..18782
FT                   /locus_tag="PYCH_00200"
FT   CDS             18249..18782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00200"
FT                   /product="ADP-ribose pyrophosphatase (MutT)"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00200"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23733"
FT                   /db_xref="GOA:F8AF59"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:F8AF59"
FT                   /protein_id="AEH23733.1"
FT                   /translation="MERYVLLVKALKGVDVTPFRERVKALAREFGLRAEMYRCIGLTVD
FT                   LVILYEGGVVLVKRGKEPYKDHWALPGGFVEYGETVEEAAVREAKEETGLDVKLLSLVG
FT                   VYSRPDRDPRGHTVTIAFLALGLGELKAGDDAREVRVFPIDALPRLPLAFDHADILRDA
FT                   LGGRIGWGRSSSAG"
FT   gene            18755..19105
FT                   /locus_tag="PYCH_00210"
FT   CDS             18755..19105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00210"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23734"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFC7"
FT                   /protein_id="AEH23734.1"
FT                   /translation="MGKVKFGRITIDGRTFEHDIVVYPSGRIDRRRKEISKRKHGTSHR
FT                   LDPEELKEYLKEDFDVLLVGTGIYGMLSLLPEAKELVKNREVIEKPTPEALELFEELRK
FT                   EKRVLAIFHVTC"
FT   gene            complement(19102..20547)
FT                   /locus_tag="PYCH_00220"
FT   CDS             complement(19102..20547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00220"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23735"
FT                   /db_xref="InterPro:IPR018646"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFC8"
FT                   /protein_id="AEH23735.1"
FT                   /translation="MLRLLYRELRYRIMKDNPMIAGDPEKLEKNLKHQGSILWSVGLQS
FT                   IVYLGLGAMLGASIYFAKEGRAVIFASYLLLPFIISLYTSTLNVSYAVSMGIFEPLKPL
FT                   PVKSSPLYLSALILLDVVPAFFLLLPAVLALANVPAALLGILWTLTAIFMGHSLGLFIY
FT                   VHFGTIHVGRRSILKNIGKTIGILLIVGIYYVIRFMEDYIESHIEMLAGIFERYSFAFP
FT                   MAASTVYEPLKSIGLLTLYMAFSLALYIYTLRRVWEAVSEPRVVGKTGEGFRLSVKEPV
FT                   VAVALKDLKTVFRRSQLLASFLVPVYVVFYPLYQAISSGLRPSETLLVLLIVSLLTSML
FT                   SDAALKLEAEGFEFLRTLPLQRETFLMGKALTMAAIPTGMVAILVTLSVLLNGAKALPL
FT                   LLYLPLPLATALISVAYVASKMGDDIAMPKMGFVDSIAMFLLTLIPVLLIGIAHLLIGH
FT                   PEDYLAGFIIEMAVMLTASRILR"
FT   gene            complement(20548..21309)
FT                   /locus_tag="PYCH_00230"
FT   CDS             complement(20548..21309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00230"
FT                   /product="ABC transporter, ATP-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00230"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23736"
FT                   /db_xref="GOA:F8AFC9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFC9"
FT                   /protein_id="AEH23736.1"
FT                   /translation="MIEVERLTKRYGGAIAVNDITFTVNDGEIYGLLGPNGSGKSTTLK
FT                   IIAGIIKPTSGRVIVEGIDVLKDPMAVKRISGYVPETPVLYESLTPTEFFSFVGSVRGI
FT                   EEDVLEDRVRRLVEAFGIEKYMNQLIGTLSFGTRQKISLISALLHDPKVLILDEAMNGL
FT                   DPKSARVFRELLMEFKAESKSIIFSTHVLALAELVCDRIGLIHNGKLIAEGTVEELKEL
FT                   AKEESLEDVFLKLTEAKDEVAILVNVLKEAL"
FT   gene            21632..22756
FT                   /locus_tag="PYCH_00240"
FT   CDS             21632..22756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00240"
FT                   /product="thermophile-specific fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00240"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23737"
FT                   /db_xref="InterPro:IPR002803"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFD0"
FT                   /protein_id="AEH23737.1"
FT                   /translation="MAVGEKITISVIKADVGGWPGHSRVHPALIERAKEVLAEAQKEGT
FT                   IIDFYVTYVGDDLQLIMTHKKGVDSPDVHGLAWEAFKKATEVAKALGLYGAGQDLLKDA
FT                   FSGNVRGLGPSVAEMEITLRKSEPIVTFHLDKTEPGAFNLPIFRMFADPFTTAGLVIDP
FT                   KMHMGFRFEIWDILEHKRVIMSSPEEMYDILALIGAKSRYVIKRVFPKEGHPIPKDEPV
FT                   AVVSTEKLYEVAGEYVGKDDPVAIVRAQSGLPALGEVLEPFAFPHLVSGWMRGSHNGPL
FT                   MPVPLKYATPTRFDGPPRAVALGWQISPEGKLVGPVDLFDDPAFDYARQKALEITEYMR
FT                   RHGPFEPHRLPLEEMEYTTLPGVLEKLKDRFEPV"
FT   gene            complement(22759..24111)
FT                   /locus_tag="PYCH_00250"
FT   CDS             complement(22759..24111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00250"
FT                   /product="sun protein (fmu protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00250"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23738"
FT                   /db_xref="GOA:F8AFD1"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011023"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFD1"
FT                   /protein_id="AEH23738.1"
FT                   /translation="MELFYRVSLQEIVADALTLVEERELSSKHALERIFSKVEGRDREK
FT                   ARGIAHAYVFEIEKWRAKIDFIINSVLRGSKVDDLDPYLANLLRIGTFEMKFKGVNPAI
FT                   ATDSIVRVVKERFDLAKAKFVNAILREVEKFDVERALKKLKEKDRVEWLSVRFSHPRWY
FT                   VEYVINLLGYDEAVRLLLSNLRPQRYYIRVNTLKADVDKVKKYLEENGVRVAYTPVDDV
FT                   LKVLDYETPVTRLEWYKRGYFVIQDLASAYVAHVLKPEPGERVLDLAAAPGSKTFHAAA
FT                   LMENKGEIVAVDYSYERLIKMKERMKRLGVKNVRLVHADGQNFKDERDFDKIILDAPCS
FT                   SSGTYRQFPEVKWRFDENKIKRVISVQRNMLLNAYENLRADGEMTYSTCSIRIDENEEN
FT                   VLFALERGFALIKHPFNWGDRGFLEIGERVFRTWTHRHDCNSFFIAKLRKE"
FT   gene            24200..24829
FT                   /locus_tag="PYCH_00260"
FT   CDS             24200..24829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00260"
FT                   /product="zinc finger family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00260"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23739"
FT                   /db_xref="GOA:F8AFD2"
FT                   /db_xref="InterPro:IPR004457"
FT                   /db_xref="InterPro:IPR004470"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFD2"
FT                   /protein_id="AEH23739.1"
FT                   /translation="MGELKPEMIQELRLGDCPICGGKGTLKAIQLIHRIPYFGEVMEST
FT                   VICEKCGYKSADVMILEEREPRLYEVRVEEERDLFTRVVRSKSGTIELVELGVKIEPGP
FT                   ASEGFVSNVEGVLERVKEVLLMARDFKEQEEDEDAVKRIDELLAYIEDVREGKKPLTVK
FT                   VMDPFGNSALIGEKVRSRLLTKEEIKSLSTGPYVVIEPEEATSRDE"
FT   gene            24907..25722
FT                   /locus_tag="PYCH_00270"
FT   CDS             24907..25722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00270"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23740"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFD3"
FT                   /protein_id="AEH23740.1"
FT                   /translation="MILGGMLKLKRIKGITHGSHIDTVYPDPLWVVSWLMRKLNEENPE
FT                   YRTVKAELRQGRLFPRTKTVDVRIYDLPFGDDVLMRTVVMEDPEPRLVTAFPVLMAETS
FT                   SQFRVERVFEWANGLEGNIAGEVLGEVKPSVSFFAVDYVERKADYLRVETDEVRLAFLA
FT                   YGARAGPPGDNFEVELPDAGPIKVNLEEAELLLPVPLSGAFMDDYMITGKVLGVRSSRT
FT                   LYGDGYLIRLKNLPLREIDLFVLREHLKGEVKEEEMLTAVGWLQGELLL"
FT   gene            complement(25682..26650)
FT                   /locus_tag="PYCH_00280"
FT   CDS             complement(25682..26650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00280"
FT                   /product="putative transcription initiation factor IIB"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00280"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23741"
FT                   /db_xref="GOA:F8AFD4"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023484"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFD4"
FT                   /protein_id="AEH23741.1"
FT                   /translation="MFTNSKISHTCPNCGSTNLVYDPYRGEIYCQNCGEIIQENIIDLR
FT                   PDYRIFDSNQWKKRSRIGAPESILLHDKGLSTDIGIDRSLTGLMREKMYRLRRWQSRLR
FT                   VSDAAERNLAFALSELDRITAQLKLPKHVEEEAARLYREAVRRGLIRGRSIESVIAACV
FT                   YAACRLLKVPRTLDEISDISRVDKKEIGRSYRFIARNLNLTPKKLFVKPTDYVNKFADE
FT                   LGLSEKVRRKAVEILEEAYRKGLTSGKSPAGLVAAALYIASLLEGEKRTQREVAEIARV
FT                   TEVTVRNRYKELVEKLGLKLPSAFITNIAKAEVPPEATQQP"
FT   gene            complement(26798..28264)
FT                   /locus_tag="PYCH_00290"
FT   CDS             complement(26798..28264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00290"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23742"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFD5"
FT                   /protein_id="AEH23742.1"
FT                   /translation="MKYINITSLNYKKMEDLEYMAALTEKVPYYDFKEKKAKFIEKEKV
FT                   KEISAELAKKGMFAEAKELLEAAKKDYLKELEKKLVPKTVPLRISFPSWIKLQALALKY
FT                   ETSPSAILRKLLITATQDLIETLKKDGIITQRAYETIKNALNRLEKIKERRTFNEDEKG
FT                   RKFVIIYEHEEQINPSDLKHIHHFLKHLVKTHASKENIPEEIVDLLFEKNITSDFKTPE
FT                   AFFYTYAGIFKENDEVFLKFGCEVNTLDIDHVVFEYPVRVVQEFPPETILKFHRKLGFE
FT                   AFVECPHVIEKIKAKLASGESITLEDYKDIFCHKFDKEIEVLFRASPEKLTFTPKLLPY
FT                   LFEDYPLPLFKMTFSKDELRINGIRLRKKAKRDEIDKNIEELKKRIKEAYWKTLNLTEK
FT                   EVLEAESKLKAGYIDETTLETLAIVKGLELFVHYLVRRNSDGGDILSAFTRPSEVFTTT
FT                   FPKPLIRILELFHGKKIKDILEEMILEEPL"
FT   gene            28362..29993
FT                   /locus_tag="PYCH_00300"
FT   CDS             28362..29993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00300"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23743"
FT                   /db_xref="InterPro:IPR007505"
FT                   /db_xref="InterPro:IPR018633"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFD6"
FT                   /protein_id="AEH23743.1"
FT                   /translation="MEVPINGEDGYWLVGEDLITYEGRLYLFEWAEYWVVGERPFIVKA
FT                   GGEEVVSRKIKENAYVAQFSFRNYVGRARVEVIEEKGRKIFRDVEVLSRKILQIYGIKK
FT                   DEEDIKAIIEVHRRFYETIVNDIIKISSLLPFSVRAPTGFGVVESGEPMSELFAYHYLR
FT                   SNKERILEAFETMLRHIKRKLVVEEDWLGLEDVSEVTSETFFSIVQYPEHLVSVGEGVL
FT                   LSEYLRGHVPMRVLSFRKYESVDTPENRFVKYFLNLLVEWSERVIGVFGDRAEVNAIEE
FT                   LLREFEFIRSNGVWEEIGEMKFFPYTSQALLKGVGYRDLLELYREFTAYSPFFEELQGA
FT                   IDNKDIAKLYEYWAFFRLVEELGEILGSKELKIVITPGGELPESGDVYAEFDNGWRLYY
FT                   NKELVPKRWSYSVTMRPDFSLFDGDPDRAGTRLIGVFDAKFKLDVVDEPKEMESFDEEV
FT                   EALEREWNYWTWAKLEDIYKMHTYRDALGCRFAVVVYPGDVSVFFKTRGRKLTDFDLAT
FT                   LILLDDFEGVGYLKLRPEVVENDGFG"
FT   gene            29980..31911
FT                   /locus_tag="PYCH_00310"
FT   CDS             29980..31911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00310"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23744"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFD7"
FT                   /protein_id="AEH23744.1"
FT                   /translation="MVSDSGILELANIIQSLKEKYKDEWKKYEKEALSKFEELSKYIFK
FT                   DNPPIEEIMKLINGLPPKIRAMLYFMHAYKKEDITEKFKRMFSDQKDQKFRKVLKDVED
FT                   KKDIKSLDLKELKENIREIDISDVGLSIISTWLTVVNPYLFIPVHKGVISDKFNSLLER
FT                   LFGFKLVWGRGGWKDYVNNYLKFVQIVNKVKNELNVETTLELAFYLSKFSTEELGVMSS
FT                   KNISSQEFTLHNYLILRGYLYPSHLVAQFYVALKTKGFVILSGLTGAGKTKIVQELAEL
FT                   LNSSGENFLFLSVRPDWRDSKALLGYYNPLTGRYHRTKLLDFILKAKEDYERNGRNAVP
FT                   YFILLDEMNLAHVEYYFADFLSVLESGRDEGGFTREGIKLHDVDEVETFDGIPKELHLP
FT                   PNLYVIGTVNMDETTYAFSPKVLDRAFTIEFHDVKLEDYPPRKIELSRKEIEELRSAIL
FT                   KDLRRGGKFLAWTKEETNEAVRELREGYEGLWNALRKLNEVLEPYDLHFGYRVIDEIAL
FT                   FFRSARESQELGIVKFGDDDEIFDLALLMKVLPKFHGNRKKLEGPLKEVLKLCMKENEQ
FT                   IIVKFRKNGEEEVVKLPDEIDRLDGNVIVTMITNWSEYEKHFRFKHTAKKVLRMLRQLY
FT                   EIGFASFS"
FT   gene            complement(32347..32607)
FT                   /locus_tag="PYCH_00320"
FT   CDS             complement(32347..32607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00320"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23745"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFD8"
FT                   /protein_id="AEH23745.1"
FT                   /translation="MWEEAKRTFHTITFYGNFINSFVEFFNSYTFHTITFYGNTVVRAM
FT                   TWSIDKFFPHDYVLRKPLAYSLCSSSNDISELVFKVFSWNR"
FT   gene            complement(32797..32994)
FT                   /locus_tag="PYCH_00330"
FT   CDS             complement(32797..32994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00330"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23746"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFD9"
FT                   /protein_id="AEH23746.1"
FT                   /translation="MAFHTITFYGNTPKKTMTKTMLTPYTFHTITFYGNATSSATATTR
FT                   KSAFPHDYVLRKREGYAVIY"
FT   gene            complement(33162..33407)
FT                   /locus_tag="PYCH_00340"
FT   CDS             complement(33162..33407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00340"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23747"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFE0"
FT                   /protein_id="AEH23747.1"
FT                   /translation="MLETFHTITFYGNEDGGEEEASGRVDFPHDYVLRKPSCRLAGEGT
FT                   STRPFPHDYVLRKHQSTISSKGWGMSLSTRLRSTET"
FT   gene            complement(33416..33544)
FT                   /locus_tag="PYCH_00350"
FT   CDS             complement(33416..33544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00350"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23748"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFE1"
FT                   /protein_id="AEH23748.1"
FT                   /translation="MDKNTFPHDYVLRKRECPWAPVLLYEAFHTITFYGNTFQTIC"
FT   gene            complement(33561..33698)
FT                   /locus_tag="PYCH_00360"
FT   CDS             complement(33561..33698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00360"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23749"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFE2"
FT                   /protein_id="AEH23749.1"
FT                   /translation="MNDSTKLAQVTFHTITFYGNREGLHTEPLPPELHFPHDYVLRKLT
FT                   "
FT   gene            34205..34411
FT                   /locus_tag="PYCH_00370"
FT   CDS             34205..34411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00370"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23750"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFE3"
FT                   /protein_id="AEH23750.1"
FT                   /translation="MVVSAYGKPSFQNSALVKLTIEVANLTPKDVSINFGGYTSGVLSF
FT                   RKEGSIEVYAVEIFFPHSALSRF"
FT   gene            34492..34608
FT                   /locus_tag="PYCH_00380"
FT   CDS             34492..34608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00380"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23751"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFE4"
FT                   /protein_id="AEH23751.1"
FT                   /translation="MLKKIEDVKTVLLAEPLNRTIPPGGRGYSLSTSPLMVG"
FT   gene            complement(34904..36121)
FT                   /locus_tag="PYCH_00390"
FT   CDS             complement(34904..36121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00390"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00390"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23752"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFE5"
FT                   /protein_id="AEH23752.1"
FT                   /translation="MNYLRRQQYFQEQIVDFNSTEKTVYEEFKREIGSATVQQICRKNA
FT                   EAWRSFFSLLRKKRNGELPSWLKPKPPNYLKEDGKRKPIIILRNDQYRIEGNKLILKGL
FT                   GKFKKLEVQFKGRIHLNGKQGRLEITFDPVKRKWYAHVSFTVEEKLEGGEWVKIPKEPL
FT                   GNLSAGIDLGVNNLMAVYVENGESFLVNGRPLKSIDFYWRRKIANYQSKLNKSGVKMSR
FT                   KLKRMHQKAKLQAKHYINTAVRQTVRRLYELGVSRIVVGYPKGIARNSDKGRKRNFLLS
FT                   HVWRFNYVIKRLKEVAEEYGISVVVVNEAFTSKTCPVCGKPHDGARFVRGLFACPATGL
FT                   VFNADLVGAFNILKKVARTITPNLGGLYAQGRGNGGKTLPEGFEEPVLVGPLMRPPQTF
FT                   PPMARG"
FT   gene            complement(36202..36507)
FT                   /locus_tag="PYCH_00400"
FT   CDS             complement(36202..36507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00400"
FT                   /product="IS element ISTsi3 orfA-like, probably
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00400"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23753"
FT                   /db_xref="GOA:F8AFE6"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFE6"
FT                   /protein_id="AEH23753.1"
FT                   /translation="MLKEYAEEIDCEVIAIEVMPDHVHVFLRAKPNLSPTKIINHLKGK
FT                   TARKLLQEFPKLRTKTTNGRLWSRSYFVATVGYVTDEIVKHYVETQWERELKRRGA"
FT   gene            36687..37739
FT                   /locus_tag="PYCH_00410"
FT   CDS             36687..37739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00410"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23754"
FT                   /db_xref="GOA:F8AFE7"
FT                   /db_xref="InterPro:IPR004656"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFE7"
FT                   /protein_id="AEH23754.1"
FT                   /translation="MGKLMKPIRDVGIVGYGAYIPMYRIRNEEIGRVWGVNSFPIEEKA
FT                   VPGLDEDTVTIGIEAARNALKRARIEPRLIRAIWFGTESKPYAVKPSATIIAEAIGATP
FT                   DLEAADFEFACKAGTEALQAAIGFVGSGMVDYAMAIGADTAQGRPGDHLEFTAGAGGAA
FT                   FIVGKKSSETLAYFEGSYSYVTDTPDFWRRQHEHYPRHGNRFTGEPAYFHHIINAAKGL
FT                   MEELGLTVDDFDYAVFHQPNVKFPLTVAKILGIPREKVLPGLLTGIIGNTYSGATMVGI
FT                   SAVLDVAKPGDRILWVSFGSGAGSDAFSLVVQDAIEEKRDLAPKVQDYVNRKKYIDYAL
FT                   YAKARRKYIL"
FT   gene            37750..38907
FT                   /locus_tag="PYCH_00420"
FT   CDS             37750..38907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00420"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00420"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23755"
FT                   /db_xref="GOA:F8AFE8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFE8"
FT                   /protein_id="AEH23755.1"
FT                   /translation="MKAVIIGVGMTPVGEHWKLSLRDLAVEALLNAMEDAGVDSVDSLY
FT                   VGNMASGSFVEQENLGALIADWANLGSIPAVKIEAACASGGAAVQEGVKAVLSGLEDVV
FT                   AVVGVEKMTDVWPSDATRYLAYASDAEWELFHGASFVALNALIMRHYMNTYGYTEEDLA
FT                   LFAVNAHTNGAKNPYAMFKKPITVETVMKSPYIADPLKLFDASPVCDGAAAVIITTPEK
FT                   AKELGVPKEKWVEVAGMGRAVDTINLANRADLLDLKAARVAAQRAYKMAGVTAKDIDFF
FT                   EVHDAFTVMAALSLEALGAAERGKGAQLAKEGQIAIDGDYPIQTMGGLKARGHPVGATG
FT                   VYQTVEAVLQLRGEAPNQVPDAEIGLTQNIGGTGSNITVTVLRRV"
FT   gene            38910..39314
FT                   /locus_tag="PYCH_00430"
FT   CDS             38910..39314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00430"
FT                   /product="acaC protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00430"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23756"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFE9"
FT                   /protein_id="AEH23756.1"
FT                   /translation="MGKPMQVSRYWRHFREKYRLIGGKCENGHVMFPKRPICPICGSRN
FT                   IEEFQFSGRGKVISWTIVRNPPSGFEYYKPYPLALVQLEEGPVVLAQLTDVDPEDIREG
FT                   MEVEMVTRKIREFDKDGLILYGYKFRPVLK"
FT   gene            complement(39424..41106)
FT                   /locus_tag="PYCH_00440"
FT   CDS             complement(39424..41106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00440"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23757"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFF0"
FT                   /protein_id="AEH23757.1"
FT                   /translation="MKEPKIGVLVIIILFSLALSMEGCIEKSRDTESKDILTTTVTETI
FT                   TRTETIMTTSTKTINYTITKKVTTTYTITETKVVTKTITTTVTLTSTKSFVTCASPNIK
FT                   YIKVDPSFTPLDKVDHITIEIYIEGDTNCKTYGRVEVIPKTYPLLNDDAFPNENKKQFL
FT                   FNASGVHIFEAKILGGREYIIKVKACNKGGCTEKGIVTPYYRQYKNLAKILKERGIIIS
FT                   TVYMAHRSGYFFYEEHLIGKPLLGSYDSWGNELSNIVQWKHIDWANGHGISVFWIEVHE
FT                   PENVPLVLSGFLEKGMSVGLMVSCWDEVLEKGSADLSDKNTKEKFVSLIKSLGKLLNDP
FT                   NYYRINGRPAIFIWAEATFKNRREAYEEIFRYVKEVSGSEPYLITDIIPAIYEEGIDPG
FT                   EGWKSWWNYRNSDGGESFISAYSGWIGFFGVAPIVGEGVKIVPIKNKSTFDKVFLSRYN
FT                   KHLQEWREYVENSGRCFIPTVSPGFSRTWDPRFISYEIDRNVSRFKKMLELAIKYRGHC
FT                   GEIRIDTWNDFVEATFVEPSESDKFLFLEAIKDVVEKYVIELH"
FT   gene            41506..41649
FT                   /locus_tag="PYCH_00450"
FT   CDS             41506..41649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00450"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23758"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFF1"
FT                   /protein_id="AEH23758.1"
FT                   /translation="MSLIGTLVRKRDDGKYELIDFQFSLSLIGTVILEDEEELFELPFN
FT                   SL"
FT   gene            41713..41916
FT                   /locus_tag="PYCH_00460"
FT   CDS             41713..41916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00460"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23759"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFF2"
FT                   /protein_id="AEH23759.1"
FT                   /translation="MSLIGTSTFLVVISSGAALSILFESYWNTLTRTHTKSWLHLSILF
FT                   ESYWNSSLLAWVKEGKKAFNSL"
FT   gene            complement(42705..44618)
FT                   /locus_tag="PYCH_00470"
FT   CDS             complement(42705..44618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00470"
FT                   /product="Magnesium chelatase, subunit ChlI family"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00470"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23760"
FT                   /db_xref="GOA:F8AFF3"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFF3"
FT                   /protein_id="AEH23760.1"
FT                   /translation="MEPREKRLVFPFSAIVGQEKAKLALLCVAVNPLIGGVLLKGDKGT
FT                   GKSTLVRALANVLPEIEVVDGCPFNCNPRNPLEMCDSCYERYEKGEELPVTKRKMRVVD
FT                   LPLSVTIDRLVGTVDVERFLKEGKKALQPGILAEANRNVLYIDEVNLLDDYIADSLLDA
FT                   AAMGWNTIEREGISFRHPARFILVGSMNPEEGELRPQILDRFGLCVEVSAPMNPEERIE
FT                   IVRRVEEFHEDPISFYKKFESEEKKLTERIVKAREILPKVEISDDLLKLLAETVINLGI
FT                   KTNRAEIATIKTAKAIAALNGRRRVSLEDLEKAMELALPHRLRDKPFQKPPQMRPPKPK
FT                   EDKEHDHDHEHNHKHEHKKEEKSESTRSQGIGNLEQNFRSSEAKIPRIESKNFDGDEFT
FT                   SNRSSRDVSITVINYPRGIPISYLPPINGELKDVDFYNSLIWAVLNGKKPPIKLDLNDI
FT                   RVRIRKAKAPTLWVLLLDSSGSMAVQKRISIAKGIAEKLVENGYTKRSKMALIVAKGNQ
FT                   AEIFVPPTKNYWEVLEKIESVPTGGRTPLSSALYNLLLLAERERRKDKSLKVRAFLITD
FT                   GKANVSLFGKRIKDEITELARALKRKEIELNVYDTRGRGIHPGISYVQILEKVANAKVY
FT                   RI"
FT   gene            complement(44594..48352)
FT                   /locus_tag="PYCH_00480"
FT   CDS             complement(44594..48352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00480"
FT                   /product="CobN/magnesium chelatase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00480"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23761"
FT                   /db_xref="GOA:F8AFF4"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFF4"
FT                   /protein_id="AEH23761.1"
FT                   /translation="MICLIIGYGARALPLLQEILREERIEGIVLTDQNCERELEKVEKA
FT                   EVIFIYAHELPETVVEKIKETKAKVIACAGLESLTNVPEEVIIKAKTYYVLGGEKNLRN
FT                   LVRFLASLTGKAIEYEEPEEVPMDGIYHPDLGTFESLDRYLEVYTKRPLVGVLFWRSAW
FT                   LYKEFKLIRELIKALEEEGFGVIPVFTYGKDPTTGLGREKSEAVEEFFMKDGKPIIEAL
FT                   VSLISFGTVDLKNLQKLNVPVFAPIRSYYQSLEEWEKSKQGVDYMTQVYGVIIPEVAGA
FT                   IEPIFIAGTRNIEGYKVGEPYEEHMKYLAKRVKKWVELRKKPKSEVKIAIVLINPPCKG
FT                   LEANVGVGLGLDVPESVVRLLHKLKEEGYYVGENIPKTGEKLIKLILKRKAISEFRWTS
FT                   VEEIVKSGGAIDFVSLEEYLEWLNELPEDLRERIIKDWGKPEDVLAGKVDKALVGMVYD
FT                   GKFVVPGIRFGNVFITPQPKFGCAGARCDGKVCRILHDPTIVPPHQWWAVYRWITRKFG
FT                   ADVMIHFGTHGYLEFRPGKGVGLSPSCVPEASLDDVPHLYVYAVSNPMEGVIAKRRGYA
FT                   TLIDHMYPPMGMAEVLDDLDSLLTQYAKAKSLGDEARRRKIYEQILEKAKENKLRIANP
FT                   EDEEQTIEEIHRYVELMRGSQINLGLHIFGHPPEEPERLAEYVATAMAYDSYYSPSIRR
FT                   VVAEALGFNYDEIRKNPLGTTNGFTNRELLEIFHRIAVKSLERLLKGESFEVIEEEIEK
FT                   FGFKVKEKEKLEEAFRKALEVARRIVECEKEYDGFLNGLAGKYVEPGPSGAITRGKFEI
FT                   LPTGRNFYAVDPRTLPTKAAWQIGVETAEKLLKAYKEKHGKYPESVGQVLWSIDGYKAD
FT                   GEQIAQILYLIGVRPVWKGDTVAGLEVIPLEELGRPRIDVLVRISGVVRDTLPNYIYLI
FT                   DEAIEKVVMLDEPLEMNYIKKHYIEHIKKLVELGKSFEEAQRFARFRVFSAPPGTYGAG
FT                   VNLAVESSAWKSDEDLAKVWVQWSGYAYGKDAFGVEAHESLVLNLKEVDIVNRNHISDE
FT                   HDPTNCCCYFAYHGGFKAAVDALTGKNVEVVQTDTRDVSDAKIVDMKVELERVVRAKLL
FT                   NDRWIEDMKKHGYRGAAEFSKKILHLYGWETTTKLVEDWVFDEIARRYVLDEEMRRWFE
FT                   EHNPYALEEIARRLIEAYERGLWKTSDELIERLMEVYSEIEGILEESLGEGEVQGGTIE
FT                   IYTAEDDEHWSEKIEEVDKIWSLVKNA"
FT   gene            complement(48349..49293)
FT                   /locus_tag="PYCH_00490"
FT   CDS             complement(48349..49293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00490"
FT                   /product="transporter gate domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00490"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23762"
FT                   /db_xref="GOA:F8AFF5"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFF5"
FT                   /protein_id="AEH23762.1"
FT                   /translation="MELLTTSVAIALNFLKRSVPGLLIGIFIAELLIEKGIVEKISFIG
FT                   KPFVKLSNLPGECALAFATAFLNTRAANAMLVDFYRESKIGKRELYIASLMNAFPAMVR
FT                   HWNSLIPVLLATLGKLGLLYFGILVFIGLIQTTVFAVAGKILIKNPREISNSQKRMRKK
FT                   KPFKDALRNALTKTKKTSLQILKTMIIVTYITALLIAVGFFNHLSDLVRSFARSLPFSP
FT                   EELSVALSAMAGSIATYTLGANLLKAGLISEKALIRALLLGSIFANITFLRVLIPYYVG
FT                   LYGPGDGIKLMLISMATRSVIILCVIAVMGVVL"
FT   gene            complement(49296..50066)
FT                   /locus_tag="PYCH_00500"
FT   CDS             complement(49296..50066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00500"
FT                   /product="ABC transporter, ATP-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00500"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23763"
FT                   /db_xref="GOA:F8AFF6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFF6"
FT                   /protein_id="AEH23763.1"
FT                   /translation="MLEVKGLSFSYGDFSVEDVCFEVREGEILTLLGPNGSGKTTILKS
FT                   IYGLLKPKKKCVFVNGKDFHSLSLKERAKLAGYVPQSHHPPFPYTVLDVVVMGLASQLG
FT                   VFESPRKEHYQKALEKLKLIGMERFKDRPYTQLSGGQLQLVLIARALVQEPKVLLLDEP
FT                   TAHLDFKNQVKVLGIVKRLAKEEGISAVMTLHDPNLASLYSDRIALVKEGRIRAIGKPN
FT                   EILREEILEEVYGVPICILEFNGFRLILPRTEVV"
FT   gene            complement(50059..51105)
FT                   /locus_tag="PYCH_00510"
FT   CDS             complement(50059..51105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00510"
FT                   /product="iron(III) ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00510"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23764"
FT                   /db_xref="GOA:F8AFF7"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFF7"
FT                   /protein_id="AEH23764.1"
FT                   /translation="MRKFLFLFLLASPIFAFLISLCIGTYHMPLPAIVDMVVLKTFQLV
FT                   SGILAKVTFGKLDFTVQIPYPSVYQTILFKIRLPRVILAMIVGSALAISGAVLQAIFRN
FT                   PLVNSYILGISAGAAFGAALAIGLSLSLGIAPLAFAFAILAVFLTTSLAKIGGKITPVS
FT                   LVLAGVIVNAFFSALTSLLKFLMEHEKLASVVYWLMGSFADADWHSVKIAFPVIFLGCL
FT                   LVYLMRWQLNVLSFGDEAKIVGVETEKLKLAFIVIISLITAVSVAFCGIIGWVGLMIPH
FT                   IVRMAFGPDHKTLIPLTITVGASFMVLADTLARSIATYEIPIGILTTLLGIPFFAYLLR
FT                   KTGGGWNA"
FT   gene            complement(51108..53075)
FT                   /locus_tag="PYCH_00520"
FT   CDS             complement(51108..53075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00520"
FT                   /product="Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00520"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23765"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFF8"
FT                   /protein_id="AEH23765.1"
FT                   /translation="MTASQYPITITDFAGRKVTIEKPPERVIVLTSYWAEILCILGVQD
FT                   RIVGIGKYIPYDPYIPDEVKKKPVVGSSFKGLNWETVASLNPDLIIVDWYGGKYKDAET
FT                   IKKAEELGIPVIALSAKSVEDNIRVVEILGKVFGKEEKAEELASWMRERLDEINKIAGQ
FT                   IPADKKKNVLLISAPKDIGGPITVYARGSAWASIVELVGAHNLAFDKEFDTQWPKLDLE
FT                   KIIAYWGDKADVIIVVSFSKERLEKAVNGIRNDPRWREIKAVKEGHVYGIQAGSKAFLD
FT                   WGPRIIVGVYQMGGLIYPEYYPEWKPIAKELLEKFYGIKYEAPVTVMDSMGRKVTFEKV
FT                   PERVIVLSSYWAEVMHCLGLDDKIVGIDTSTPKNQFLPDSVRQKPQVGSTWSGINWETV
FT                   ASLNPDLIIMGRWKGGFTKGEQEVIERSKELGIKVLAFGIPDSNVTGTEMPYENIRIIR
FT                   VLGKVFDKEKKAEELASFLEKYYNEALEIASKIPADKKKNVLVIYGSSVVGKYATGAIS
FT                   ISYKGSAYAQAVELVGAHNVAFDYNFSTQYPKLDLEKLIAYFGDKTDVLIVVDWDPKRL
FT                   PEAVKKIKSDPAWQEIKAVKEGNVVGILVSSWRKDAVALYGPRFITGIYAFGHAIYPEY
FT                   YPDWKPIYEEILKRFYGMEG"
FT   gene            complement(53402..54502)
FT                   /locus_tag="PYCH_00530"
FT   CDS             complement(53402..54502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00530"
FT                   /product="maltose/maltodextrin transport ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00530"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23766"
FT                   /db_xref="GOA:F8AFF9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFF9"
FT                   /protein_id="AEH23766.1"
FT                   /translation="MVEVRLENLKKYFDGGKVKAVDGVNLTIKDGEFLVLLGPSGCGKT
FT                   TTLRMIAGLEEPTEGRIWFGDREVTYLPPKDRNISMVFQSYAVWPHMTVYENIAFPLQI
FT                   RKFPRDEIDKRVRWAAELLQIEGLLDRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPL
FT                   SNLDAKLRVAMRAEIKKLQTRLKVTTIYVTHDQVEAMTMGDRIAVMNAGKVLQVGPPTE
FT                   VYLKPNSVFVATFIGAPEMNILEVSVADGYLEGRGFRIELPDDIMEILRPYIGKGVLFG
FT                   IRPEHMTVEGVSEMSHMRRTVRLRGRVDFVEALGTDTILHVKLGDELIKVKLPGHVPLE
FT                   VGKEVTLLLDIDMIHVFDKSSENAII"
FT   gene            complement(54508..55341)
FT                   /locus_tag="PYCH_00540"
FT   CDS             complement(54508..55341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00540"
FT                   /product="sugar transport membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00540"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23767"
FT                   /db_xref="GOA:F8AFG0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFG0"
FT                   /protein_id="AEH23767.1"
FT                   /translation="MNDKTKFMLKKIAFYAFIFTVVAWIVIPIIVSTLYAFSSKLDYYD
FT                   PEKVVPTNFTTAWVKTILFTLGAWDGIKNSVVVALLTIAISFSLGIPAGYAVARFAFRG
FT                   KDTIKLSIVALRMFPIPVMAIPLVVLYIRLNLIDTLLGVALAHTAMALPFVVLITSSIF
FT                   GSVEKELEEAAMVFGLTRLGAFLKITLPLALPGLAAAAMFTFVMSWNEVFVASILTLHN
FT                   RTLPAQILSIVAGASGGAAPAYYKFAAAFIMTLPAMMFVFFARRYLVTMWGITLR"
FT   gene            complement(55338..56186)
FT                   /locus_tag="PYCH_00550"
FT   CDS             complement(55338..56186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00550"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00550"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23768"
FT                   /db_xref="GOA:F8AFG1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFG1"
FT                   /protein_id="AEH23768.1"
FT                   /translation="MRTRHLPYLLILPALAYLLFFIGYPLLEALYLAFTKNGTFSLETV
FT                   RRATSDPMFWKALKYTLAFAAVIVPLQLVLALILALAVNRAFRGKDLAIYVLVIPLTIS
FT                   DVAAGLIWYTMLSDHGFMNKLLMNLGIISEPIHFFGYQYRNMEFLAIVIAELWRATAIV
FT                   FVIILAGLQMISREYLEAAEVFGAGYWTRLRRIVIPMLKPSIQSALIIRTLFAMQVFGV
FT                   VWILAGRDIPVLAGEGFYQLTEIKDYGVASIYALTIALLSIVLGALYVKFLKAEYLEVR
FT                   Q"
FT   gene            complement(56196..57476)
FT                   /locus_tag="PYCH_00560"
FT   CDS             complement(56196..57476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00560"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23769"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFG2"
FT                   /protein_id="AEH23769.1"
FT                   /translation="MRKIGGVLLATLLLAAVMVSGCIGGKEEAKVVWASTQLNPPEERA
FT                   FVLEKLLPPFKDETGIDVEFVPLSYADLSTRLAGEMEAGKVTIDVIGDLHGGLDYFNSQ
FT                   GWLMDLSDKKLEGRTFIESFMKYATDKDGKIFYIPWMSATYVMVINKDAFKYLPAGLTE
FT                   EDVIKGTEKWTYDALLEWAKNIYEQTGKKALGFPAGPKGLFHRFLHGYLYPSFTGYEAK
FT                   NFDTPEAVKMWNYLKELWQYVNPTSTTWDSMADPLLQGEVLIAWDHTARIKNAIETKPD
FT                   QFVVVPVPRGPKGRGFIVVLAGLAIPKNAPHPEEAWKLIDYLTRPEVQVEILKNVGFFP
FT                   TVKEAADAVPEGPLKILANGVAAQSSTKDALIVMIPNLGEKGGEFSAIYREAFQRIVLQ
FT                   GEDPAKVTAELKPKLYGLFQEKGLEVP"
FT   gene            57583..58596
FT                   /locus_tag="PYCH_00570"
FT   CDS             57583..58596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00570"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23770"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFG3"
FT                   /protein_id="AEH23770.1"
FT                   /translation="MGDIKAEWEKALNERDCGRLLELFDDYIEEIEDEETLRGELKRLG
FT                   DVLVECDDPYDLAYEVAHVYSHLGETEKGIEIYKRIAKRKKDDPDEYAVALYYLADAYE
FT                   HFGMPEKAIEVYEQLLKLEEEIGNERETALTLAHLAVSHDELGEVEKAVALMERARDIF
FT                   ERLGDEVNLLTSLIDLAHFHYELGHYDEAEALIREVLRNPRNDEIEVNARLVEAEIHAG
FT                   RKNYRAAFTALRDALLKTNEKEELFSLVFDTLVDFLEDLLDEGAYGDVYENVGLLAEAF
FT                   EDDTADFFRAIGELARWREGDEEAKKRFEELYSKVKNEELRLILDEWKRPKLTFGL"
FT   gene            complement(58598..58873)
FT                   /locus_tag="PYCH_00580"
FT   CDS             complement(58598..58873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00580"
FT                   /product="elongation factor 1-beta"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00580"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23771"
FT                   /db_xref="GOA:F8AFG4"
FT                   /db_xref="InterPro:IPR004542"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFG4"
FT                   /protein_id="AEH23771.1"
FT                   /translation="MSDFNVVGVIKVMPTDPEVNLDELEEKLKAVIPEKYGLAKVEREP
FT                   IAFGLVALKFYVLGKDEEGYSFDEVAELFRKVENVESAEVETVSRI"
FT   gene            59146..60039
FT                   /locus_tag="PYCH_00590"
FT   CDS             59146..60039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00590"
FT                   /product="prenyltransferase UbiA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00590"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23772"
FT                   /db_xref="GOA:F8AFG5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR023547"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFG5"
FT                   /protein_id="AEH23772.1"
FT                   /translation="MVKLFKPLRGLPQGKLMETRALLEIIRPHNCLLAGLVGVLGALVA
FT                   YEGVPPIDRLLIVFLVVFLGCAGGNTVNDYFDYEIDMINRPNRPLPRGALSRRLALYYS
FT                   LLLYALGLSFAYFLGFKAFIFAFSAYTLTFIYAWKLKPLPFVGNVAVALLTGATPIYGA
FT                   LGVGRIGLAGYLAICAFLVNVAREIMKDIEDVEGDKRLGARTLPIVSSPKKAAEIASLF
FT                   GFLTVLASLLPIRAGIGLGYLPMILVDGMILKASIDMLKEPRPEVAGRAQRALKLATFI
FT                   AVVSFLFGAITKGVGI"
FT   gene            60036..60413
FT                   /locus_tag="PYCH_00600"
FT   CDS             60036..60413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00600"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23773"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFG6"
FT                   /protein_id="AEH23773.1"
FT                   /translation="MIEGVIKDNIESDTFWLVIIFKTPLGPSETMERIAKAVENAGWKV
FT                   TFKANWWTADIPYGLVRIDAKKNGREKIILGKWILGREWKVIRAESLELEKGKDEFFRT
FT                   VDSITSTLIHDPVIRTMREQY"
FT   gene            complement(60427..61245)
FT                   /locus_tag="PYCH_00610"
FT   CDS             complement(60427..61245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00610"
FT                   /product="aldo/keto reductase family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00610"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23774"
FT                   /db_xref="GOA:F8AFG7"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFG7"
FT                   /protein_id="AEH23774.1"
FT                   /translation="MKDLKVIGDDKVTAIGIGTWGIGGYESPDYSRDRESIAVLKYGLE
FT                   LGINLIDTAEFYGAGHSEELVGEAIKEFERDDVFIISKVWPSHFGYESAKKAARASVRR
FT                   LGTYIDLYLLHWPGDSFERIKKTLWALEDLVDEGLIRYIGVSNFDLNLLMRSQEVMRKY
FT                   EIVANEVKYSIRDRWPETTGLLDYMKREGMALIAYTPLEKGSLARNECLAKIGRRYGKT
FT                   ASQVALNYLIWEENVIAIPKASRKGHIEENAGAMGWRLSEEDREKAKRCV"
FT   gene            61374..61667
FT                   /locus_tag="PYCH_00620"
FT   CDS             61374..61667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00620"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23775"
FT                   /db_xref="InterPro:IPR025517"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFG8"
FT                   /protein_id="AEH23775.1"
FT                   /translation="MDPISKAIEEAKNDPKLRKKLRIKAALTTVLMIAFLGVIFITVGT
FT                   FISARQGTFLGMNQLDFLKLRARYGLLMMFLIILHIAANWKIYRKELELLSG"
FT   gene            complement(61664..61852)
FT                   /locus_tag="PYCH_00630"
FT   CDS             complement(61664..61852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00630"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23776"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIG7"
FT                   /protein_id="AEH23776.1"
FT                   /translation="MSTPSGWISIILSLIVLVVLIFAFYQVNKVLNEFKVEIERLKNVL
FT                   EETRKNTEEVKRKLEEV"
FT   gene            complement(61877..62179)
FT                   /locus_tag="PYCH_00640"
FT   CDS             complement(61877..62179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00640"
FT                   /product="Transcriptional regulator, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00640"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23777"
FT                   /db_xref="GOA:F8AFG9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFG9"
FT                   /protein_id="AEH23777.1"
FT                   /translation="MIAMVQTIEELVRVGEALGNPVRVRILKMLCEKEWYVYELAKELG
FT                   ISRQLLYLHLKKLEKAGLVESELRLEPNDPRAKKYYRAKQFRIVIDNELLKNLEG"
FT   gene            complement(62618..63466)
FT                   /locus_tag="PYCH_00650"
FT   CDS             complement(62618..63466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00650"
FT                   /product="domon domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00650"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23778"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR019243"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIG8"
FT                   /protein_id="AEH23778.1"
FT                   /translation="MEEVENMRKIWFGIGLIALLIGMSLGAVSAWRGQPGPNPYTSHGA
FT                   VQTAPMLNRTLTSYYSDLSQEEIDSLLYMVEKEKLERDVYIKLYEKWGLPVFQNIANSE
FT                   QRHMDAVLSLIEKYNLTAPETLDQVGVFQNEELQALYDQLVERGSQSVVDALKVGALIE
FT                   ETEIKDLEGWIAQTDNEDIKQVYENIMKGSENHLRAFAGQLEGLEVSYTAQVLPGEQVD
FT                   EILTSVPDHGAGMKGAAVGMMGTCHCEARIQSGIVDGIANMFRHAWGWIRGFAKRIGMP
FT                   L"
FT   gene            63563..63736
FT                   /locus_tag="PYCH_00660"
FT   CDS             63563..63736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00660"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23779"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFH0"
FT                   /protein_id="AEH23779.1"
FT                   /translation="MISRGEIASYLAIAMGIVYLIVDLGSKRLALADRIFMTLLSMSLC
FT                   LEVKKRNEERPT"
FT   gene            complement(63733..64965)
FT                   /locus_tag="PYCH_00670"
FT   CDS             complement(63733..64965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00670"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase (apgM)"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00670"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23780"
FT                   /db_xref="GOA:F8AFH1"
FT                   /db_xref="InterPro:IPR004456"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023665"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFH1"
FT                   /protein_id="AEH23780.1"
FT                   /translation="MKRKGILIILDGLGDRPIKEFGGKTPLEYANTPNMDELARIGILG
FT                   QQDPIRPGQPAGSDTAHLSIFGHNPYETYRGRGYFEALGVGLDLDEDDLAFRVNFATIE
FT                   NGIIVDRRAGRISTEEAHELAKAIQENVKLPVEFVFKGATGHRAVLVLKGMAKGYRVGE
FT                   NDPHIEGKPPHTFSWKDEESRRVAEILEEFVRQSHKVLEKHSINEKRRKEGKPVANYLL
FT                   IRGAGTYPNIPMKFTEQWKVKAGAVVAVALVKGVAKAIGFDVYTPEGATGEYNTDAIAK
FT                   AKKVIELLKDYDFVFLHFKPIDAAGHDNNPRLKVEMIEKADRMIGYIVEHVNLDEVVIA
FT                   ITGDHSTPCEVKNHSGDPVPLLIAGGGVRTDHAQSFGEREAMRGGLGRIKGHDIVPIMM
FT                   DLMNRSEKFGA"
FT   gene            65296..66600
FT                   /locus_tag="PYCH_00680"
FT   CDS             65296..66600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00680"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00680"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23781"
FT                   /db_xref="GOA:F8AIG9"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIG9"
FT                   /protein_id="AEH23781.1"
FT                   /translation="MIEKVYCAEVKPDMDGKKVRLAGWVYTNMRVGKKVFLWIRDSTGI
FT                   VQTVVARGVVDEETFNTAKKLGRESSVIVEGIVKADERAPGGAEVHVERLQIIQAVSEF
FT                   PIPENPEQASPELLLDLRHLHLRSPKVAAIMKVKATLMQAAREWLLQDGWYEVFPPILV
FT                   TGAVEGGATLFKLKYFDRYAYLSQSAQLYLEAAIFGLEKVWSLTPSFRAEKSRTRRHLT
FT                   EFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELRRKEIETFRDDLTTLKNTEPPFPR
FT                   ISYDEAIEILQSKGVNIEWGDDMGADEERILTQEFDRPFFVYGYPKHIKAFYMKEDPED
FT                   PRKVLAADMLAPEGYGEIIGGSQREEDWEKLRQRIIEEGMDPKDYEWYLDLRKYGSVPH
FT                   SGFGLGLERLVAWILKLDHIRWATLFPRTPNRIYP"
FT   gene            complement(66608..67942)
FT                   /locus_tag="PYCH_00690"
FT   CDS             complement(66608..67942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00690"
FT                   /product="amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00690"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23782"
FT                   /db_xref="GOA:F8AFH2"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFH2"
FT                   /protein_id="AEH23782.1"
FT                   /translation="MREKCGIFAALTDEAPKKAYYALLALQHRGQEGAGISFWNGSLRT
FT                   VKGHGLVPEVFREDSLDGLDAQAAIGHVRYSTSGSLSEVQPLEIECCGRTLALAHNGTL
FT                   TNFLPLRRKYEGMGVKFRHSLDSELLGVSFLWHLKEEGDEFEAMRRVFEEVKGAYSIVI
FT                   LLEGELIVARDPVGFRPLAYGWGGGHYFASEDSALKMFGLETRDIRPGEVFLVSEGGVE
FT                   SRILVKEEHRHCVFEYIYFARPDSTLDGVSVYLARYRMGRELAKESPAKGDVVIAVPDS
FT                   GRTAALGFAHESGIPYMEGLIKNRYVGRTFIMPSQAYRELKVKLKLSPVREVLEGKRVI
FT                   LVDDSIVRGTTMRQIIAMLRRAGAREVHVRIASPPIRYPCYMGIDIPTRHELIAAWRSL
FT                   EDIRKEIGADSLAYLSIEGLKKAVGTEKLCMACLTGEYPEWAFKF"
FT   gene            68076..68780
FT                   /locus_tag="PYCH_00700"
FT   CDS             68076..68780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00700"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00700"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23783"
FT                   /db_xref="GOA:F8AFH3"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFH3"
FT                   /protein_id="AEH23783.1"
FT                   /translation="MEVYEGKAKKVIPIDDDKAIMEFKDDATAFDGVKKAQFRGKGWLN
FT                   AQISAKLFKLLEEHGIKTHFIGVAGDNKLIVERLQMYPLEVVVRNVVAGSLRKRLPLPE
FT                   GYELPEPIVELYYKSDELHDPMINHYHAKVLGLSEEELKEMERIALRVNEILRKFFAER
FT                   GIILVDFKLEFGKNKKGEIVLADEISPDTCRFWDAETKRSLDKDVFRFDKGDLIEAYRE
FT                   LYERLTGEKVQA"
FT   gene            68842..69507
FT                   /locus_tag="PYCH_00710"
FT   CDS             68842..69507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00710"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23784"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIH0"
FT                   /protein_id="AEH23784.1"
FT                   /translation="MKYRIEHRPSFSFLEVELQPGEAVQAEAGAMVYMSPTVRVETKAR
FT                   GGLLGALKRSVLGGESFFINVFRAEDGPGVVGFAPGYPGDIEALEINGTIYAQSGAFLA
FT                   GSEDIQIDIKFGGAKTFLGRESLFLLELSGRGIVFLASYGAIRPVHLKGERFVVDTGHM
FT                   VAFTEGLDFTVKSIGGLKSVLFSGEGLVMEFRGTGTVYIQTRSLDGFLSWLLPHLPKS"
FT   gene            complement(69504..70301)
FT                   /locus_tag="PYCH_00720"
FT   CDS             complement(69504..70301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00720"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23785"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFH4"
FT                   /protein_id="AEH23785.1"
FT                   /translation="MRFEVLTKDDMNELSRLLSKAGIMNRTREELGWELSHTVVIRGKF
FT                   GELRKIDIEPVRQRLGEIEATFRSLIKEIKEGKEIEELLDDTNDAKVEVFSALVEAGFL
FT                   DIGECVKLKKEPALEELKIELRFPMEDVIEYVEDLEKHGAKLVTEIALIKRYYVEVMEI
FT                   EEEAIAKAIEIAGEYATEESLVEAMFSGLAKSALAKRMLELVEDIRRKDELIEIMMEQE
FT                   PIILRGKDVELAVYYEEDAIEDLLKELQTLGYLKVKGNRVWPY"
FT   gene            complement(70298..70948)
FT                   /locus_tag="PYCH_00730"
FT   CDS             complement(70298..70948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00730"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23786"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIH1"
FT                   /protein_id="AEH23786.1"
FT                   /translation="MREVIEEVEKRIRRLEAQAEIAEELLYRMEESGILRKYRILKRKG
FT                   MSLYTFFMPLWTIAGLMMLFILRWRYPEVLGRINLTPYLVLVAMVSLLPLLAALLEREG
FT                   EDPVAELEGKARNARKVIRDFYNPLKKGLEEGNEEVLRGLADRLLDDPTLAQAIEAVHE
FT                   GDAKLMAYALYLYLNRKAVSEEELQKAIILLGRGPLAMLLEKARKEREGDGRI"
FT   gene            complement(71001..71882)
FT                   /locus_tag="PYCH_00740"
FT   CDS             complement(71001..71882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00740"
FT                   /product="sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00740"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23787"
FT                   /db_xref="GOA:F8AFH5"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFH5"
FT                   /protein_id="AEH23787.1"
FT                   /translation="MDVVCMGNLNYDITFILDRFPEFHEKVNARSAYFGLGGSAGNTAT
FT                   WLAHLGLRVGFIGAVGNDDFGRLHIEFFRRIGVDTSRVRVVEVPTGIAVMLIHGEDKRI
FT                   VKFPGANVFKELDEAYIAQARHLHLSSNPVELVRRAVAIAKRHGLTVSFDPGEMEVPED
FT                   VEAKLDYLIMNEDEFRRKYGGLGAVKDVKAKNVVVTLNGGGALVRDSAGRVFEVKGLSA
FT                   RVVDSTGAGDAFDAGLVYGIVKGWSLENATKLGMLLAYLTVQKVGARSAVIPLEDVKRI
FT                   AERLSLGIFGET"
FT   gene            72008..72511
FT                   /locus_tag="PYCH_00750"
FT   CDS             72008..72511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00750"
FT                   /product="small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00750"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23788"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFH6"
FT                   /protein_id="AEH23788.1"
FT                   /translation="MTIRRRRWNIWDPFDIMREIQEEIDSIFEEIFRGPRFWTYRRWGE
FT                   PEAYETRIEEVWREPFVDIFDNGNEFVITVELPGVRKEDIKVRVTENTVYIEAQVRREK
FT                   ELEREGAIRVERYYSGYRRVIRLPEEVIPEKARAKYNNGVLEIRIPKKHPTKREEEGFE
FT                   VKVE"
FT   gene            72579..74969
FT                   /locus_tag="PYCH_00760"
FT   CDS             72579..74969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00760"
FT                   /product="cell division protein CDC48"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00760"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23789"
FT                   /db_xref="GOA:F8AIH2"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIH2"
FT                   /protein_id="AEH23789.1"
FT                   /translation="MADKKEIKLKVASAYQRDVGRGIVRIDRKSMREIGVEPGDIVEII
FT                   GTKNTAAIVWPAYPEDEGLGIIRMDGTIRKNAGVGLGDEVTVRKAEVREAKKVVLAPTE
FT                   PIRFGPDFVEWLHERLIGRPVVRGDYIKIGVLGQELTFIVTATQPSGVVQIAEYTDFSI
FT                   SEKPVKEVAKAMTTGVTYEDIGGLKDVIQKIREMIELPLKHPELFEKLGIEPPKGVLLY
FT                   GPPGTGKTLLAKAVANEANAHFIAINGPEIMSKYYGESEERLRQVFKEAEENAPAIIFI
FT                   DEIDAIAPKREETHGEVEKRVVSQLLTLMDGLKSRGKVIVIAATNRPDAIDPALRRPGR
FT                   FDREIEVGVPDKQGRKEILQIHTRGMPIEPDFRKGEVFEILEELRKEEKFRGIVEKAIG
FT                   KVIGARDEEEVKKVLKEVSTELYDEVKARLIDRLLDELAEVTHGFVGADLAALAREAAM
FT                   AALRRLIKEGKIDFEAETIPREVLEELKVTRKDFYEALKMVEPSALREVLIEVPNVRWD
FT                   DIGGLEEVKQELREAVEWPLKHSEAFRAFGITPPKGILLYGPPGTGKTLLAKAVATESQ
FT                   ANFIAVRGPEILSKWVGESEKNIREIFRKARQAAPTVIFIDEIDAIAPRRGTDVNRVTD
FT                   RIINQLLTEMDGIVENSGVVVIAATNRPDIIDPALLRPGRFDRLILVPAPDERARLEIF
FT                   RVHTRNMPLAKDVNLEELAKRTEGYTGADIAAVCREAAMIAMRKALEKGIIKEGMKAEE
FT                   IRKVAKVTMKDFEEALKKIGPSVSKETMEYYKRIQEQFKQARG"
FT   gene            75078..75353
FT                   /locus_tag="PYCH_00770"
FT   CDS             75078..75353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00770"
FT                   /product="DNA-binding protein Alba"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00770"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23790"
FT                   /db_xref="GOA:F8AFH7"
FT                   /db_xref="InterPro:IPR002775"
FT                   /db_xref="InterPro:IPR013795"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFH7"
FT                   /protein_id="AEH23790.1"
FT                   /translation="MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVVIKARGRAISRAV
FT                   DVAEIVRNRFLPEVSVKDIKIGTEELPTADGRTTNTSTIEIVLEKP"
FT   gene            complement(75380..75976)
FT                   /locus_tag="PYCH_00780"
FT   CDS             complement(75380..75976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00780"
FT                   /product="UPF0278 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00780"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23791"
FT                   /db_xref="InterPro:IPR014856"
FT                   /db_xref="InterPro:IPR022785"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFH8"
FT                   /protein_id="AEH23791.1"
FT                   /translation="MGMIRFVLDTSIFVNPDVRSKFGATPTEAMKTFLRYAEKLFGKVE
FT                   FYMPPGIYREIMNFVDEQEVSPDVELYIIKKPPNVHDIKIPAFVVYELIEDIRRRVDKG
FT                   LRVAEKAVRESVIDTENVDKIIQKLRRNYRKALREGIVDSKEDFELILLAKELDAILVS
FT                   ADVGVLTWAEKMGIKWVDAGKFRELLEELVEKFEK"
FT   gene            77012..77986
FT                   /locus_tag="PYCH_00790"
FT   CDS             77012..77986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00790"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23792"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIH3"
FT                   /protein_id="AEH23792.1"
FT                   /translation="MKKFIIGGIFIFMLSFFILSLLINGNSGNVVLQFENNTPPQQLIK
FT                   TSNNAYRASETKSEVTPPSPSDFILPYVGYIYGTPNDTVAQVMLYWCYPKSVVNQSVAI
FT                   SVTMNFGGSFLSVSYNGEDIPVFYHGYLGIILPINFSQLNLSAPGNYKYLDVSGDLYWI
FT                   QNGRKQRIRLNLGNWTFETVNEEQKLKPNITAFSLESIEFKEGTREVKYSFGLYNPFNV
FT                   TMRLINVSFGIPSKLVKIVNIEVYNTSTPYEIAKSKLMSSKLIPPEESRYFVITLEING
FT                   KVRSLFIQPKLVYSIGDEVYTMAGPPFQDTVLPVTCTYNMKAS"
FT   gene            complement(78066..79082)
FT                   /locus_tag="PYCH_00800"
FT   CDS             complement(78066..79082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00800"
FT                   /product="o-linked GlcNAc transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00800"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23793"
FT                   /db_xref="GOA:F8AFH9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFH9"
FT                   /protein_id="AEH23793.1"
FT                   /translation="MDRLKIYIAAFIAIILGIAGLIVWKWGFWMLVRIILGLGFLFLTL
FT                   MLAFFLALTLYAESWKYAAMLLPITAVSAYATYLSITWQRLKIVGAVIAFFVAAVAFGI
FT                   WYISEPDLSIADRFRSAEKLERMGRYKQAARKYEKAGNYLKAAEMYLKLGWLESAAWAY
FT                   EKAGQYAKAAELYEQLYEKEKDTYYLKEAHEYWKKAGNMERAAKALERYAEEEPWFWED
FT                   VAKLYEELGNEERARGAWEKALEYYMKEAKEEGVFWEDVGNIARKLGREELAREAYQKF
FT                   LEYCLKEVEEDPMWWKHVAEAYEYLGEKEKAEDARKKYEEYREKIMKANEETSKFPK"
FT   gene            complement(79070..79588)
FT                   /locus_tag="PYCH_00810"
FT   CDS             complement(79070..79588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00810"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00810"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23794"
FT                   /db_xref="GOA:F8AIH4"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR015236"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIH4"
FT                   /protein_id="AEH23794.1"
FT                   /translation="MISIEAFSLANRKILIAVLWEEKIEGITFSLDGKEFLKERITRLR
FT                   EFLLRRGASISLRLETSNYPELVFKILVGEVENREALKELSFATSTPFERRVYIWLAKN
FT                   VKRGNIITYGEVARALRTSARAIGGAMRRNPYPIVIPCHRVVAKEDLGHYTPKPEYKRF
FT                   LLEVEGWIG"
FT   gene            complement(79585..80529)
FT                   /locus_tag="PYCH_00820"
FT   CDS             complement(79585..80529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00820"
FT                   /product="Thiamine monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00820"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23795"
FT                   /db_xref="GOA:F8AFI0"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFI0"
FT                   /protein_id="AEH23795.1"
FT                   /translation="MREREIIELFLKEVELQGDLPLGDDAGAIKLGNAWIVVTSDMLVW
FT                   GTDVPPIMTPEQAGMKVVIMNLSDVAAMGAKPLGFFFSLGIPRDIGEDVLRGIAKGIGR
FT                   AANLYRVPVLSGDTNEGRELVIDGGALGLTERPLLRSGARPGDLVCVTGDLGRALAGLL
FT                   TWKKGLNISPSIRRSLYEKLLEPTARVEEGIELGKVANAAIDVSDGLSKELHILAEMSG
FT                   VRIVVEEDRIPIGEGVQEVAELLGFDPIELALTSGEEFELVFTVSPERVYELSFDFSII
FT                   GRVDAGKGVYIERGGRKERMPLFGWEHFAEGLL"
FT   gene            80510..81178
FT                   /locus_tag="PYCH_00830"
FT   CDS             80510..81178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00830"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23796"
FT                   /db_xref="GOA:F8AFI1"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFI1"
FT                   /protein_id="AEH23796.1"
FT                   /translation="MISRSLIILTESFIKGRPYQGMVVGMKEETLIAYANYFKAIVGII
FT                   VVVYVTYILFNKEKFKTPFVLAISGVMTALVAVVTMFIQINIPASQGYLNFGDTMVMLA
FT                   AILFGPLVGAFAGGVGSALADIFSGYAHWSIFTLMIKGVEGLVVGYLAKGEANYSRILV
FT                   ATIAGSSVMVIGYVGVAYLLYGVAGATIELYNDIVQATTGIIVGGGLGYALKRRLAGIM
FT                   "
FT   gene            complement(81184..81579)
FT                   /locus_tag="PYCH_00840"
FT   CDS             complement(81184..81579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00840"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23797"
FT                   /db_xref="InterPro:IPR014418"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFI2"
FT                   /protein_id="AEH23797.1"
FT                   /translation="MNPHNINSFTKRPKYFIGRISREREDEMGKKEEFLDQLIELINTA
FT                   IRELEEEGLSPDILLAGSEFLKYSLDIIEGLSLSVYEIKELGNDAIIADSKYIGQLKKA
FT                   SRRISIEPLLQEEEWEEILKNLPEIED"
FT   gene            81950..83044
FT                   /locus_tag="PYCH_00850"
FT   CDS             81950..83044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00850"
FT                   /product="aromatic amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00850"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23798"
FT                   /db_xref="GOA:F8AFI3"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFI3"
FT                   /protein_id="AEH23798.1"
FT                   /translation="MKRLTLAEASAILIGTQIGAGVLGLPYALKDTGFAGIMVVIAVGI
FT                   LTLITALFVLELAVQRGGTLTSLARETLGRAGGWLMLASISVLSYGALIAYVAGSGDIL
FT                   SSLLGLDKAICATIFWLAMSWIVLMGLKASGEAELALNFLLLGALAVAVVLMLPRVNVD
FT                   NLGIGSPSAVISGVGVAIFAYVSHMVVPEMYRGLGDSEETKKAVLIGYLVPMVFYALFV
FT                   LAFVGALGGKTPELATSALEEYYGSLGRFVGLILPLAAISTSYIGIALAQMDNLREAFK
FT                   LDKRTAWLLTVVPPLLVYFAGLKSFVRALWLAGTFGGLLYAGILPVAMYLRVKSECVRV
FT                   PHGVAYFAGAIFLLVLLYSVASLV"
FT   gene            complement(83068..84072)
FT                   /locus_tag="PYCH_00860"
FT   CDS             complement(83068..84072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00860"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00860"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23799"
FT                   /db_xref="GOA:F8AIH5"
FT                   /db_xref="InterPro:IPR006436"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIH5"
FT                   /protein_id="AEH23799.1"
FT                   /translation="MKVKVGINGYGTIGKRVAYAVTRQDDMELIGVTKTKPDFEAYRAE
FT                   ELGIPVYAASEEFLPRFEKAGFEVAGTLNDLLEKVDVIIDATPGGMGAKNKPIYEKAGV
FT                   KAIFQGGEKADVAQVSFVAQANYEKALGKDYVRVVSCNTTGLVRTLSAIQDYIDYVYAV
FT                   MIRRAADPNDIKRGPINAIKPSVTVPSHHGPDVQTVIPINIETSAFVVPTTIMHVHSVM
FT                   VELKKPLEAKDVIEIFENTTRVILFEKEKGFESTAQLIEFARDLHREWNNLYEIAVWKE
FT                   SISVRGNRLFYIQAVHQESDVVPENIDAIRAMFEMADKWESIKKTNESLGILK"
FT   gene            84193..84450
FT                   /locus_tag="PYCH_00870"
FT   CDS             84193..84450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00870"
FT                   /product="50S ribosomal protein L35Ae"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00870"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23800"
FT                   /db_xref="GOA:F8AFI4"
FT                   /db_xref="InterPro:IPR001780"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR018266"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFI4"
FT                   /protein_id="AEH23800.1"
FT                   /translation="MKAVVLSYRRSKENQHNYHMIIKPLDINSREEAAKLIGRLVIWKS
FT                   PSGKILKGKITRVHGTKGAVRVRFEKGLPGQALGDYVEIL"
FT   gene            84474..85607
FT                   /locus_tag="PYCH_00880"
FT   CDS             84474..85607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00880"
FT                   /product="N(2),N(2)-dimethylguanosine tRNA
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00880"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23801"
FT                   /db_xref="GOA:F8AFI5"
FT                   /db_xref="InterPro:IPR002905"
FT                   /db_xref="InterPro:IPR022923"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFI5"
FT                   /protein_id="AEH23801.1"
FT                   /translation="MELVEVKEGKARVLVPKAESIYNAPVFYNPRMALNRDVAVLLLNL
FT                   LKPGKVLDALAATGIRGLRFALETPAKEVWLNDISEEAYALMRRNVALNFGEEPIVKGE
FT                   RAYLQADKLIVVNRGDANRLMAEKHRYFHFIDLDPFGSPMEFLDTALRAVKRKGILGVT
FT                   ATDAAPLCGAHPKACIRKYLAVPLRGELCHEVGTRILVGVIARYAAKYDLGIEVLLAYY
FT                   KDHYFRAFIRLRDGAKKGDESLEQLGYVYFDERTGRFDVERGFLPTKPSAYGPVWLGPL
FT                   KSEELVEEMMKLAEGMELAEKKRALKLLAILREELDVPLFYDTHALGRRLGIQPRKVGE
FT                   IIERLRELGYNASRTHFSPTAVKTDAPFEEVVRAMAR"
FT   gene            complement(85604..85819)
FT                   /locus_tag="PYCH_00890"
FT   CDS             complement(85604..85819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00890"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23802"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFI6"
FT                   /protein_id="AEH23802.1"
FT                   /translation="MKDVFFWLTLAFVFISAYLSFRGMRKEAILTAGIAGGSALAFALF
FT                   ERFPWPVAFGLGFFATVVFEWARRRS"
FT   gene            complement(85820..86728)
FT                   /locus_tag="PYCH_00900"
FT   CDS             complement(85820..86728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00900"
FT                   /product="GHMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00900"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23803"
FT                   /db_xref="GOA:F8AFI7"
FT                   /db_xref="InterPro:IPR012043"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFI7"
FT                   /protein_id="AEH23803.1"
FT                   /translation="MMLIRAFVPAHITAFFVPVIEEDPLKSGSLGAGINLDKGTNVFLS
FT                   VEEGHEGNIHVTFNGEPVKREEAVITYWVAERLLPQDFIGEIEIWQYFDFPNGHGFANS
FT                   AGGALGTALTLAYRFGRTLLQAARTAHEAEVRHGGGLGDVVAQLHGGIEMRVKAGGPGV
FT                   AVVDNILVEGYRVLAIPLGRMGTKEVLEGDVIEAIRRAGEEALEKLLREPTAENMMRLA
FT                   REFAEGTGLLEGELLEVAREIDRVLSLPSSMVMLGKSLFALVRENEVKNVKALMMDLNL
FT                   PYELCGIYWGRPVVGRWIGGE"
FT   gene            complement(86725..87558)
FT                   /locus_tag="PYCH_00910"
FT   CDS             complement(86725..87558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00910"
FT                   /product="site-specific recombinase, phage integrase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00910"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23804"
FT                   /db_xref="GOA:F8AFI8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFI8"
FT                   /protein_id="AEH23804.1"
FT                   /translation="MSLEEFSTFLELEGKSEHTVRMYTYYVARFLEEEGELSSRSALRF
FT                   LAKLRKKGYSMRSINLVVQALKAYFRFEGLEEEAEKLKSPKVPRTLPKSLTVEEVRRLL
FT                   SVIPPTKRRDRLIVLLLYGAGLRVSELCNLKKSDIDFERSLIIVRGGKGGKDRVVPISK
FT                   VLLEGIRAYLESRNDDSEYLLVEERRKRKDRLSPKTVWYLLKKYGERAGVEVTPHRLRH
FT                   SFATHMLERGVDIRVIQELLGHSNLATTQIYTKVTVRHLREAQERARLIEELGVG"
FT   gene            complement(87555..88382)
FT                   /locus_tag="PYCH_00920"
FT   CDS             complement(87555..88382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00920"
FT                   /product="TOPRIM-domain-containing protein, potential
FT                   nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00920"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23805"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR014481"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFI9"
FT                   /protein_id="AEH23805.1"
FT                   /translation="MTIVDVRILVEGASDVEVISKALQGLALGSEYNITISSIIPTTNV
FT                   DIAKSAAAGADLLIIATDADRVGRELAERLFQELSDMVGHIERMKLPLGHDLEHVDVEL
FT                   VRKELKNALVRAGLKALQLLPDYMALRRDFLDLKGKYEELQKEKENLEKELEDLKKKYE
FT                   ELQAEYARLREENENLNQIIKRKVNIFKLEEKWKELFPEAELPDESIIAEAVKKLGFAG
FT                   KVIAGQGYIYSEDEGLVEELLRTVYLSMIIAKTKAKEEQEEEERPEVEEEVVE"
FT   gene            88531..89736
FT                   /locus_tag="PYCH_00930"
FT   CDS             88531..89736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00930"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00930"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23806"
FT                   /db_xref="GOA:F8AFJ0"
FT                   /db_xref="InterPro:IPR002795"
FT                   /db_xref="InterPro:IPR027790"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFJ0"
FT                   /protein_id="AEH23806.1"
FT                   /translation="MARNIIVEELVRTPVEKQKVELVERKGIGHPDSIADGIAEAVSRA
FT                   LCREYIKRYGIILHHNTDQVEVVGGRAYPRFGGGEVIKPMYILLSGRAVELVDKEMFPV
FT                   HEVAIKAAKDYLRKTIRHLDVENHVVIDSRIGQGSVDLVSVFNKAKENPIPLANDTSFG
FT                   VGYAPLSETERLVLEAERLLNGEKFKKEWPAVGEDIKVMGLRRGDEIDLTIAAAIVDSE
FT                   VANPNEYMEVKEGIYEAVKELAKEITSRKVNIYVNTADDPEKDIYYITVTGTSAEAGDD
FT                   GSVGRGNRVNGLITPNRHMSMEAAAGKNPVSHVGKIYNLLAMLIARDVAEALPVEEVYV
FT                   RILSQIGKPIDQPLVASIQIIPKEGHSVREMERDAYAIADEWLANITKIQKMILEDKLT
FT                   VF"
FT   gene            complement(89723..90550)
FT                   /locus_tag="PYCH_00940"
FT   CDS             complement(89723..90550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00940"
FT                   /product="dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00940"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23807"
FT                   /db_xref="GOA:F8AIP5"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIP5"
FT                   /protein_id="AEH23807.1"
FT                   /translation="MKERLFYLLSKYGLRPNEDLGQNFLIVEDVIERSVERAAIGERDT
FT                   VLEVGPGLGFLTEKLAEKAGKVYAIERDARLVEILRKEYDWKNVEVIKGDALKVEWPPF
FT                   NKVVSNLPYQISSPFTFRLLRHEFEVAVLMYQLEFALRMVAKPGDKNYSRLSLMVQALA
FT                   EAEIAERVGRGAFYPRPKVDSAVVVIRPKPPSERVELDENLVKALFQHRRKVVAKALRE
FT                   SIHMLGLTKGDAKELKATLRTIPHAEKRVFQLTPENVKEIEEYLKAEGILRRR"
FT   gene            complement(90553..91170)
FT                   /locus_tag="PYCH_00950"
FT   CDS             complement(90553..91170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00950"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00950"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23808"
FT                   /db_xref="GOA:F8AFJ1"
FT                   /db_xref="InterPro:IPR007003"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFJ1"
FT                   /protein_id="AEH23808.1"
FT                   /translation="MDYHRRHPYHASIKKKRNLEYEEYAYVLDYLPNGYPDLTTGQYLG
FT                   KPVAQVIGEKAFTLLEVTPKTDLMLYERVFVGRGNRDKILVINKKLGYDELTDTAKAEL
FT                   PYVLEEIVKNNEERFVKFFNVAPPITNRLHSLELLPGIGKKHMWEIIEEREKKPFESFE
FT                   DLKHRIKGLPDPVKMIAKRILDELQGKDRYRLFVGHNRIFRG"
FT   gene            91274..92311
FT                   /locus_tag="PYCH_00960"
FT   CDS             91274..92311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00960"
FT                   /product="aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00960"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23809"
FT                   /db_xref="GOA:F8AFJ2"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFJ2"
FT                   /protein_id="AEH23809.1"
FT                   /translation="MVDWALMQRVIEAPGVSGYEHLGIRDLVVDILKEVADEVKVDKLG
FT                   NVIARFKGSSPKVMVSAHMDKIGVMVNHIDKDGYLHIVPVGGVLPQTLVAQRIRFFTEK
FT                   GERYGVVGVVPPHLRKPEERNKSVDWDAIVVDIGAGSKEEAEEMGFRIGTVGEFAPAFT
FT                   RLSEHRFATPYLDDRICLYAMIETARSLGEHEADIYFVASVQEEVGLRGARVASYAINP
FT                   EIGIAMDVTFAKQPGDKGKIVPELGKGPVMDVGPNINPKLRAFADEVAKKHDIPLQVEP
FT                   SPRPTGTDANVMQINREGVAIAVLSIPIRYMHSQVELADARDVDNTIKLAKALLEELRP
FT                   MDLTP"
FT   gene            92317..92865
FT                   /locus_tag="PYCH_00970"
FT   CDS             92317..92865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00970"
FT                   /product="archemetzincin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00970"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23810"
FT                   /db_xref="GOA:F8AFJ3"
FT                   /db_xref="InterPro:IPR012091"
FT                   /db_xref="InterPro:IPR012962"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFJ3"
FT                   /protein_id="AEH23810.1"
FT                   /translation="MILVVPIGGTRAVAKEIAARVSSFYSPFGIKVEVHPGIPVDTFLR
FT                   FYDPFRGQFLGRGFLPELSRLCSYCSAILGVVDLDLYEPGLNFIFGLANSSLRAAVIAL
FT                   PRLRPEFYGLAPDEKLFIERAVKEAMHELGHVFDLGHCPNPRCVMHFSNSILDTDAKGW
FT                   LYCERCLSLLKKRLSMGHV"
FT   gene            complement(93339..94160)
FT                   /locus_tag="PYCH_00980"
FT   CDS             complement(93339..94160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_00980"
FT                   /product="cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_00980"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23811"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFJ4"
FT                   /protein_id="AEH23811.1"
FT                   /translation="MYFAKLEFFNPFSRSIKDRPVFNMMKDIRKRTRLYEASSGNVGIA
FT                   MAALSAVLGHRFKAYLPKPTPKATEVLIRIFGAEIVRTDFETIDRAFVEFVKEEAAREG
FT                   AVNLNQFENDANFEAHYYGTAKELEEQLKSIGKEADAIVAGIGTSGHIAALSKYFRERY
FT                   GTRIIGVVPAEGESIPGIKRLETGPKWISEVEIDEVVEVTAKEAFEGVVKVARGDGLLI
FT                   GMSSGAVVKAYEMTRPEGTVVLIFPDDGFKYVELFEKFLGGAQGRSVSPVL"
FT   gene            complement(94287..95474)
FT                   /pseudo
FT                   /locus_tag="PYCH_00990"
FT                   /note="ABC transporter/permease / fragment"
FT   gene            complement(95476..96465)
FT                   /locus_tag="PYCH_01010"
FT   CDS             complement(95476..96465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01010"
FT                   /product="ABC-type dipeptide/oligopeptide transport system,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01010"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23812"
FT                   /db_xref="GOA:F8AIP6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIP6"
FT                   /protein_id="AEH23812.1"
FT                   /translation="MGISAEKILKISGIYLTLFLLMIIIAGAVGMKISRIYANEAVDYI
FT                   KVTNQNFYRELVENASKENISPEEYYYRLLLSRVSKSNNIILVGLGMLRRSKLYLKNTP
FT                   NLDLSRAILVSLGIMAGSFCIALLIGTFLGLKFLRSKAIGVMARFFTGVPSWWVGVVLI
FT                   LIFVTKLKILSISDIAISAPSLTRYVLPVTTLVLIYVWEIANFVSYEAPKELTMPYTLA
FT                   DRAKGLPERIVRKHVLRNIAITLSSFSFQKFGELFTDFVAIDVLFGLGGLGSLLKQSFV
FT                   REIVPPYGVIVRFNYHLFFVVTLTIMTILFLISILLETIRGILDPRVS"
FT   gene            complement(96438..97289)
FT                   /locus_tag="PYCH_01020"
FT   CDS             complement(96438..97289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01020"
FT                   /product="cobalt transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01020"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23813"
FT                   /db_xref="GOA:F8AFJ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFJ5"
FT                   /protein_id="AEH23813.1"
FT                   /translation="MIIEVENVSFRYAHSPEPSLRGISMAVRKGEFVGIVGPSGSGKST
FT                   FCLTLNGIIPHSIKGEFRGNVYVDGLNTREHSVATLSTRVGLVLQNPDAQLFNMTVEDE
FT                   VAFALENLGIEREEMERRIRWTLKLVGLWAKRHEFPPNLSGGEKQRLAIASVLVMKPKV
FT                   LVLDEPTAQLDPLGRKEVLSLIALLNREEKITVILVEHNTEYLLEYADRIIVFDNGRIL
FT                   MEGKPEEVFENVEVLENIGVRIPARIKISYELKRMGLTDKIIFDRERIVEVLRWAYQRR
FT                   KS"
FT   gene            complement(97286..98773)
FT                   /locus_tag="PYCH_01030"
FT   CDS             complement(97286..98773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01030"
FT                   /product="trk system potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01030"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23814"
FT                   /db_xref="GOA:F8AFR3"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFR3"
FT                   /protein_id="AEH23814.1"
FT                   /translation="MAKLRLGRFINVSDDIFVIRNLIGALLQGIGVAYLVPVLILWFYP
FT                   EEIDFAPYYIGPGVGSILLGSLLSWHIEKVEDVNLRQAMIASAFVWLFASFVSVLPFMK
FT                   IAKMSFVDSYFETMSAWTGTGLTMMSNLESKPHILLFWRAWMQWLGGIGIILVALTILI
FT                   RPGVAAARLYRAEARSERILPNLANTAKIIVKIYAVLTLVGAYLYYLNGMSPFDALLHS
FT                   MTGLGTGGMSTHDLSIGYFNSLAIETITIFLMILGATNFTVHYRVFKNRSLKEFFKDIQ
FT                   VKYMFYFLGMIIPAMVYSLYRFGNLNPITALREAIFHAVSAITCTGFSIDDLSSYPEVA
FT                   KVLIGLLMVIGGGAGSTAGGIKLIRIVITFQSLKWTIQQAILPKGAVIKRRVADYEFSE
FT                   EEVQEVLSFTMTYFAFLVLGTLYIMLRLGEGFANSFFETASAIGNVGLSVGITSPALPV
FT                   DVKILLIVLMWIGRLEIFSTLVFVVGLAMILPRVFKR"
FT   gene            complement(98820..100127)
FT                   /locus_tag="PYCH_01040"
FT   CDS             complement(98820..100127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01040"
FT                   /product="nucleic acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01040"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23815"
FT                   /db_xref="GOA:F8AFR4"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013696"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR024913"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFR4"
FT                   /protein_id="AEH23815.1"
FT                   /translation="MKLHIGIDDTDSPKGMCTTYIGALLYRELSRLGEPLDLPRLIRLN
FT                   PNVPYKTRGNGAVAMTFEVEEELIPEIKDIVLFYVNQLADLEDENTNPGVVFLEGEIPE
FT                   ELREFSLRALREHVTVEEAEEAARRAGAEYFKFKLGRGIVGALAAIAYPFKHFTYELLA
FT                   YRKPENWGTPRKVDRESVFEMDRLFYPFTYDNVDPYKRSVLIAPHGKDPVLVGIRGIDA
FT                   GKVLQAFEIVRFEEPVALYQLYRTNQGTDDHLTFKKIGELKPYDSAVVRGIVVKPYWEK
FT                   GRHVFFELEDETGRIRVAAFEPTKKFRNFVRKLLPGDEIIAAGGVKEHDGVLTLNLEKF
FT                   YPVKLAPKIEYRKPKCPSCGGTMKSKGDYLKCKKCGHRMPKKLIPVEMPRDLEKKIYEV
FT                   PPDARKHISRPLVLPGGEDKILEALIGMHKTVPSSR"
FT   gene            complement(100473..100649)
FT                   /locus_tag="PYCH_01050"
FT   CDS             complement(100473..100649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01050"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23816"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFR5"
FT                   /protein_id="AEH23816.1"
FT                   /translation="MHVLKNGGVVRAVSIETVMTLAKRAWSNHRDLLKANSETRSGEAD
FT                   EGEYLEGNKASSL"
FT   gene            100644..101560
FT                   /pseudo
FT                   /locus_tag="PYCH_01060"
FT                   /note="L-tyrosine decarboxylase / fragment"
FT   gene            101733..103310
FT                   /locus_tag="PYCH_01080"
FT   CDS             101733..103310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01080"
FT                   /product="hypothetical protein cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01080"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23817"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFR6"
FT                   /protein_id="AEH23817.1"
FT                   /translation="MKKTIIVLIVVLFLGSIASGAAVYNIPIDSREYLGAKVEYKRSLL
FT                   HPSLEIELPEKGYGIVTASILLPNGSLMELGTFSGRDKIKISYSQLIKVMKLWGSYLKS
FT                   AKLDSRAVSASLLLLGTLRDENNNVQYFIKAVPINVGEVLDKRSIGVKLPRGGSKILYT
FT                   KKQIEKMLKSIEPQKIKGNSISATTENWPPGFDYDQCYPKCDPWTGSCYQVCLVWKLEQ
FT                   VIASKSNTIIPLATFQVTGDTGKINGITITTMYRQRTTQSLELIFSAAAAVQRGGSSSS
FT                   TEAEIIGTSYSINTEDLTIPESHITIWGSELSNPSVIGAGIKGTVVLAKYRLYWWDGLV
FT                   YQKLDDVAYIILGKPDEEDMSLQKFVEHGWPSQYGGIGRRTMWFVHSYWEPTSYESQQG
FT                   GLTKLDVDFLSSTDTIPLFSASMVALGTLNYNNLEIAPFVMAIGVGFNTDSAEFSLIHL
FT                   NLQLKEEYKNHYVDGTFYSSKVKFQYKDSQYSLAGMYGDIYVYSSGSLPPCDPRTGICP
FT                   TSDDLRGQ"
FT   gene            complement(103344..103976)
FT                   /locus_tag="PYCH_01090"
FT   CDS             complement(103344..103976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01090"
FT                   /product="putative cobalt/zinc/cadmium cation efflux pump
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01090"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23818"
FT                   /db_xref="GOA:F8AFR7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFR7"
FT                   /protein_id="AEH23818.1"
FT                   /translation="MAFLIGEALLIAAYEIGRDAVYRIIEGGTIEVNSIMLGVTVLSIL
FT                   SKEAMFRYSVYVGRKLNSQILIADAYHHRSDALSSVAVLVGLGAQKLGFQYGDAIAGLV
FT                   VAVFLVKVSLEIIRENVRYLPGQAPPFEVCERIKKIALNVPNVLGVHDLRAHYVGNKLH
FT                   VELHVEVPPELSLKEAHDISEEVKKRIGQIPEVEVAFVHVDIKGVTK"
FT   gene            104306..104770
FT                   /locus_tag="PYCH_01100"
FT   CDS             104306..104770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01100"
FT                   /product="putative molybdenum cofactor biosynthesis protein
FT                   MoaC"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01100"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23819"
FT                   /db_xref="GOA:F8AFR8"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR023047"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFR8"
FT                   /protein_id="AEH23819.1"
FT                   /translation="MKLTHVDERGVKMVEVGHKPDVIRKAIAKGRIRLRAETVRLIREG
FT                   KVEKGNVLAAAQIAAILAVKKTPELIPLCHPIPLTGIDVTFEFGEDYIEVTCEVRAHYK
FT                   TGVEMEALTGVTVALLTIWDMVKAVEKDEHGQYPFTRIENIRVVEKMKGE"
FT   gene            complement(104817..104960)
FT                   /locus_tag="PYCH_01110"
FT   CDS             complement(104817..104960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01110"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23820"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFR9"
FT                   /protein_id="AEH23820.1"
FT                   /translation="MVIPARNLATEPTLLTAMNPKTYAPKATTVPATPHPRLLALKSTE
FT                   RA"
FT   gene            complement(104929..105588)
FT                   /locus_tag="PYCH_01120"
FT   CDS             complement(104929..105588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01120"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23821"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFS0"
FT                   /protein_id="AEH23821.1"
FT                   /translation="MIERLIKPAFVLIEAETEMERREIEKELRRKGFHIAELFGEGYEL
FT                   ESLVESFIEMTSGKFVYLIKARDGKVLARGSEAGVRSLKIEKEYIVRSEKALVNLILMK
FT                   ESRNKKALRTAVLIGLAAVVGLLLNSGEDFSWIWIGGTAIAGSELMKALEYLLLGYREK
FT                   EKSEKPKKRRRKNKKEDKKENRHRRAFRGFRKPSKPPEEEKGEQPSGGHPSEELSY"
FT   gene            complement(105600..106406)
FT                   /locus_tag="PYCH_01130"
FT   CDS             complement(105600..106406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01130"
FT                   /product="glucose-1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01130"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23822"
FT                   /db_xref="GOA:F8AFS1"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFS1"
FT                   /protein_id="AEH23822.1"
FT                   /translation="MDVKIDLGGMGVLVTASSQGIGLNVARELLKRNARVVISSRSEEN
FT                   LKRAAEELSSYGEVHYVRADLKEKGDLEKLVKEAWELLDGVDALVWNAGNVRCEPCLPH
FT                   EATYMDWLEAALLHLVAPGYLTTLLVQTWLERKRKGVLVYLSSSSVLEPMPPLLLADAT
FT                   RAGLVQLAKGVSRVYGRKGIRAYTVLLGSFDTPGARENLRAIAEEREEPFEAVWEREVL
FT                   GRTPLHRTGRWEELGSLVAFLLSGEAEYLLGSTILIDGAMTRAVNL"
FT   gene            complement(106432..106968)
FT                   /locus_tag="PYCH_01140"
FT   CDS             complement(106432..106968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01140"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01140"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23823"
FT                   /db_xref="GOA:F8AFS2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFS2"
FT                   /protein_id="AEH23823.1"
FT                   /translation="MIRQIVLRGKKVSLGILLKEDIPKVWLWYNDRDIRRFLSSPDALF
FT                   YFEDEMEWYERVRREKERHRVFGILENRSDGLVGILGLHGIDFKNGYAELGYFLAKEFW
FT                   GKGYATEAVSLALTYAFEWINLRKVIARVYAPNKASIRVLEKNGFILVGRLREHVYVPG
FT                   HGFVDVLFYERFRNI"
FT   gene            107017..107976
FT                   /locus_tag="PYCH_01150"
FT   CDS             107017..107976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01150"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23824"
FT                   /db_xref="GOA:F8AFS3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR020886"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFS3"
FT                   /protein_id="AEH23824.1"
FT                   /translation="MMEKEKLINIVEGVLRRTGFRTARFNFRGGCFDLVASRYLLLLFI
FT                   KTLVNIDAFTEEQAEDLKKLAKLFKASPLLVGLRTKNVELEEGVVYERFGVYAVSPETL
FT                   YSLFVENEPPLIMAERGGFYVRIDGERLRRLREEHGYTLGELANLVGISRKSLQKYERG
FT                   EGSVSLEVAIRLEEVFDEPIAKPIDILAARLEDVELEARPETKLEQEIFERLRRIGMGV
FT                   VKIKRAPFNAVSKEEEEDIRLLTGIDERKTGSTVRRARLVGEITKVVGSEGLFILKDVK
FT                   AEVVSEVPLLPKRVLEEVRDVDELIEVIEELRRSRLKF"
FT   gene            complement(107966..109327)
FT                   /locus_tag="PYCH_01160"
FT   CDS             complement(107966..109327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01160"
FT                   /product="DNA damage-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01160"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23825"
FT                   /db_xref="GOA:F8AFS4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFS4"
FT                   /protein_id="AEH23825.1"
FT                   /translation="MTDIRKKLWQLAWPAIMGNISQTLLNLVDTMIVGHVSAVAVGAVG
FT                   LGGQVSWFMFPVMIAVSTGTLALVARRVGEGNMGEASHVAEQSMCLAFLLGIPIMLFGW
FT                   FLGDDVLRIMGAKGEVLELGYAYLKVLFAFYPIRFMGFAFFSALRGAGDTKTPMKLNIL
FT                   MNLVNAVLDYLLVFGKLGFPRLGPVGAAWASGVGITSAFIVGMFLFLRKKLILKPVLDL
FT                   RLRLDIIGKVLHIGIPTMVERGLFSFYNFLYMSIVTRFGNIALAAHQIGLRVESIAYMP
FT                   AFGFSIATSSLVGQSLGAKKPEQAEAVVREALKMVTLFMSVMAIVLIAFPHYLVRPFLN
FT                   PSDPHYSDVLRLASIYLIIVGISEIPLGWTFVFSGALRGAGDTKSPMYVTAVSKLLFRI
FT                   VPSYLLGFGFAFMGFTFEGLGVIAAWLAMTLETFTTALLFWWVFRKGRWKTIKI"
FT   gene            109474..110226
FT                   /locus_tag="PYCH_01170"
FT   CDS             109474..110226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01170"
FT                   /product="cell division inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01170"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23826"
FT                   /db_xref="GOA:F8AFS5"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFS5"
FT                   /protein_id="AEH23826.1"
FT                   /translation="MAVVVVTGRGGAGKTTTTANISTYFAQEDYRVLAIDGDLYLPNLG
FT                   LHFALDNVKYTVHSVLKDPNMDPEWAIYRHKETGVYVMPGSSRLEDVLGISGQRLRDLV
FT                   DNLRYKYPLIFVDSPTGVPFDTLPTFEAANYQIIVVEIERSPIYSFETMVENEVLKLKA
FT                   LGDRYGLKVGVVINKVREAADVIDKIVEVIEEEIGVPVLGVIPFDDSVPESINAGIPVL
FT                   VYKPHSDASLAFKEAGQITEEWIFGSKG"
FT   gene            110231..111457
FT                   /locus_tag="PYCH_01180"
FT   CDS             110231..111457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01180"
FT                   /product="3-hydroxy-3-methylglutaryl-coenzyme A reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01180"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23827"
FT                   /db_xref="GOA:F8AFS6"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004554"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="InterPro:IPR023282"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFS6"
FT                   /protein_id="AEH23827.1"
FT                   /translation="MDIEELIEKVARGEIKLHQVEKYTEGDRRLATEIRRKALERKLGV
FT                   KLEHIGHYSIDPNELIGRNIENMIGVVQIPMGVAGPLRINGEYARGDFYIPLATTEGAL
FT                   VASVNRGCSALTEAGGVVTTLLDDKMTRAPLIKCPNARKAREVAEWVKANIEYLQEKAV
FT                   SKVTRHGKLRDVKPFIVGKNLYMRFEFETGDAMGMNMVTIASEEIMKVIEEHFPDVRYL
FT                   ALSGNLCVDKKPNAVNFILGRGKTVIAEAVVPRGIVERKLKTTPELIAEVNYLKNLVGS
FT                   AQAGAYGFNAHFANIVGAIFLATGQDEAQITEGAHGITLAEVTPEGDLYISVTMPSLEI
FT                   GTVGGGTRVPTQREALSIMGVAGGGDPPGVNAKKFAEIVAGAVLAGELSLLAAIAAKHL
FT                   ARAHKMLGR"
FT   gene            111613..112938
FT                   /locus_tag="PYCH_01190"
FT   CDS             111613..112938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01190"
FT                   /product="TBP-interacting protein TIP49"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01190"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23828"
FT                   /db_xref="GOA:F8AFS7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFS7"
FT                   /protein_id="AEH23828.1"
FT                   /translation="MAVIEELPTVKFERVGSHSHIKGLGLDENGRARFIGDGMVGQIRA
FT                   REAAGIAVKLIKQGKLAGKGILLVGPTGSGKTAIAMGIAKELGEDVPFVQISGSEIYSA
FT                   EVKKTEFLKQSLRRAIGVRISEEKKVYEGAVEKIELRKTRHPFNPYVEIPESVIITLRT
FT                   KDDRKTIRAGREIAYQLLELSVEEGDVIQIDAETGRVSKVGTTKEEEGLFFRRKVELPS
FT                   GPVLKIKEFTYTVTLHDLDIVNARAGGIFSLLFGGGLEINDEIRERVDQMVKQWVEEGK
FT                   ATLVPGVLFIDECHMLDIEAFSFLARAMEGELAPILILATNRGVAKIRGTDIEAPHGIP
FT                   LDMLDRLLIINTEPYKKEEIREIVKIRAREEGVELSEDALEYLAELGEKTSLRYAVQLL
FT                   APASIIAGGKRVEKKHVEKAREYFADVKRSIGLVEKLEGMLK"
FT   gene            113144..116677
FT                   /locus_tag="PYCH_01200"
FT   CDS             113144..116677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01200"
FT                   /product="chromosome segregation protein smc"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01200"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23829"
FT                   /db_xref="GOA:F8AFS8"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFS8"
FT                   /protein_id="AEH23829.1"
FT                   /translation="MPYIEKLELKGFKSYGNRKVVIPFSKGFTAIVGANGSGKSNIGDA
FT                   ILFVLGGLSAKAMRATRISDLIFAGSKGEPPAKYAEVAIYFNNEDRGFPIDEDEVVIKR
FT                   RVYPDGRSAYWLNGRRATRSEILDLLSAAMISPEGYNLVLQGDITKFIKMSPLERRQLI
FT                   DEISGIAEYDAKKEKALEELKQAEENLARVDLLIKEVKKQLDKLEKERNDALRYLDLKE
FT                   RLERARVALLLGEIKRLESMIDEGERKRAEIEEEARKIEVRLEELARAIVEKEKELRKL
FT                   EEELEREGGEGVIEVTRRIGDVRSKMELAKRNVELAKREIEDSQMRLIRAKDELRKTLE
FT                   EIEKTKGAIVRWGKRKEKLIEEIRAREEERNALVVRLGEIDRTFAVAREEFDTVVKELE
FT                   EARKSLYEGEARIKRAEEEKERLKAEILTGEARLPGLRERAENLRRLVEEKRAEISELE
FT                   RRLSSITSKRIRAEGELEKAVKELEKVKEELEKAEKELIRAEAQSEVRGNRAVEALKSA
FT                   GIPGIHGALAELIKVKDERHAVAIEVALGNRADHVVVDDEKVAEEAIKFLKANRLGRLT
FT                   FLPLNKIRPRSVEAEVGVRAADLVEYDPRFEPAVKFALGDTVVVENMEEARPYIGKVRM
FT                   VTLEGELFEKSGAITGGYYRPRGLRVDTKELKAKVDALKARREALEGRVNALRVELRAL
FT                   ESQSFELRIKLSDLEKELELARKDLEKVLAEERAVREEIEVAKRRINELDTLIERERGE
FT                   LAKLRGRIERLERKRDKLKKALENPEARELTEKIRAVEKEIAALREELSRVEGKLEGLE
FT                   SKLDEELLPRKAALEEEIEGLVNRINALKENIRENEEALKRLEEELRELEIEEEKMKGK
FT                   IKELRARRRTLEEEITALRKEKEELRNRLQTLQIEENTIKVKSAQLRIQLEEKRRELKH
FT                   FDAALIRSVKEVSLDLEVLRKEIEDMEAEIKALEPVNMKAIEDFEVVERRYLELKSKRE
FT                   KLEAEKESIIEFINEIEKEKKNVFMRTLEAIAKNFSELFAKLSPGGSARLILENPEDPF
FT                   SGGLEIEAKPAGKDVKRIEAMSGGEKALTALAFIFAIQRFKPAPFYLFDEIDAHLDDAN
FT                   VKRVADLIKESSRESQFIVITLRDVMMANADKIIGVSMRDGVSRVVSLSLEKAMKILEE
FT                   AKKRNEATIGG"
FT   gene            116683..117339
FT                   /locus_tag="PYCH_01210"
FT   CDS             116683..117339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01210"
FT                   /product="segregation and condensation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01210"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23830"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFS9"
FT                   /protein_id="AEH23830.1"
FT                   /translation="MESRFEPEVTPIDILLQLVQMGKVDPWNIDIVDLTEKYIQRLKEM
FT                   QELDLRVSARAILAASILVRMKSEALLREDEEEKEPEEERIRVEVDPLVPPLRRVERYY
FT                   TLEDLIEALMDALEEAERRKPKKKKKVEIEEEIFVVDDFRVDIEKHVNRLYEIVKKLYE
FT                   ETGKPILFWDLVFDPSPKVIARTFLYLLFLANMGKVELVQEEPFGDIYIVPQAQM"
FT   gene            complement(117324..117758)
FT                   /locus_tag="PYCH_01220"
FT   CDS             complement(117324..117758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01220"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23831"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFT0"
FT                   /protein_id="AEH23831.1"
FT                   /translation="MLLTRHAKERIAKRLAKKRSLSHIYSSLWAFLERAVRIEIAEGVV
FT                   AFTDGRKTLVCVPLDCERLSRGEILEKVRGVGVYECIFPEGRLAKLTRPEKFLESVPPG
FT                   EYYFYMNDEKKVLYVGKRRPLLAITFRPAKRDERLFYIWA"
FT   gene            complement(117765..119375)
FT                   /locus_tag="PYCH_01230"
FT   CDS             complement(117765..119375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01230"
FT                   /product="CTP synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01230"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23832"
FT                   /db_xref="GOA:F8AFT1"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFT1"
FT                   /protein_id="AEH23832.1"
FT                   /translation="MTKFIFVTGGVVSGLGKGITSASIGLLMKARGFKTTNIKIDPYIN
FT                   YDAGTMNPYQHGEVFVLDDGGEVDLDLGNYERFLDTSLSFDHNITTGKIYSAVIEKERK
FT                   GEYLGATVQVIPHITDEIKSRIRAIAKDYDVVVVEIGGTVGDIESMPFLEAARQMQLEE
FT                   GRDKVAFVHVTYVPKLRVVGEQKTKPTQHSVKELRSLGIQPDAIVARSEDPLEEEARKK
FT                   ISLFTNVPEEAVISAYDVEDTYEVPLLLEREGLGRYLTRRLGLPEREPDLRAWEKMVAR
FT                   YKALKESVEIAVVGKYVKLPDSYLSIKEALKHASVSNDVKVKIRWVEAEDVEKHGTKLL
FT                   EGVDGIIVPGGFGARGTEGKIMAIRYARENDIPFLGICFGFQLTVVEFARNVLGLKGAH
FT                   STEIDPQTPYPVVDLMPEQRNLDRLGGTMRLGAYPVKIKSGTLAHNLYGKELVYERHRH
FT                   RWEVNPDYIEELERAGLVFSGVAGDDERRMEILELPDKRYFIATQFHPEFKSRPMKPAP
FT                   VFHGLVRAAKEFKREKVDV"
FT   gene            119537..120958
FT                   /locus_tag="PYCH_01240"
FT   CDS             119537..120958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01240"
FT                   /product="acetyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01240"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23833"
FT                   /db_xref="GOA:F8AFT2"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFT2"
FT                   /protein_id="AEH23833.1"
FT                   /translation="MENDRIVQELKPFFEPRAVAIIGATNKKGKVGNVIFENFKRNKER
FT                   GIFKGNIYPVNPKLDEIDGYKVYHSVEELPDDTDLAVIAIPAPFVPDTMREIAKKGIKA
FT                   VIIITGGFGELGEEGKRMEREILEIAKANGIRVIGPNCVGVYAPDTGVDTVFLPEEKMD
FT                   RPKSGPIAFISQSGAFAAAMLDWAAMAGIGIGKMVSYGNKLDVDDADIMEYFMHDDQIK
FT                   VMTFYIEGVKDGRKFMEAAKKVTKVKPVIALKSGRTEYGAKAASSHTGSLAGQDVIYDA
FT                   VFKQTGIIRAEDFEHMFDLAKAFAKCKLPKGDRIGIITDGGGAGVMASDAVAKFGLRLA
FT                   ELSEETLKFLKEKFPPHAVVGNPTDVVGDTDAGRYRLALEAFVKDPNVDAILVIVLFQV
FT                   PLLNEEEVIEIIADYARKSDKPIVAVAMGGKKTDRYARMLEEKGVPVYPTPERGVRALA
FT                   ALVQYAKYLERGNAE"
FT   gene            120955..121671
FT                   /locus_tag="PYCH_01250"
FT   CDS             120955..121671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01250"
FT                   /product="Acetyl-CoA synthetase (ADP forming), beta chain
FT                   (acdB)"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01250"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23834"
FT                   /db_xref="GOA:F8AFT3"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFT3"
FT                   /protein_id="AEH23834.1"
FT                   /translation="MREEALGVIEEVLKSGRTAMVEYEAKQVLKAYGLPVPEEKLAKTL
FT                   DEALKYAEEIGYPVVMKLMSPQILHKSDAKVVMLNVKSPEELKEKWALIHENARKYRPD
FT                   AEILGVLIAPMLRPGREIIIGVTEDPQFGHAIMFGLGGIFVEILKDVTFRLVPITEKDA
FT                   RKMISEIKGYPILAGARGEEPADIEAIVDMLLKVSQLVDELKDYIKEMDLNPVFVYEKG
FT                   KGAVIVDARIILKERA"
FT   gene            complement(121695..122009)
FT                   /locus_tag="PYCH_01260"
FT   CDS             complement(121695..122009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01260"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23835"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFT4"
FT                   /protein_id="AEH23835.1"
FT                   /translation="MKPLKLATSLLFLNGLLLLYYAHSLGSRAYLAFSLFSIGLALGLL
FT                   WESRKAVKVALIYAASEFFFALLFLMAGNVLSAIDAGISLLIIHDIIGYIEKREQNCRA
FT                   "
FT   gene            complement(122006..122611)
FT                   /locus_tag="PYCH_01270"
FT   CDS             complement(122006..122611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01270"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23836"
FT                   /db_xref="GOA:F8AFT5"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFT5"
FT                   /protein_id="AEH23836.1"
FT                   /translation="MRVVALLSSGIDSPVAIHLMASRGAEVFPLHFRQDEIKESKVRRL
FT                   VGRLREIHGELVKEPKIVDAFEVQEPVFDRLREIGKEKWTCVFCKYIMYIIAEGYARRI
FT                   GAKAIVTGDSLGQVASQTLDNLMVISSATSLPVIRPLIGLDKEEIVQIAKEIGTFDIST
FT                   EEEPGCPFVPKFPVVRASPSQFKKILEEVKDKLPRGYP"
FT   gene            complement(122608..123081)
FT                   /locus_tag="PYCH_01280"
FT   CDS             complement(122608..123081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01280"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23837"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFT6"
FT                   /protein_id="AEH23837.1"
FT                   /translation="MKPKVLAILFLMYFVVGLAIVLRQNPWFSFTENALSDMGSVKNPV
FT                   GWMFNGFVMGLGVLGIITALALERKLLALSMAFLFLVGVFPEETEPHGPVAVLFYLLAL
FT                   TDMGLYGGIWRIISVATLLGMLVLMRVFDGLAIPELLGASSILSYILWLGMRK"
FT   gene            123148..123768
FT                   /locus_tag="PYCH_01290"
FT   CDS             123148..123768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01290"
FT                   /product="Zinc metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01290"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23838"
FT                   /db_xref="GOA:F8AFT7"
FT                   /db_xref="InterPro:IPR012091"
FT                   /db_xref="InterPro:IPR012962"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFT7"
FT                   /protein_id="AEH23838.1"
FT                   /translation="MDRIAFAYMGGEEFSDVFFEVYDRVRRYFRDVGLAIVPIYVGRIP
FT                   LPPGTLARVETSEGYVKMYSFEAVVEALYGKLVEMKESVHDESLTKIFGLTTYPVGSRD
FT                   PHLDFYKKYLGLQVTVANYHVMVLSMKPFQSENRFLFVERVFKGVLHEIGHLYGLDHCR
FT                   NRCVMNPPSDVQEWDSRPPTYCNSCLKKLRDREELKPMPRFPL"
FT   gene            complement(123740..124549)
FT                   /locus_tag="PYCH_01300"
FT   CDS             complement(123740..124549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01300"
FT                   /product="GTP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01300"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23839"
FT                   /db_xref="GOA:F8AFT8"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022840"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFT8"
FT                   /protein_id="AEH23839.1"
FT                   /translation="MRFYETQEEPPDIKERLHRVGITNLRTVAKINWKGRVYTFIPTFE
FT                   VTIDVPEDKKGIHMSRLVESITEAMSEAVEEEVMLSHTSLEELALAVIRRIEKKHRHRR
FT                   AEVWIRTHLILEKTTPASGRTSLEPYDVEVGVIKEYEKLEKVLRVTVIGNTVCPHAMAN
FT                   NDGRTHIQRAVATLEVRTDFGEDITLEDMIEVVESSFSSPTYTLLKTMDENAVVQKMYE
FT                   NPKFVEDVAREILAKAKERFRGKIHVKVTSHESIHKHDVIAETWALV"
FT   gene            complement(124624..124827)
FT                   /locus_tag="PYCH_01310"
FT   CDS             complement(124624..124827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01310"
FT                   /product="histon"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01310"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23840"
FT                   /db_xref="GOA:F8AFT9"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFT9"
FT                   /protein_id="AEH23840.1"
FT                   /translation="MAELPIAPVDRLIRKAGAERVSEEAAKILAEYLEEYAIEISKKAV
FT                   EFARHAGRKTVKAEDIKLAIKA"
FT   gene            complement(125040..125492)
FT                   /locus_tag="PYCH_01320"
FT   CDS             complement(125040..125492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01320"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23841"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFU0"
FT                   /protein_id="AEH23841.1"
FT                   /translation="MLRDILRMERGVIMITGDAKRITKILVDNWTGRGIVFLAEELPFT
FT                   PEIPEMVYIGRPSEGFGGYLLVDVLKKGKMERKGIYEWINAVRDMAIVVLYERAYYLDS
FT                   VLRHGISKFLDYLLAYKRETVGFELLTVYKFENGKIVDRKRYVRKR"
FT   gene            125549..126787
FT                   /locus_tag="PYCH_01330"
FT   CDS             125549..126787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01330"
FT                   /product="nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01330"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23842"
FT                   /db_xref="GOA:F8AFU1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFU1"
FT                   /protein_id="AEH23842.1"
FT                   /translation="MSDGKIIHDAVHGSMKIPEVFMRFVETPEFQRLRYIRQLGLAYLV
FT                   YPGANHTRFEHSLGTWHLARKLAVELELPQEEALLVQLAALLHDVGHGPFSHTFESIYR
FT                   EYAKGHDHMSLTRAIVEGKVEIVEGGEIPDLIKGLGFEPREIGELIFGTHEKRYLGMMI
FT                   HGDVDVDQLDYLARDAHYTGVAHGIIDLERLLMVLKIHEGELVVDEKGVEAVEGMLVAR
FT                   SLMYSRVYFHHTVKIAEGMLTRALEFALEEGLLWDFWKMTDCRLMVELEDLEGYPSEIV
FT                   ARLRRRRLYKAAVVAGPEDLTGEEKRILYSIYRSVRKRREVEKELADRVGAKEGEIILE
FT                   FSTAELISSEPRIKQAGIGVLLDDGRVEPITRVTPLAGAIKRRQTPRWVVLIATPEEYV
FT                   EAVRKVWKEVLFG"
FT   gene            126863..127258
FT                   /locus_tag="PYCH_01340"
FT   CDS             126863..127258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01340"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23843"
FT                   /db_xref="GOA:F8AFU2"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR012426"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFU2"
FT                   /protein_id="AEH23843.1"
FT                   /translation="MGLFDKLKKGEAQRKPVASIRKDVKGKTPDVELVPLEEDAIAREL
FT                   VKPQTRYIKKIVVTSYADLEKISSELQAGNIVIADLTPLESKTEILAKVAEQIKGMAQA
FT                   LGGDVAKISKCEIKLIITPSDIKISRE"
FT   gene            127382..128227
FT                   /locus_tag="PYCH_01350"
FT   CDS             127382..128227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01350"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23844"
FT                   /db_xref="GOA:F8AFU3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFU3"
FT                   /protein_id="AEH23844.1"
FT                   /translation="MKVKTIMTPNPAVITLPATRNYALDLFKKHKVRSFPVVNREGKLV
FT                   GIVSIKSVLLHPDEEQLAMLVKRDVPTVKPDDDLKKAARLMLEHDYRRVVVVDNEDKPI
FT                   GILTVGDIIRRYLAKNEKYKEVEIEPYYQRHVSIVWKGTPLKATLKALLLSNAMALPVV
FT                   DDNGNLVGIVDETDLLKDSEIVRVMKSTSLSASSEEDWILESHPTLLFEKFELQLPNKP
FT                   VEDIMTRELIIATPHMTVYEVAKKMAKYHIEQLPVIRGEGELVGLIRDFDLLKVLVKGK
FT                   "
FT   gene            128282..129178
FT                   /locus_tag="PYCH_01360"
FT   CDS             128282..129178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01360"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23845"
FT                   /db_xref="InterPro:IPR003750"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFU4"
FT                   /protein_id="AEH23845.1"
FT                   /translation="MQKFFTTSKSRRVETFESLLNRPLKHHHSLPGKRELRMAGITWHV
FT                   FIPDSLLEETHDPKLRAYKVGQIARAAAIFGVEHIWIYRAGGRDGRFIKTLLEYAETPQ
FT                   YLRKRLFPLMPELRYAGVMPPLQIPSHKPKESPRIGEIREGFAYRKGKKLFADIGLDRP
FT                   ALVKGVAQEGRGTFKVISVKPLRVVPTKPEGYWGYKVHLTRMTLAKTLKKANLDVVIAT
FT                   SRKGVDVRRADVTLEGDVGIVFGSPRRGVMEILREFNEDYEFDVILNTIPGQKTKTVRT
FT                   EEAVLATLAVLNLMRGD"
FT   gene            129180..130259
FT                   /locus_tag="PYCH_01370"
FT   CDS             129180..130259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01370"
FT                   /product="50S ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01370"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23846"
FT                   /db_xref="GOA:F8AFU5"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019928"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFU5"
FT                   /protein_id="AEH23846.1"
FT                   /translation="MGKVHRPRRGSLGFTPRKRAKSIVPRIRSWPKETEVRMLGFAGYK
FT                   AGMTHILMIDDEPGLTNGKEIFMPVTIVETPPLRVFGVRAYRQGYLGLETATEVIVPDF
FT                   TLDNYVTKKGKQKTFYELLRRRIATLPKNYTEDDFQQKLGELEDLIKEGEIVEVRALVS
FT                   TQPWIIKLKKKPEVMEYAIGGTSVEEKFNYIKERLGKELRVKDVLKEGELLDVIAVTKG
FT                   KGTQGVIKRWGVKLRAHKDSKGRRKVASIGPWHPARVMWTVPMAGQMGFHHRTELNKRL
FT                   IAIGENGKLVLDGNEIEITPKGGFPHYGIVRSDFMMIAGSVPGAIKRIIRVRPAIRPPK
FT                   KKPPVQRPQITYVSVESKQ"
FT   gene            130271..131038
FT                   /locus_tag="PYCH_01380"
FT   CDS             130271..131038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01380"
FT                   /product="50S ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01380"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23847"
FT                   /db_xref="GOA:F8AFU6"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013000"
FT                   /db_xref="InterPro:IPR019970"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFU6"
FT                   /protein_id="AEH23847.1"
FT                   /translation="MKVKVFDLNGEPVEEIELPKVFETPFRPDLIRRAVIASWTHRIQP
FT                   QGRDPMAGKRRVTENIGKGHGMARVERLKTPPRYAAFVPFARGGRRTHPPKVEKIIWEN
FT                   INKKERRLAIMSAIAATANYDLVKARGHIIDNVPQIPLVVVDELEKVSKTRETREIFKK
FT                   LGIWDDIMRAKEKSGVRAGKGKMRGRRYKKAKGPLIVVAKNEGIVFGARNHPGVDVVVV
FT                   DNLGIEHLAPGTHPGRLTIWTKSAIERLREIYG"
FT   gene            131045..131305
FT                   /locus_tag="PYCH_01390"
FT   CDS             131045..131305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01390"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01390"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23848"
FT                   /db_xref="GOA:F8AFU7"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="InterPro:IPR019985"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFU7"
FT                   /protein_id="AEH23848.1"
FT                   /translation="MDPYKVIIRPVVTEKAISLIERENKLTFIVDRRATKTDIKRAVEE
FT                   IFGVKVEKVNTLITPRGEKKAYVKLKPEYSASEVAARLGLF"
FT   gene            131326..132045
FT                   /locus_tag="PYCH_01400"
FT   CDS             131326..132045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01400"
FT                   /product="50S ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01400"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23849"
FT                   /db_xref="GOA:F8AFU8"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR023672"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFU8"
FT                   /protein_id="AEH23849.1"
FT                   /translation="MGKSLIQQRRGKGSPTFKSPSHRFRGAVKYIPLNYTAERTIRGVV
FT                   EEIMHDPGRTAPVARVKFENGIEKLIIAPEGLLVGQEIYIGPEAPVAIGNTLPLAKIPE
FT                   GTYIYNIEGVPGDGGKYVRAGGTYALVVSREKDKVIVQLPSGELKAFNPMCRATIGVVA
FT                   GGGRLEKPLVKAGKAYYKYKARNRFWPTPRGVKMNAVNHPFGGKEHHPGKPTTTSRRAP
FT                   PGRKVGHIAARRTGRRK"
FT   gene            132056..132454
FT                   /locus_tag="PYCH_01410"
FT   CDS             132056..132454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01410"
FT                   /product="30S ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01410"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23850"
FT                   /db_xref="GOA:F8AFU9"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005713"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFU9"
FT                   /protein_id="AEH23850.1"
FT                   /translation="MARREFRYRGYTLEQLMNMSLEELAKLLPARQRRSLKRGLTPEQK
FT                   KLLRKIRLAKKGKYNKPIRTHCRDMIVLPEMVGLTIYVHNGKDFVPVEIKPEMIGHYLG
FT                   EFALTRKPVKHGAPGIGATRSSMFVAVK"
FT   gene            132465..132932
FT                   /locus_tag="PYCH_01420"
FT   CDS             132465..132932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01420"
FT                   /product="50S ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01420"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23851"
FT                   /db_xref="GOA:F8AFV0"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005721"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFV0"
FT                   /protein_id="AEH23851.1"
FT                   /translation="MGKRFGYSFQNFDPERMARASGRDLRISPKFAVEVCREIRGMMLN
FT                   DAIRYLDEVIALKRPVPLRRYNDSQGHKPGKGFGPGRYPVKVAKAIKKVLLNAKNNAEQ
FT                   KGLDPDRLRIIHIAAHKGPVLRGWYPRAFGRATPFNEQTTHIEVVVEEVRR"
FT   gene            132937..133569
FT                   /locus_tag="PYCH_01430"
FT   CDS             132937..133569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01430"
FT                   /product="30S ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01430"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23852"
FT                   /db_xref="GOA:F8AFV1"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005703"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027488"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFV1"
FT                   /protein_id="AEH23852.1"
FT                   /translation="MAIERYFIREAVREMLIDEYLEKELRRAGYGGLDIKKTPLGTKVI
FT                   IFAANPGYVIGRGGRRIRELTRVLERQFGLENPQIEVEEIKNPYLNAKVQAVRLAQALE
FT                   RGIHFRRAAYAAMRAIMNNGARGVEIRLSGKLTGERAKSVRFYQGYLAKVGNPAETLVS
FT                   KGYAQALLKLGVIGVKVAIMPPEARLPDEIEIIEKPVEEEVSTNEAE"
FT   gene            133556..133762
FT                   /locus_tag="PYCH_01440"
FT   CDS             133556..133762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01440"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01440"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23853"
FT                   /db_xref="GOA:F8AFV2"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFV2"
FT                   /protein_id="AEH23853.1"
FT                   /translation="MKPSEIREMSIEEIDQKIRELRLQLAKERGMLTMGTSLENPMVIR
FT                   NLRRDIARLLTIKREKLRERAKK"
FT   gene            133775..134071
FT                   /locus_tag="PYCH_01450"
FT   CDS             133775..134071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01450"
FT                   /product="translation initiation factor Sui1"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01450"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23854"
FT                   /db_xref="GOA:F8AFV3"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR022851"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFV3"
FT                   /protein_id="AEH23854.1"
FT                   /translation="MPRIVNPLDEMLFKEVLKEQQRIRVYVERARYGKLKTIIEGIDEK
FT                   EFDLEEIAKKLKAKLACGGTAKKGRIELQGDHRDKVKKLLAELGFSEELIEVE"
FT   gene            134068..134337
FT                   /locus_tag="PYCH_01460"
FT   CDS             134068..134337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01460"
FT                   /product="ribonuclease P protein component 1"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01460"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23855"
FT                   /db_xref="GOA:F8AFV4"
FT                   /db_xref="InterPro:IPR002730"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR023538"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFV4"
FT                   /protein_id="AEH23855.1"
FT                   /translation="MTRRNIIWHELIGLKARIVKATHPGYLGIEGYVIDETRNTLVIAG
FT                   KKIWVVPKDVVEIEFELEDGAKIKIPGRELVGRPEMRLKKRWRR"
FT   gene            134334..134678
FT                   /locus_tag="PYCH_01470"
FT   CDS             134334..134678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01470"
FT                   /product="30S ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01470"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23856"
FT                   /db_xref="GOA:F8AFV5"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019978"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR028333"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFV5"
FT                   /protein_id="AEH23856.1"
FT                   /translation="MRDIGLRVQPPAEKCDDPKCPWHGHLKVHGRVFEGIVVSDKPRKT
FT                   VTVERQYYHYLKKYERYELRRSKIHAHNPPCINAKVGDRVLIAETRPLSKTKHFVVVAI
FT                   LEKAEERAGR"
FT   gene            134684..135109
FT                   /locus_tag="PYCH_01480"
FT   CDS             134684..135109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01480"
FT                   /product="50S ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01480"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23857"
FT                   /db_xref="GOA:F8AFV6"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR019971"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR023571"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFV6"
FT                   /protein_id="AEH23857.1"
FT                   /translation="MAKKGAGATRGVSPVRPTRAIPVGAYLTVADNSGAKVIQVIGVVE
FT                   YHGTRRRLASAGVGDMVVATVKKGRPDMRHQVVRAVIIRQRKEYRRLDGMRVKFEDNAA
FT                   VIVTPEGVPRGTEIRGPVAREAAEKWVRIGSIASIVI"
FT   gene            135120..135485
FT                   /locus_tag="PYCH_01490"
FT   CDS             135120..135485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01490"
FT                   /product="50S ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01490"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23858"
FT                   /db_xref="GOA:F8AIP7"
FT                   /db_xref="InterPro:IPR005756"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIP7"
FT                   /protein_id="AEH23858.1"
FT                   /translation="MRLNSKQPRKQRKFLYNAPLHLRHKIMSATLSKELRQKYGVRNLP
FT                   IRKGDKVRIMRGDFRGHEGKVVEVDLKRYRIYVEGATIRKTNGTEVFYPIHPSNVMIIE
FT                   LNLEDDRRKKIIERRAG"
FT   gene            135485..136231
FT                   /locus_tag="PYCH_01500"
FT   CDS             135485..136231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01500"
FT                   /product="30S ribosomal protein S4e"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01500"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23859"
FT                   /db_xref="GOA:F8AFV7"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR018199"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFV7"
FT                   /protein_id="AEH23859.1"
FT                   /translation="MARKGPKRHLKRLAAPTSWYIERKAYKWAVRPRPGPHSMKTSIPL
FT                   LYIVRDYLGYAKTAREARKILNEGKILVDGKVRKDYKFPVGIMDVVSIPETGEHYRVLP
FT                   NRIGKLILHPISEEEAKIKPFRIRNKRMVKGGNLQLNLHDGSNHLIRLSSLTDETKDRY
FT                   HTSDTLIMRVPEREIIEVLPFEVGAYVFVTQGKNVARKGRIVEIRHFPMGWPDVVTIED
FT                   EEGELFDTLKEYAFVVGKDSPRISLP"
FT   gene            136242..136802
FT                   /locus_tag="PYCH_01510"
FT   CDS             136242..136802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01510"
FT                   /product="50S ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01510"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23860"
FT                   /db_xref="GOA:F8AFV8"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR022804"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFV8"
FT                   /protein_id="AEH23860.1"
FT                   /translation="MAVTIPNREAILADWEAHPMRRPRIQKVTINIGVGESGERLTKAE
FT                   IMLQQLTGQKPIRRKAKKTNRDFGIRRGEPIAVKVTLRGPKAYEMLRRLLAAVDNRLKA
FT                   SSFDEHGNVCFGIEEHINIPGVEYDPEIGIFGMDVCVTLERPGFRVARRKRKRAKIPTR
FT                   HKLTKEEGMLYLMEEFGVEIVEG"
FT   gene            136806..136976
FT                   /locus_tag="PYCH_01520"
FT   CDS             136806..136976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01520"
FT                   /product="30S ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01520"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23861"
FT                   /db_xref="GOA:F8AFV9"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023676"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFV9"
FT                   /protein_id="AEH23861.1"
FT                   /translation="MAKADYNKRKPRKFGKGARRCIRCGQYGPIIRIYGLMLCRHCFRE
FT                   VAPKLGFRKYE"
FT   gene            136988..137380
FT                   /locus_tag="PYCH_01530"
FT   CDS             136988..137380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01530"
FT                   /product="30S ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01530"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23862"
FT                   /db_xref="GOA:F8AFW0"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFW0"
FT                   /protein_id="AEH23862.1"
FT                   /translation="MTLLDPLANALSHITNSERVGKKEVYIKPASKLIGEVLRVMQENG
FT                   YIGEFEFIDDGRAGIYRVQLLGRINKAGAIKPRFPVKVTEFEKWEKRFLPAFEFGILIV
FT                   STSQGVMSHKEAREKGIGGRLIAYVY"
FT   gene            137391..137945
FT                   /locus_tag="PYCH_01540"
FT   CDS             137391..137945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01540"
FT                   /product="50S ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01540"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23863"
FT                   /db_xref="GOA:F8AFW1"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002359"
FT                   /db_xref="InterPro:IPR019907"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFW1"
FT                   /protein_id="AEH23863.1"
FT                   /translation="MPVDAWIREEIEIPEGVEVIVEGSTVTVKGPKGELKRDFSYPGVK
FT                   IFTEDGKVVIYKEFPRRKDVAVVGTFRAHITNMIKGVTEGFVYKLKVVYSHFPITVKVQ
FT                   GDEVIIENFLGEKAPRKAKILPGVTVKVKGQEITVEGIDKEAVGQTAANIEQATRITKW
FT                   DRRVFQDGIYIVEKAGKPIKF"
FT   gene            137956..138342
FT                   /locus_tag="PYCH_01550"
FT   CDS             137956..138342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01550"
FT                   /product="50S ribosomal protein L32e"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01550"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23864"
FT                   /db_xref="GOA:F8AFW2"
FT                   /db_xref="InterPro:IPR001515"
FT                   /db_xref="InterPro:IPR018263"
FT                   /db_xref="InterPro:IPR023654"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFW2"
FT                   /protein_id="AEH23864.1"
FT                   /translation="MDEKARLLRVRAKLKRKKPRFLRQEWWRYPKFKNDPKWRRPKGID
FT                   SKMRLKKKGKPRSPSIGWSSPRLVRGLHPSGYEEVLVHNVKELEKLDPARQAARIAHTV
FT                   GRKKRLAILERAKELGIKVLNPRV"
FT   gene            138352..138804
FT                   /locus_tag="PYCH_01560"
FT   CDS             138352..138804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01560"
FT                   /product="50S ribosomal protein L19e"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01560"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23865"
FT                   /db_xref="GOA:F8AIP8"
FT                   /db_xref="InterPro:IPR000196"
FT                   /db_xref="InterPro:IPR015972"
FT                   /db_xref="InterPro:IPR015973"
FT                   /db_xref="InterPro:IPR015974"
FT                   /db_xref="InterPro:IPR023638"
FT                   /db_xref="InterPro:IPR027547"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIP8"
FT                   /protein_id="AEH23865.1"
FT                   /translation="MSTLRMQRRIAADILKCGENRIWIDPERIDDVAAAITREDIRRLI
FT                   KEGIIKKKPVKGQSRYRARIRHEQKKKGRHRGPGSRKGKKTARMGKKERWIMTIRALRK
FT                   ELRKLKAEKKIDAHTYRMLYIRAKGGQFKSKHQLYLFLEERGILKR"
FT   gene            138810..139421
FT                   /locus_tag="PYCH_01570"
FT   CDS             138810..139421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01570"
FT                   /product="50S ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01570"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23866"
FT                   /db_xref="GOA:F8AFW3"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="InterPro:IPR005485"
FT                   /db_xref="InterPro:IPR025607"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFW3"
FT                   /protein_id="AEH23866.1"
FT                   /translation="MAHGPRYRVPFRRRREGKTNYRKRLALLKSGKPRLVVRKSLNHHI
FT                   AQIIVYDPKGDRTLVSAHTRELIRDFGWKGHCGNTPSAYLLGLLIGYKAKKAGIEEAIL
FT                   DIGLHPPVRGSSVFAVLKGAVDAGLNVPHSPEIFPDDYRIKGEHIAEYARMLKEQDEEM
FT                   FRRQFGGYLAKGLDPEKLPEHFEEVKARIIEKFEGEGARE"
FT   gene            139418..140128
FT                   /locus_tag="PYCH_01580"
FT   CDS             139418..140128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01580"
FT                   /product="30S ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01580"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23867"
FT                   /db_xref="GOA:F8AFW4"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005711"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFW4"
FT                   /protein_id="AEH23867.1"
FT                   /translation="MSQEWREYAKRVLDEWQPKTKLGMLVKEGQITDIHEIFRRGYQIK
FT                   EPEIIDVLLPEVNARENQEVLDITLTVRMTDSGRRVRFRVLAAVGNRDGYVGLGIGHGR
FT                   EVGIAIRKAINYAKLNIIEIKRGCGSWECRCRRPHSVPFTVEGKEGSVRVKLIPGPRGL
FT                   GLVIGDVGKKILRLAGIQDVWSQTLGETRTTVNFAKAVFDALYNTNRVAISPEMIERYG
FT                   IVVGRAMPATFSLE"
FT   gene            140140..140607
FT                   /locus_tag="PYCH_01590"
FT   CDS             140140..140607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01590"
FT                   /product="50S ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01590"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23868"
FT                   /db_xref="GOA:F8AIP9"
FT                   /db_xref="InterPro:IPR005997"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR023106"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIP9"
FT                   /protein_id="AEH23868.1"
FT                   /translation="MAKLAVIRIRGRVNVRRPIRDTLAMLRLHRVNHCVIVDDTPSYLG
FT                   MLQKAKDYITWGEINKETLAKLIRKRGKLIGNKPVTDEYVQEKLGMTIEEFAEKVIRGE
FT                   MSLKDLPNLKPVFRLHPPRGGFRGSKKRSFKEGGALGYRGEKINDLIERML"
FT   gene            140619..141062
FT                   /locus_tag="PYCH_01600"
FT   CDS             140619..141062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01600"
FT                   /product="50S ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01600"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23869"
FT                   /db_xref="GOA:F8AFW5"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR027386"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFW5"
FT                   /protein_id="AEH23869.1"
FT                   /translation="MIRRRKKVRKMRGSHTHGWGCKKKHRGGGSKGGRGMAGTGKRNKT
FT                   KWTWTIKYAPDHLGKRGFTRPPEVQRDVKVVNLKFIDEHLEELMQMGIAYEEEGRIVVD
FT                   TTQFADKVLGTGRLTRPLVIKAKAFSPKAEEKIRAAGGEAVLA"
FT   gene            141097..142503
FT                   /locus_tag="PYCH_01610"
FT   CDS             141097..142503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01610"
FT                   /product="preprotein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01610"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23870"
FT                   /db_xref="GOA:F8AFW6"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR019561"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFW6"
FT                   /protein_id="AEH23870.1"
FT                   /translation="MGARDVVYALEKWFPEVERPKKHVPLREKFVWTGLALLLYYVLSE
FT                   IPLYGIPERIQDYFQFLRVVLAGRNGSLLTLGIGPIVTAGIILQLLVGSEILKLDLANP
FT                   EDRRFYQALQRVFSVFMCFFEAAVWVLGGAFGRVGIDITHAIAVLLILQLAMGGILLII
FT                   LDELVSKWGIGSGISLFIAAGVSQTILTRSLNPLTDPNIVDPLTGEPAIVGAIPYFIQH
FT                   ILKGDLWGGFYRGGSAPDMIAVIATVIVFLIVVYFESMRVEIPLSYGRVTVRGRYPIRF
FT                   LYVSNIPIILTFALYANIQLWARLLDRFGHPWLGTFDPTTGNPISGPVLYVIPPRSIFT
FT                   VIDNPVRAIVYLLLTVGFSLLFGFLWVELTGLDARSIARQLQRAGLQIPGFRRDPRILE
FT                   RVLQRYIPYVTFWGSLTVALISVLADFLGALGTGTGILLTVGILYRFYEEIAREQVSEM
FT                   FPVLRRFFGS"
FT   gene            142562..143152
FT                   /locus_tag="PYCH_01620"
FT   CDS             142562..143152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01620"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01620"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23871"
FT                   /db_xref="GOA:F8AFW7"
FT                   /db_xref="InterPro:IPR023477"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFW7"
FT                   /protein_id="AEH23871.1"
FT                   /translation="MPFVVIITGIPGVGKSTITRLALKKTRAKFKLINFGDVMFEEAVK
FT                   AGLVKHRDEMRRLPLEVQRELQHRAAEKIAEMAKKEPILLDTHATIKTPHGYLLGLPYD
FT                   VIRTLNPNFIVIIEATPAEILGRRLRDLKRDRDVETEEQIQRHQDLNRAAAIAYAMHSN
FT                   ALIKIIENHEDKGLEEAVNELVKILDLAVKEYA"
FT   gene            143145..143672
FT                   /locus_tag="PYCH_01630"
FT   CDS             143145..143672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01630"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23872"
FT                   /db_xref="GOA:F8AFW8"
FT                   /db_xref="InterPro:IPR002809"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFW8"
FT                   /protein_id="AEH23872.1"
FT                   /translation="MLEGIYAALDELFGPLVMNTHPMLVVTVAGIILGAFFVLLNYFLV
FT                   DQEKVKRLQKMSMEFQKEFREAREKGDEKKLRKLQQKQLELIKLQNEVMKDAFFKPMLI
FT                   TWPIIIVFWGWLRRWYFEVAIVKYPFNFFLFDIFHKIYHSALQADELGYLGWYFLTSYV
FT                   VGSVLRKFLDMA"
FT   gene            complement(143669..144805)
FT                   /locus_tag="PYCH_01640"
FT   CDS             complement(143669..144805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01640"
FT                   /product="sarcosine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01640"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23873"
FT                   /db_xref="GOA:F8AFW9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFW9"
FT                   /protein_id="AEH23873.1"
FT                   /translation="MIGIIGGGITGIATAYELAKLGEDVVVFEKRFFGSGSTFRCASGI
FT                   RAQFTDEANIRLMKYTIERWKKLGEELGHDVHFRQTGYLFLATSEEEVEAFKENIRLQN
FT                   KLGVPTKLIDMDEAKEIVPPLNTEPFLAGAWNPEDGKASPFHALYAYKKAAEELGVKFY
FT                   EYTPVVGLERLDGSWLIKTERGDFKVDVIVNAANAWAPQINAMAGLDVVPIKPIKHQII
FT                   KTEPIKRGQIEPLVCPPSWNDSYVIQDGEDGGVMCGTGLEYPSSPDDFTPTYEFAREVL
FT                   KWVVRIVPALKHVHVVRQWAGHYAKTPDNNPAIGKLAEGFYIAAGFSGHGFMMAPAVGQ
FT                   AMAELIVKGRSKVPLDWEWFDPRRFERGELRKSAFQIG"
FT   gene            complement(144802..145035)
FT                   /locus_tag="PYCH_01650"
FT   CDS             complement(144802..145035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01650"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23874"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFX0"
FT                   /protein_id="AEH23874.1"
FT                   /translation="MTVEDVERLIDEGVTDIEELKRLLRIGMGPCQGRTCLPIVISILA
FT                   RKTGKRPEDIPLPATRFPVRPVPIKALVEGEK"
FT   gene            complement(145059..145562)
FT                   /locus_tag="PYCH_01660"
FT   CDS             complement(145059..145562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01660"
FT                   /product="4Fe-4S binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01660"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23875"
FT                   /db_xref="GOA:F8AFX1"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFX1"
FT                   /protein_id="AEH23875.1"
FT                   /translation="MSIPHYLREGYLTVEELKELIGLPSEERLRRGPVAIPECPQQIPC
FT                   TPCKEVCPTGAVAMERPNDIPKVDYEKCIGCSLCVQICPGLAFFMVHYIGDRARITMPH
FT                   ELLPLPRVGEEVVLLNRIGEPVGKGKVVAVIPREKAKGDTPIITVEVPIELAWEVRAVR
FT                   VVRE"
FT   gene            complement(145559..146986)
FT                   /locus_tag="PYCH_01670"
FT   CDS             complement(145559..146986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01670"
FT                   /product="sarcosine oxidase, subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01670"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23876"
FT                   /db_xref="GOA:F8AFX2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFX2"
FT                   /protein_id="AEH23876.1"
FT                   /translation="MRLGEHPILNFSRGRKVTIYFEGKQIEAYEGETIAAALHAAGIRV
FT                   LNYSRVEGRPRGLFCAIGKCSSCLMTVNGVPNVRTCITLVEDGMVIERGQGELTKDKEI
FT                   PKFGKARKVEGDIIVIGGGPAGLMAAIGASDAGAKVVLIDENHMLGGQLVKQTHKFFGK
FT                   REQFAGVRGIKIAKILEEEVRKRGIEVFLETSAVGIFQEGDEKLIVAIRKNEELIEFRG
FT                   RAVIVATGAMEKSVPFENNDLPGVYGAGAIQTLMNTYGVKPGERALIVGAGNVGLILAY
FT                   QLLQADVEVKAIVEAMPKIGGYFVHAAKVRRLGIPILTRHTILRAEGRERVERAAVAQI
FT                   DENWKPIPGTEKVFDVDLIAIAVGLRPSIELLHQAGCQIRYVPELGGHVAVRDEWMETT
FT                   VRGIFVAGDSAGIEEATTAMLEGRIAGIAAALRLGIADESWVREIEKAQKELEEFRSGP
FT                   FGQHVVEGIKKLLGVRA"
FT   gene            complement(147091..147651)
FT                   /locus_tag="PYCH_01680"
FT   CDS             complement(147091..147651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01680"
FT                   /product="inosine-5'-monophosphate dehydrogenase related
FT                   protein I"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01680"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23877"
FT                   /db_xref="GOA:F8AFX3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017158"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFX3"
FT                   /protein_id="AEH23877.1"
FT                   /translation="MVIVPRPIDPRDIKRIRKELGITQEELARKAGVTQAYIAKLEAGK
FT                   VDPRLSTLNRILRALIECQKARVTARSIMSSPIIYVRPGDRVEKVVRLMKKHNISQVPV
FT                   IDNEKVIGAITEKNLVRRSLEDEDIYSRNVTEVMEEPFPLVSEEEDIEVIKYLLEKHPA
FT                   VIVQGKNGKPIGIITRSDIFRLG"
FT   gene            148005..148610
FT                   /locus_tag="PYCH_01690"
FT   CDS             148005..148610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01690"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01690"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23878"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIQ0"
FT                   /protein_id="AEH23878.1"
FT                   /translation="MIEFYASEALICPRRIYFRLKGYPERWPDIAKPRLEKGNRTHSVL
FT                   GEILRKRFGFELEKHIVLRSSRLGIEIHGKIDAFRDFPIEIKGKSSLPKVPPDYHLAQL
FT                   NVYLRWAETEYGYLYYVKLDNRPEKIVGSINFSNFPLVKGRNFKAFEVPYDDSLFRETV
FT                   RHFYSVKRYFEKDKLPGGWKGPHCRFCPYNYLCFPDGL"
FT   gene            complement(148607..149101)
FT                   /locus_tag="PYCH_01700"
FT   CDS             complement(148607..149101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01700"
FT                   /product="5'-cyclic-nucleotide phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01700"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23879"
FT                   /db_xref="GOA:F8AFX4"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFX4"
FT                   /protein_id="AEH23879.1"
FT                   /translation="MLVGVLSDTHYPKAYFPDVVLEVFEKQDVELIIHAGDITEPILLE
FT                   KLNEVAPVLAVRGNADPPGLREVEVVDIGGMKTLVIHGHQFLSLTAQNLVYKAFEEEAT
FT                   LVIFGHTHRPYFEAVEAMRRKVYLLNPGSPTLPRLSPPSFALMEVEKERVKVRFYNPWD
FT                   V"
FT   gene            complement(149146..149424)
FT                   /locus_tag="PYCH_01710"
FT   CDS             complement(149146..149424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01710"
FT                   /product="H/ACA RNA-protein complex component Gar1"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01710"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23880"
FT                   /db_xref="GOA:F8AIQ1"
FT                   /db_xref="InterPro:IPR007504"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR020321"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIQ1"
FT                   /protein_id="AEH23880.1"
FT                   /translation="MKRLGKVSHYAKQGLLIVRTNWVPTLNEPVVDKNLKPVGIVKDVF
FT                   GPVKAPYVAVKPKVKDPERYVGEVLYIDDRRKRKHRGRKERERKKGR"
FT   gene            complement(149456..150067)
FT                   /locus_tag="PYCH_01720"
FT   CDS             complement(149456..150067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01720"
FT                   /product="ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01720"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23881"
FT                   /db_xref="GOA:F8AFX5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFX5"
FT                   /protein_id="AEH23881.1"
FT                   /translation="MKFNEELGRLLDVLGNETRRKILLLLTKRPYFVSELSQELGVGQK
FT                   AVLEHLRMLEEAGLVESRIEKIPRGRPRKYYMIKRGLRLEILLTPHLFGSEVYEPRDIT
FT                   KSPEYEQARELIKSQEPVQVKMRELAEFLSELDERIREIVKEKRELEEVRMLVESYIEN
FT                   VMRRMLDENRRMFEEILAEIEKILPPGYARRIKEKFMENI"
FT   gene            150139..150414
FT                   /locus_tag="PYCH_01730"
FT   CDS             150139..150414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01730"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23882"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFX6"
FT                   /protein_id="AEH23882.1"
FT                   /translation="MKAGELLNLIDEALANVRTAIVAFQMRILESPHTAHEFLQKSLEL
FT                   QEEVERLEKLRKEFEALNPDKELRGEDIDALVRYLEALRNFRGHEF"
FT   gene            complement(150395..151060)
FT                   /locus_tag="PYCH_01740"
FT   CDS             complement(150395..151060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01740"
FT                   /product="phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01740"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23883"
FT                   /db_xref="GOA:F8AFX7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFX7"
FT                   /protein_id="AEH23883.1"
FT                   /translation="MLRGIIFDVDETLVYYEGYSLRKWYESIALPAMKELEIVVDWETF
FT                   RKMAKGELPRSYVEKFGIDHVEFWKALDRANREYRERLLREGKIKTFPDVGVLKDLKAM
FT                   EIKLAAVSNASQDNTELVLEAFGLKDYFDVILGKDYAYLDGVKPNPYLVKKALRLMNIG
FT                   PEEALVVGDSELDVKAGHAAGVRVVQVIREKKVEGADYYVRNLWELLELVKDLKTRDP"
FT   gene            151134..152087
FT                   /locus_tag="PYCH_01750"
FT   CDS             151134..152087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01750"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01750"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23884"
FT                   /db_xref="GOA:F8AFX8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFX8"
FT                   /protein_id="AEH23884.1"
FT                   /translation="MLRNKFIIVTGGAGFIGSHIAEVLAEDNEVVVIDNLYTGRKENIP
FT                   ANVKFVEADVRDYSIAEMIRHADYIFHEAAIVSVQESIENPLLTEEVNVLGTLNILRAL
FT                   SEGHGKLIFASSAAIYGDSSNLPLREDEPPRPLSPYGVSKVAGEHYCMVFHRLYGVPTV
FT                   VLRYFNVFGPRQGGNQYAGVIRIFMERALKGEPLVIFGDGRQTRDFIYVKDVVRANIIV
FT                   AEKRRAEGETFNVATGRETTILELALKVIELTGSSSPVLFDAPRPGDIRRSVANVEKIS
FT                   RLGFKPRYTLEDGLRETLEWFQKTFNIVNQSGGESL"
FT   gene            152101..152799
FT                   /locus_tag="PYCH_01760"
FT   CDS             152101..152799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01760"
FT                   /product="AcdB acetate--coA ligase (ADP-forming) , beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01760"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23885"
FT                   /db_xref="GOA:F8AFX9"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFX9"
FT                   /protein_id="AEH23885.1"
FT                   /translation="MSRIEKARAIIEKAKAENRPLVEPEAKEILKLYGVPVPDFKVATN
FT                   EDEAVKFAREIGYPVVMKIVSPQIIHKSDAGGVKINIKNDEEARQAFREIMENAKRYKP
FT                   DADLWGVIVYKMLPLGKEVIVGMIRDPQFGPAIMFGLGGIFVEILKDVSFRVAPITREE
FT                   ALDMIKEIRAYPILAGARGEKPVDIEALADIIVKVGELALELPEIKELDINPIFAYEDG
FT                   AVAVDARMLL"
FT   gene            152902..153243
FT                   /locus_tag="PYCH_01770"
FT   CDS             152902..153243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01770"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23886"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFY0"
FT                   /protein_id="AEH23886.1"
FT                   /translation="MEDEESNSFWLMRLFKKKPEAEVLEQEITDDAYEELKSLLMRAKP
FT                   EVRGEDIVLRLPKAEVILSRGKLRVKASNRKEAEKVLRNLHHYSQPPGLWPAYGLSYSI
FT                   KKEIRTKAS"
FT   gene            complement(153240..153380)
FT                   /locus_tag="PYCH_01780"
FT   CDS             complement(153240..153380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01780"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23887"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFY1"
FT                   /protein_id="AEH23887.1"
FT                   /translation="MELLKRLGPSEAKDKLVEEYSTGITFGTLTLQRLEKIARKKGLQG
FT                   F"
FT   gene            complement(153352..153507)
FT                   /locus_tag="PYCH_01790"
FT   CDS             complement(153352..153507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01790"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23888"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFY2"
FT                   /protein_id="AEH23888.1"
FT                   /translation="MPLENERSVSLANERPLYWKPTDLENLEVFGGLYGIKNARKRVGT
FT                   PEKAWP"
FT   gene            complement(153936..155084)
FT                   /locus_tag="PYCH_01800"
FT   CDS             complement(153936..155084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01800"
FT                   /product="Permease, major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01800"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23889"
FT                   /db_xref="GOA:F8AFY3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFY3"
FT                   /protein_id="AEH23889.1"
FT                   /translation="MLYHTIIAPQLIVWILFPLYLMKTGYSILEVGAFFTAVNIVSIPL
FT                   TYLFGRAFNRWDIKKGLIAIDFLDGVAYVLYGFAKGTVAPLMLFAGRIVEKLSTVLYPL
FT                   YRAYEQIIYPEDKYEEIFAWHLRLPEIARLITFPILGYLFGYVWSSAEHYRLAFLFFGL
FT                   LSIPTIAYIWFFLPSVGREERITSESFTFRVGEFKLLLAFEALLTLAWSLAPELVLINY
FT                   VVFVLKKTVFEVTLIACASSVASVIGTYASERVPKEKGFHVIGLGMLINAFYALVMALA
FT                   PPFWLALAVYALGDFGNTFWFPFYRSWMFSLIPKERASEFHAAISSYNRLIGLFTPFVA
FT                   GALASVHATLPYAVSFGLFLLAGGLFVKGQAFRKAKVKNSSQ"
FT   gene            complement(155163..155570)
FT                   /locus_tag="PYCH_01810"
FT   CDS             complement(155163..155570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01810"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01810"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23890"
FT                   /db_xref="GOA:F8AFY4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFY4"
FT                   /protein_id="AEH23890.1"
FT                   /translation="MSEWFNEAGLRAIEEDLKSEITFIALDKEVLGFITVKSLNEKVLE
FT                   ILWMAVRREHRGKGIGSKLLNFVEEWAKEHRFEVLLVKTSGDLSYKPYDETRKFYEKNG
FT                   FVSVALIDPYPEWGEPALIYVKCLKGKEKEH"
FT   gene            complement(155874..156062)
FT                   /locus_tag="PYCH_01820"
FT   CDS             complement(155874..156062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01820"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23891"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFY5"
FT                   /protein_id="AEH23891.1"
FT                   /translation="MLNGGNQNQKRITELSKRLGKEFNVSLEEFYTYPTAEAYEDDKYP
FT                   DAEGYLSDEYLPKDVER"
FT   gene            156097..156805
FT                   /pseudo
FT                   /locus_tag="PYCH_01830"
FT                   /note="N-acetyltransferase / fragment"
FT   gene            complement(156888..157013)
FT                   /locus_tag="PYCH_01860"
FT   CDS             complement(156888..157013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01860"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23892"
FT                   /db_xref="UniProtKB/TrEMBL:F8AFY6"
FT                   /protein_id="AEH23892.1"
FT                   /translation="MSRIWSQHRGAKNPHTVEFLEEPFKIARWSRERFIKEKKSF"
FT   gene            complement(157059..157386)
FT                   /pseudo
FT                   /locus_tag="PYCH_01870"
FT                   /note="N-acetyltransferase / fragment"
FT   gene            complement(157536..158177)
FT                   /locus_tag="PYCH_01890"
FT   CDS             complement(157536..158177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01890"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23893"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG57"
FT                   /protein_id="AEH23893.1"
FT                   /translation="MVKRSIIAVSIFLLLFFGAFVFSQAMKTVEVYVTVYYPGELEADG
FT                   YYVKDDQITLTFHVLKGSEDLKGHFEKFKIRCFLCNLDLENATVVVDIDGTPLYPTCRD
FT                   YIMSFDKGGNIKGMHYVVSPYNLTEIAKIRILEGYVFRELKFENNTLTIFLSPGNGEEV
FT                   EIIRSNIIAEHQKGLKRGWVKVVYTDGSRKWEGRVYSMGEGECPVLIEAE"
FT   gene            158619..159023
FT                   /locus_tag="PYCH_01900"
FT   CDS             158619..159023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01900"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23894"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG58"
FT                   /protein_id="AEH23894.1"
FT                   /translation="MNGLFEVSNTALFCLEDMNALGIMLENNVSNDVFRERLSRYTYCS
FT                   VTLEKASFSLYLLNEDERYWRLHVAASNLEVYFHTAMNSQNPQEKISDNVELINKISRE
FT                   INAILQNGGVKELSDAQAEKLFNLTQSLSD"
FT   gene            complement(159156..159305)
FT                   /pseudo
FT                   /locus_tag="PYCH_01910"
FT                   /note="conserved hypothetical protein / fragment"
FT   gene            complement(159431..159967)
FT                   /pseudo
FT                   /locus_tag="PYCH_01920"
FT                   /note="conserved hypothetical protein / fragment"
FT   gene            160128..160568
FT                   /locus_tag="PYCH_01930"
FT   CDS             160128..160568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01930"
FT                   /product="Transcription regulator, putative, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01930"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23895"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG59"
FT                   /protein_id="AEH23895.1"
FT                   /translation="MPDDDLAREVQELKKALAELRKSFNLVSQLAQAYLKLLNIYAQHG
FT                   ELGIDVAVPEVRGDPIAREIVRILFDLKRANVSQIARELKGRRGKASRNTVRAKLTELK
FT                   ELGIVVEVPGERGKTYTLSREVVRKWLEMIGMPIRLDQLNDY"
FT   gene            160579..161088
FT                   /locus_tag="PYCH_01940"
FT   CDS             160579..161088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01940"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23896"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG60"
FT                   /protein_id="AEH23896.1"
FT                   /translation="MVDVETGKKTPEQLERLLDELVEGIKNAKTPEEVELLEKKAKIVE
FT                   DLIKAYEGDKDLEQVGKLVEKLGDVMENLIGPLKDLLAELYSPDRIEAMGRSVAEFYKT
FT                   LVEAGMDKEEATKLTKEYMDSINIVKKLMESLGSVMGHGKEQGNWWMKMVGQTPKKPGN
FT                   DGEEGA"
FT   gene            161085..161297
FT                   /locus_tag="PYCH_01950"
FT   CDS             161085..161297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01950"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23897"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG61"
FT                   /protein_id="AEH23897.1"
FT                   /translation="MRLPLRFFLRLPLLLFKLAGLVGVINRGKRRFRKVLIESGLPKDV
FT                   VEGLVEKFDPTRPLKKAFRKFIYWP"
FT   gene            complement(161281..161676)
FT                   /locus_tag="PYCH_01960"
FT   CDS             complement(161281..161676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01960"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23898"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG62"
FT                   /protein_id="AEH23898.1"
FT                   /translation="MRKVSKVIVALAVLTLMCVIVGVNGEKIINAIGFQYLDERELYNA
FT                   GEFKVDILPANVHVDGYVEGRLFSVYVLDKHNLEHFKKGESFTAVYSWENINYVKLNFN
FT                   TTENLYIVVKNELNEREWIHFKVKASR"
FT   gene            161763..162224
FT                   /locus_tag="PYCH_01970"
FT   CDS             161763..162224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01970"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23899"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG63"
FT                   /protein_id="AEH23899.1"
FT                   /translation="MPFTPFHLGPALLFATTLDFPTFLIANVIVDFEPFLVMTYDLDLR
FT                   YGYPLHGFFHTFLGGALVALILAEGMVVLYSQFGKEVNIKKLRITALSGIWLHIVLDSF
FT                   LYMDIKPFFPLSWNPFYGLFSGIEVYGFCVVAFVIGALLHIVTKRKWES"
FT   gene            complement(162234..162428)
FT                   /locus_tag="PYCH_01980"
FT   CDS             complement(162234..162428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01980"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23900"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG64"
FT                   /protein_id="AEH23900.1"
FT                   /translation="MLVPYLHFLRSNVALHQRLSNAFYELVRRSRDIEGIDSKKFMELA
FT                   EEVIGKDLTEFFKKKIYGT"
FT   gene            complement(162572..162685)
FT                   /locus_tag="PYCH_01990"
FT   CDS             complement(162572..162685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_01990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_01990"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23901"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG65"
FT                   /protein_id="AEH23901.1"
FT                   /translation="MEQGIQNEVATLEVGALIGNVGIKDLEEWLGTPSRTL"
FT   gene            162891..163673
FT                   /locus_tag="PYCH_02000"
FT   CDS             162891..163673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02000"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23902"
FT                   /db_xref="InterPro:IPR008553"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG66"
FT                   /protein_id="AEH23902.1"
FT                   /translation="MAKPIVPLYEVAYDITMLAVIGYVWLFFLRRWNRYMAELRSFARR
FT                   AAIFLGFGFIGRVIDLVDNFIEVPYGEIATAILYGVSIAGVIYTTVHYLKFLEVKYVLV
FT                   SPSPKIANNNSEEKKLVGAYIISGSRVKIVEVINMIKELKVPILVFTRSPEFYKGLDEN
FT                   VKIVWISQATDVGIPPTKLHVIQDYAIRFARESNHAIVVIDCLEYLLIYNEFSSVFKFL
FT                   VNLKDHLRMLNSALILAVDEKALDKRQYHLLINEFEPL"
FT   gene            163751..164203
FT                   /locus_tag="PYCH_02010"
FT   CDS             163751..164203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02010"
FT                   /product="Dual specificity phosphatase, catalytic domain,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02010"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23903"
FT                   /db_xref="GOA:F8AG67"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG67"
FT                   /protein_id="AEH23903.1"
FT                   /translation="MKFVTERVAFSPMPTLEELGELLKEFRAFVVLVEDFELEYDIEAL
FT                   EEVVDVLYSLIPDFPAPSLEQLLEIVQWIEARVREGKKVLIHCLSGSGRSGTVAVAYLM
FT                   YSQGLSLHDALSKVRSLKPSAIETEDQMDVLRAFEVLLAWDRKVFK"
FT   gene            164226..164347
FT                   /locus_tag="PYCH_r10"
FT   rRNA            164226..164347
FT                   /locus_tag="PYCH_r10"
FT                   /product="5S ribosomal RNA"
FT   gene            164357..164434
FT                   /locus_tag="PYCH_t105"
FT   tRNA            164357..164434
FT                   /locus_tag="PYCH_t105"
FT                   /product="tRNA-Asp"
FT   gene            164455..165054
FT                   /locus_tag="PYCH_02020"
FT   CDS             164455..165054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02020"
FT                   /product="methylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02020"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23904"
FT                   /db_xref="GOA:F8AG68"
FT                   /db_xref="InterPro:IPR004557"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG68"
FT                   /protein_id="AEH23904.1"
FT                   /translation="MAIHYAGLRIELHPDVYEPAEDTFLLAENLDVREGEIVLDMGTGA
FT                   GIIALLAARRARFVVGVDINPMAIELAWKNARLNGIKNAIFIRSDLFENVRGTFDLITF
FT                   NPPYLPGEKVEEPIDLALVGGPRGDEVLRRFVARVDEYLSASGRVLVVVSSLTGEGIEG
FT                   TTKLFEEHGFETEVIAKKRIFFEELAIIRATRAERV"
FT   gene            complement(165032..165166)
FT                   /locus_tag="PYCH_02030"
FT   CDS             complement(165032..165166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02030"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23905"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG69"
FT                   /protein_id="AEH23905.1"
FT                   /translation="MRHIKPEPMLAKWRDFKIELSEEEREEQKPRVRLITTVKRVQLS"
FT   gene            complement(165221..165631)
FT                   /locus_tag="PYCH_02040"
FT   CDS             complement(165221..165631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02040"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23906"
FT                   /db_xref="GOA:F8AG70"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG70"
FT                   /protein_id="AEH23906.1"
FT                   /translation="MRRPWLVVPDTNFLLVPGQFGVDIIGELERILDVRYEMVIPNVVL
FT                   EELRVIAGKVRGRDLIAVRMALAIAERFRVIEIGRFGERPTDELIYEFAVNNDRVIVGT
FT                   NDKMLRKKLREAGVPVVFLRQKKRLELEGMLE"
FT   gene            complement(165661..166896)
FT                   /locus_tag="PYCH_02050"
FT   CDS             complement(165661..166896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02050"
FT                   /product="ranslation initiation factor IF-2 subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02050"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23907"
FT                   /db_xref="GOA:F8AG71"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="InterPro:IPR022424"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG71"
FT                   /protein_id="AEH23907.1"
FT                   /translation="MAEERKTKQAEVNIGMVGHVDHGKTTLTKALTGVWTDTHSEELRR
FT                   GITIKIGFADAEIRECPNCGRYSTSPVCPYCGHETEFVRRVSFIDAPGHEALMTTMLAG
FT                   ASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDREKALENYRQI
FT                   KEFIKGTVAENAPIIPISALHGANVDVLVKAIEDFIPTPKRDPNKPPKMLVLRSFDVNK
FT                   PGTPPERLVGGVLGGSIVQGKLKVGDEIEIRPGVPYEEHGRIRYEPITTEIVSLQAGGR
FT                   FVDEAYPGGLVGVGTKLDPYLTKGDLMAGNVVGKPGKLPPVWEDLRLEVHLLERVVGTE
FT                   QELKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIELKLQIPVCAEPGDRVAISRQIGS
FT                   RWRLIGYGFIKE"
FT   gene            complement(167023..168003)
FT                   /locus_tag="PYCH_02060"
FT   CDS             complement(167023..168003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02060"
FT                   /product="tRNA-modifying enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02060"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23908"
FT                   /db_xref="GOA:F8AG72"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR023993"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG72"
FT                   /protein_id="AEH23908.1"
FT                   /translation="MAIVVRSNPNMPEEIAGLFRKQHYIIVGHHSGVKLCHWLKESLTK
FT                   GRFCYKQKFYGIHSHRCLQMTPVTAWCTHNCIFCWRPMEGFLGTELPEPWDDPAFIVEE
FT                   SIKAQRKLLVGYKGNPKVTKETFEEAWHPKHAAISLSGEPMLYPYMGDLVEEFHKRGFT
FT                   TFIVTNGTVPERLEEMIKEDKLPTQLYVSVTAPDIETYNRVNIPMIPDGWDRILRTLEL
FT                   MRDLPTRTVIRLTLVKGENMHNPEGYAKLIMKAKPMFVEAKAYMFVGFSRNRLTINNMP
FT                   SHDDIKAFAEALVRHLPGYHIEDEYAPSRVVLIMRDDVEERFIKH"
FT   gene            168340..168477
FT                   /locus_tag="PYCH_02070"
FT   CDS             168340..168477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02070"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23909"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG73"
FT                   /protein_id="AEH23909.1"
FT                   /translation="MSKKVAIGLLMSLLFLAVLFAVPAVAEKPETIRTIMAMEPTLLEP
FT                   "
FT   gene            168495..169190
FT                   /locus_tag="PYCH_02080"
FT   CDS             168495..169190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02080"
FT                   /product="serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02080"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23910"
FT                   /db_xref="GOA:F8AG74"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG74"
FT                   /protein_id="AEH23910.1"
FT                   /translation="MGVVGVAPKVEIYAIKVLDRTGSGTYTDIAIGIEQALLGPDGVLD
FT                   ADGDGIIVGDPDDDAAEVISMSLGGPTDDQYLHDIIIQAYNYGVVIVAASGNDGADQPS
FT                   YPAAYPEVIAVGATDSTDAIASFSNLQPEVTAPGVDILSTYPDDTYETLSGTSMATPHV
FT                   SGVVALIQAAYYNKYGKVLPVGTFDDMSTNTVRGILHVTADDLGDPGWDIYYGYGIVRA
FT                   DLAVQAALG"
FT   gene            169302..169442
FT                   /pseudo
FT                   /locus_tag="PYCH_02090"
FT                   /note="intracellular protease / fragment"
FT   gene            complement(169471..169611)
FT                   /pseudo
FT                   /locus_tag="PYCH_02100"
FT                   /note="intracellular protease / fragment"
FT   gene            169805..170071
FT                   /pseudo
FT                   /locus_tag="PYCH_02110"
FT                   /note="intracellular protease / fragment"
FT   gene            170138..170827
FT                   /locus_tag="PYCH_02120"
FT   CDS             170138..170827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02120"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23911"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG75"
FT                   /protein_id="AEH23911.1"
FT                   /translation="MVKKGSLFGLALVILLTMVVFSAIALALFVKDFYPKKTAGPLADV
FT                   GSFNATSLIVRDIVGNVRVVEGNISHILVKSNLPVNATLSGATLRIYCPVRGGKNVCSE
FT                   YRNGTIVIVVGGPLETVKIEDVVGDAVVSADVKNIWVEDLVGEFWGDVWTSYTIKNVVG
FT                   NLVVHAGGDAIVEDVVGNVVVELPAGVGVSLSIEHVLGKVLNSVGEGNATVSVYLSNIV
FT                   GEISIER"
FT   gene            170833..171738
FT                   /locus_tag="PYCH_02130"
FT   CDS             170833..171738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02130"
FT                   /product="ATP:dephospho-CoA triphosphoribosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02130"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23912"
FT                   /db_xref="GOA:F8AG76"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG76"
FT                   /protein_id="AEH23912.1"
FT                   /translation="MDPWEVVKAFVIGPLLEATVPKPGNVSRRRDFNDLTLYHFIFASP
FT                   AWADVLREAVLRGKEIAEGRRPLEEANIGRFIRTAVEKSKAYQDANPNFGVITLSVPLV
FT                   VALPSGGVEGAGKIARTLIEASTPEDSIELYRAIRIANPKGIPKGVKYDVYSDESFEEL
FT                   RRDGVNLLRLAEMSCERELIFCEWLNCYSLVYKTFGRLEELVGEKPLEEAVLWAFLELL
FT                   AEREDTLILRKAGPEEARLVRERACAVLLGEMTLEDFERFMEERGDLRNPGSLADIMAV
FT                   TLSLLLLKGYRLRGRWLVIG"
FT   gene            171784..171927
FT                   /locus_tag="PYCH_02140"
FT   CDS             171784..171927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02140"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23913"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG77"
FT                   /protein_id="AEH23913.1"
FT                   /translation="MGGERAHRPPRVVRGSNLGGAFYPIYLLPYTSLLIQPTPDGHMGA
FT                   GG"
FT   gene            171938..172243
FT                   /locus_tag="PYCH_02150"
FT   CDS             171938..172243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02150"
FT                   /product="Archaeal histone A2"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02150"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23914"
FT                   /db_xref="GOA:F8AG78"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG78"
FT                   /protein_id="AEH23914.1"
FT                   /translation="MGAYRGVERPQNPKGLYISFALKENDKTFAGVVEMAELPIAPVDR
FT                   LIRKAGAQRVSEEAAKVLAEHLEEKALEIAKKAVELAKHAGRKTVKAEDIKLAIKA"
FT   gene            172298..173632
FT                   /locus_tag="PYCH_02160"
FT   CDS             172298..173632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02160"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23915"
FT                   /db_xref="GOA:F8AG79"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023970"
FT                   /db_xref="InterPro:IPR023980"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG79"
FT                   /protein_id="AEH23915.1"
FT                   /translation="MPEVALRLTRRNHNAFVHLLAALETQGYALGDILVSKSLEEIIRA
FT                   KPKIVLYSFYSQEVWDVEREVKLLKERTGAILVVGGYHATAMPRHTLRMGFDIAVIGEG
FT                   EEVLYELLTTLGRTGYKVTKDLLNVKGLAFYLGGEFTFTGFAKVMDFSKFPPYPEALRL
FT                   ISPMEISRGCPFACYYCQTPYMKGFRMRHRPIDQIVRYSRRMKDMRYITPNAFAYGSPG
FT                   AILRLDKLEALLKALQPLRKEGRRLFYGTFPSEVRPEFVLPETLELLVQYTDTTRLAIG
FT                   AQSGDDAMLKAMHRLHKVEHVVRAVELALEYGLEPVVDFIVGLPNETEESQRKSIELMK
FT                   WIMRKGGKVRAHYFMPLPGTPWARCKPSPLSDEMKKFLGKMAAEGKIEGSWGMQIEISR
FT                   RLQRLIEEFYEEPFSYHGKVLDICSDQKFITQAEVGTTVNAPRKL"
FT   gene            173613..174008
FT                   /locus_tag="PYCH_02170"
FT   CDS             173613..174008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02170"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23916"
FT                   /db_xref="GOA:F8AG80"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR022972"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG80"
FT                   /protein_id="AEH23916.1"
FT                   /translation="MHPENYKRLEKLIEKLREFEGLIIVEGRRDEEALRRLGVRTEILR
FT                   LSRSPLAEVALVASEYEEVMILTDLDEAGEHLARRLCQLLEGLTKVDLETRRELKFIAR
FT                   KDIKGIEDLPSLWEGLGLRFWPPPEGI"
FT   gene            174008..175384
FT                   /locus_tag="PYCH_02180"
FT   CDS             174008..175384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02180"
FT                   /product="DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02180"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23917"
FT                   /db_xref="GOA:F8AG81"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR020607"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG81"
FT                   /protein_id="AEH23917.1"
FT                   /translation="MKRKKALLHQILTEKQRREKLKEGGNMAGKDDFGTTKYVIHAEFE
FT                   ANGVVERPDVVGAIFGQTEGLLGDDLDLRELQKTGRIGRIKVEVHTRAGKTYGTILVPS
FT                   SLDRVETAIIAAALETIDRVGPCEAKIKVIKIEDVRATKRKYIIERAKEILETLMEEEI
FT                   PETQELTEEVRKAVREKELIEYGPEKLPAGPHVPFSDSIIIVEGRADVLNLLRHGIKNA
FT                   IAVEGTSIPETIIKLSRERIVTAFTDGDRGGELILKELLQVADIDYVARAPEGKEVEEL
FT                   TKKEIIKALRSKVPAEQVINELFNKGKSFYDIVKEREKKVREEEKEKEEEKKREERLAP
FT                   ASISTAAEKVKANEKFVRPIKPPQQDYREFEEFIEKVKGDSVALLLDENKNVIAEVPIR
FT                   DLLTAIEEKEGIYAVVFNGIITQRLIDLVSEKGVKYLVGARKANVVRRPINLKIVTFTE
FT                   "
FT   gene            175462..176547
FT                   /locus_tag="PYCH_02190"
FT   CDS             175462..176547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02190"
FT                   /product="NDP-sugar synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02190"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23918"
FT                   /db_xref="GOA:F8AG82"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG82"
FT                   /protein_id="AEH23918.1"
FT                   /translation="MQAVLLAGGKGTRLLPLTVYRPKPMIPFFNRPLMEYILEALVNIG
FT                   VDEVFVLVGYLKEKIMEHFGDGEEFGVEIHYSNGDNLKLGTAGAIKKIEGKIEDSFLVA
FT                   STDILTNINFKDLYEFHKKKDGVATMALTRVEDPSHYGVAILDTDLRIRSFKEKPRPEE
FT                   ALSNLVNTGIYVLEPEVFDLIPEGKNFDFSLHLFPKILEEGLPLYGYPFDEYWNDVGRP
FT                   STYLQATEDAFAGKLKLPQISVGPLKGNVERGGSLYTGRKCVLRKTRIIGFAVLGDNVK
FT                   IGKNVKIERSVIFSNVVIEEGAEIREAIIGENVYIGKGVVVEPGSVIGDNAIIEDFSRI
FT                   GANVKIWADSRIGRESVILPD"
FT   gene            176562..177266
FT                   /locus_tag="PYCH_02200"
FT   CDS             176562..177266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02200"
FT                   /product="phospho-sugar mutase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02200"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23919"
FT                   /db_xref="GOA:F8AG83"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG83"
FT                   /protein_id="AEH23919.1"
FT                   /translation="MEIYHSDRFNPEELALLGRAIGTVSQGTIIVGRDGRAIARYGKRA
FT                   LVVGIVSTGSTIMDVRLIPLIALRDFARRKGLPFAYVYYYGGMRVEMSGLDVDEVRAIL
FT                   KTKSFVEAPPNDIGATVYYPNALEDILSELFKHYDFTIGGRALVDCMNTPAVLLFPRLG
FT                   EHFGFEAELINDMMTSYVPPKPKEVFLQKLAKGDYDFGLRFRPDGTVEIHRKGEEKEFK
FT                   SLWGLLEYLKNI"
FT   gene            177278..177895
FT                   /locus_tag="PYCH_02210"
FT   CDS             177278..177895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02210"
FT                   /product="thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02210"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23920"
FT                   /db_xref="GOA:F8AG84"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG84"
FT                   /protein_id="AEH23920.1"
FT                   /translation="MDGLFIVFEGIDGAGKSTQARLLAEWFREKGYDVVLTKEPTDSEL
FT                   GNFVKRLILIGGIINGGRISHEAEALLFAADRAEHVKKVIEPALREGKVVISDRYFYSS
FT                   LAYQWARGLDVEWLISVNSFAPRPHLVILLDLPAKESMRRVRLRGAESEFDKLLELQRK
FT                   VRENYLKLAERFPEFRIVNAMAPVEDIHRDVVALVEHELLRR"
FT   gene            177900..179231
FT                   /locus_tag="PYCH_02220"
FT   CDS             177900..179231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02220"
FT                   /product="signal recognition particle protein Srp54"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02220"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23921"
FT                   /db_xref="GOA:F8AG85"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG85"
FT                   /protein_id="AEH23921.1"
FT                   /translation="MALDALGRALSNALKKIARAGTVDETLVKEVVRDIQRALIQADVN
FT                   VRLVLKLTKEIQRRALEEKPPAGISRKEHIIKIVYEELSKLLGSEAKPIEIKEKPMILL
FT                   MVGIQGSGKTTTVAKLARHFQKRGYKVGVVCSDTWRPGAYHQLRQLLDPYHVEVFGNPE
FT                   EKDAVKLAREGVEYFRGKGVDIIIVDTAGRHKEEKGLIEEMRQISEAIRPHEVILVIDG
FT                   TIGQQAYSQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGVGEKIDDL
FT                   EPFDPKRFVSRLLGLGDIQGLLEKFEELEKEVEFSEKDVERFLKGKFTLKDMYAQLEAM
FT                   QKMGPLKQILRMIPGLGYSLPDEVISVGEERLKKFRVIMDSMTEEELENPGIINYSRMK
FT                   RIARGSGTSVKDVKELLEQYKQMKRFFKTMNKRQLARLARRFGI"
FT   gene            179228..179470
FT                   /locus_tag="PYCH_02230"
FT   CDS             179228..179470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02230"
FT                   /product="AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02230"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23922"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG86"
FT                   /protein_id="AEH23922.1"
FT                   /translation="MMEVFILLIVQPGKEDEVYEILKDRPEVKEIYKVYGDYDILIRVE
FT                   VPNIKALDEFHDGVLRGIPGIEMTETLIASSYGGR"
FT   gene            179467..179988
FT                   /locus_tag="PYCH_02240"
FT   CDS             179467..179988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02240"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23923"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG87"
FT                   /protein_id="AEH23923.1"
FT                   /translation="MMERELVAIIHLNPLNLEVVWKDFKFKCVENCAKCCRELDIPLRE
FT                   GDIERIKALGYEEDYFVDFTKMFYRGSRFLGYSLKKRPFDGTCVFLDENGKCKIYEHRP
FT                   IACKLYPFILVKHGNFLEVYVKKDPLCPGINHPEGRPIDWSFVREYFGEVLQAYEVGMP
FT                   EGIEVDRRVR"
FT   gene            179969..180412
FT                   /locus_tag="PYCH_02250"
FT   CDS             179969..180412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02250"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02250"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23924"
FT                   /db_xref="GOA:F8AG88"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG88"
FT                   /protein_id="AEH23924.1"
FT                   /translation="MIDELDRKIIRVLLRDARISYREIAKELDVAVGTIYNRVKRLEEE
FT                   GVIEGFYPKLNYEKVGYDLTVIIGIKAQGKRIRDIEREIARDEHVMCVYDVTGEYDIIV
FT                   IAKFRNRKDMNTFVKKILSIDGVEKTNTHVALEVVKEDFRLEP"
FT   gene            complement(180409..181122)
FT                   /locus_tag="PYCH_02260"
FT   CDS             complement(180409..181122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02260"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02260"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23925"
FT                   /db_xref="GOA:F8AG89"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG89"
FT                   /protein_id="AEH23925.1"
FT                   /translation="MNQLEALKEKLRVIRMLRVLKRSYTYEELSKITGLPITVLNRYVR
FT                   GKVLPSTERAKILAQQLAPYLNLAEEVRKRLQFDSFGFFDTMKVLSDTNLVALIAEDVA
FT                   LRYMGKGVTKVLTAATDGIPLAVQIADELGVDIVYAKKKKEVGVEKFYEVNYVPSASGS
FT                   VTTLYLPQWALKKGDRVLIVDDVIRSGETQRALLQMCKQANAIPVGMFFLISVSDVVDR
FT                   LREEYNVPVESLVRL"
FT   gene            181225..181302
FT                   /locus_tag="PYCH_t160"
FT   tRNA            181225..181302
FT                   /locus_tag="PYCH_t160"
FT                   /product="tRNA-Val"
FT   gene            181359..182642
FT                   /locus_tag="PYCH_02270"
FT   CDS             181359..182642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02270"
FT                   /product="serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02270"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23926"
FT                   /db_xref="GOA:F8AG90"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG90"
FT                   /protein_id="AEH23926.1"
FT                   /translation="MSYREYRDKVFHFLEEHEKWRSHTINLIASENVTSPSVNRAVASG
FT                   FMHKYAEGWPRQRYYQGCKYVDEVELIGVELFTKLFKSDYADLRPISGTNANQAVFFGL
FT                   AQPGDKVIVLHTSHGGHISHMPFGAAGMRGLEVHTWPFDNEAFNIDVDKAAQMIRELEP
FT                   KIVMFGGSLFPFPHPVKELASVAKEVGAYVVYDAAHVLGLIAGGQFQDPLREGADIITA
FT                   STHKTFPGPQGGVILYKQFGSSDEVAKLQWAIFPGVLSNHHLHHMAGKVITAAEMLEYG
FT                   EAYAKQIVKNAKALAEALAEEGFKVIGEDKGYTESHQVIVDVSDLHPAGGGWAAPLLEE
FT                   AGIILNKNLLPWDPLEKVNDPSGLRIGVQEMTRVGMKEDEMKEIARFIRRVLIDKEDPA
FT                   KVRKDVYYFRLDYQKVYYSFDYGLPMKE"
FT   gene            182718..183437
FT                   /locus_tag="PYCH_02280"
FT   CDS             182718..183437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02280"
FT                   /product="2-haloalkanoic acid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02280"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23927"
FT                   /db_xref="GOA:F8AG91"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR011950"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG91"
FT                   /protein_id="AEH23927.1"
FT                   /translation="MIKVVFFDLDDTLVDTSRLAEMARRNAIENMIVHGLPVDFDTAYS
FT                   ELMELIREYGSNFPHHFDYLLRRLDLPYNPKWVAAGVIAYHNTKFAYLREVPGARKTLL
FT                   RLREAGYRLGIITDGNPIKQWEKILRLDLGDFFEHVIISDFAGVRKPHPKIFRKALKAF
FT                   GVKPEEAVMVGDRLYSDIYGAKRVGMMTVWFRYGKYANAELEYREYADHEIKRLEELIG
FT                   VLEREEGSNKEVHPAGR"
FT   gene            183394..183969
FT                   /locus_tag="PYCH_02290"
FT   CDS             183394..183969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02290"
FT                   /product="hydrothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02290"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23928"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG92"
FT                   /protein_id="AEH23928.1"
FT                   /translation="MKKVQIRKFILLDARYKEKILRGKKVTTIRYGAYEARPGSEIYIV
FT                   ITPSDTAIAKARIKAVRSKKVLELTNEDAKLDGFSDVKELVRELSKIYGELYGDDEVTI
FT                   IEFEDVRPLKEGVPLKWLKGLNYKDPYEVVELSLENWEKLGLGRDAEIILRRISEVGLR
FT                   EAVKHFGPKRVQQALLKAYHALYGAGLI"
FT   gene            184052..184654
FT                   /locus_tag="PYCH_02300"
FT   CDS             184052..184654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02300"
FT                   /product="membrane-associated phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02300"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23929"
FT                   /db_xref="GOA:F8AG93"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG93"
FT                   /protein_id="AEH23929.1"
FT                   /translation="MAIFIAEWFGAFKGINDIIYAHTPLVSSSWVVMITDSASLAAFVV
FT                   YLILFLAWDFKRCGKLSRLILNFAISLALGMAVVVVLKALTEVPRPNEFPLSLPFIQAL
FT                   LNADYFAFPSGHTARAAILAYFLSRRFPKYAPIWWIYAVLIALSRLLLHVHWFSDVLFS
FT                   LLLGPWTFMLVELTESFWLPIYSSIIRKLGLEVFAVE"
FT   gene            184647..185108
FT                   /locus_tag="PYCH_02310"
FT   CDS             184647..185108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02310"
FT                   /product="Putative small multi-drug export protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02310"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23930"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG94"
FT                   /protein_id="AEH23930.1"
FT                   /translation="MNSFVEVFVLSLIPTFEGRYAILYGIGKGYPLWETLMAAAFGVLL
FT                   LSLVLPALLPYIDRLMLRLEKTSLERIARLYLSYIERVRKKARPYVERWGFLGLTIFVA
FT                   IPLPGTGVWTGALASYLLGIERKVAVPALILGGLLSMAITMGPALGIIR"
FT   gene            complement(185111..186121)
FT                   /locus_tag="PYCH_02320"
FT   CDS             complement(185111..186121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02320"
FT                   /product="iron III ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02320"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23931"
FT                   /db_xref="GOA:F8AG95"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG95"
FT                   /protein_id="AEH23931.1"
FT                   /translation="MRKGLLVGLLMAIVILSGCIGSNTTTAPAQMQTVTSRETITVTQT
FT                   VTETYTPTNYPITITDSLGRKVKIEKEPQRIVSLAPSITEMLYFIGALDKVVGVTQFDD
FT                   FPPGVQEGRTVIGGFSDPNIEVIASLSPDLIIGTSMHIQYLEQLEKIAPVIIIEPKNID
FT                   EIYEWTITLGKVVNREDEAKGVVNYMKAIVESVETKVNGTERPRVLFISWWNPIYVPGG
FT                   DTFQGALIEMAGGRNIFHDVSGWKQVSVEEIIARDPEVIILSAHAGVTPEDLCNSPLAQ
FT                   TTAVREGRIYVVSDDNLVSRPGPRIVLGLEELARFIHPEAFGYAHGTKACAAASS"
FT   gene            complement(186209..186757)
FT                   /locus_tag="PYCH_02330"
FT   CDS             complement(186209..186757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02330"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase subunit
FT                   gamma"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02330"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23932"
FT                   /db_xref="GOA:F8AG96"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG96"
FT                   /protein_id="AEH23932.1"
FT                   /translation="MRKEILIGGFGGQGVILASVILGKAATVYEGLYAVQTQAYGPESR
FT                   GGASRAEVVISDEPIDYPKVIAPDYAILLSQQAYDKYLSLVKDDGLVIVESDLVPRRDA
FT                   GMEKSKKIYALPLTEIAEKTTGLSLTMNILTLGFFVGLTGIVSEESIEKAVKDAVPKGT
FT                   EEINLRALRKGFELAKRTL"
FT   gene            complement(186754..187599)
FT                   /locus_tag="PYCH_02340"
FT   CDS             complement(186754..187599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02340"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase subunit
FT                   beta"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02340"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23933"
FT                   /db_xref="GOA:F8AG97"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG97"
FT                   /protein_id="AEH23933.1"
FT                   /translation="MRLVSAYEIRDRYLRKDMLPTIFCPGCGIGTVLQFTLRAIDELGL
FT                   NPDEIVWVSGIGCSSRVPGFVNFDGLHTTHGRALAFATGIKLANPKLKIIAFMGDGDAA
FT                   AIGGNHFIHAIRRNLDITVILINNFTYGMTGGQVAPTTPKGLRGTTAPYGQFENPFDIA
FT                   ELAVAAGANYVARWTVFNYVQGINSIKKALQKEGFSLVEFLSPCPVSFGRRNRMKTSPE
FT                   LIRWYQKITVPISKAKNMSPEELEGKIVIGEFVDRDRPGLVREYEEYKKRAKRIMGWEK
FT                   "
FT   gene            complement(187596..188753)
FT                   /locus_tag="PYCH_02350"
FT   CDS             complement(187596..188753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02350"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase subunit
FT                   alpha"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02350"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23934"
FT                   /db_xref="GOA:F8AG98"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG98"
FT                   /protein_id="AEH23934.1"
FT                   /translation="MRYPFPIGQADFIQGDEAIARAAILAGCRFYAGYPITPASEIFEA
FT                   MALYMPLVDGVVIQMEDEIASIAAIIGASWAGVKAMTATSGPGFSLMQENIGYAVMTET
FT                   PIVIVDVQRSGPSTGQPTLPAQGDVMQAIWGTHGDHSLIVLSPATVQEAFDFTIRAFNL
FT                   SEKYRTPVILLTDAEVGHMRERVYIPRPDEIELVERKLPANEEEAKLPFGDPHGDGVPP
FT                   MPIFGKGYRTYVTGLTHDERGRPRTVEPEIHERLIRRIVEKIEKNKEDIIDYQTFELED
FT                   AEIAIVAHGIVARSAIRAVKMLRAEGIKAGLLKLNVLWPFDFELIERIAERVKRIYVPE
FT                   MNLGQLYHLVREGANGKADVKLISKIGGEVHAPIDIIRPIRGDLM"
FT   gene            complement(188800..189315)
FT                   /locus_tag="PYCH_02360"
FT   CDS             complement(188800..189315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02360"
FT                   /product="2-oxoglutarate synthase subunit KorC"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02360"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23935"
FT                   /db_xref="GOA:F8AG99"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:F8AG99"
FT                   /protein_id="AEH23935.1"
FT                   /translation="MQIRFAGIGGQGVVLAGVILGEAAAIEGLNVIQTQDYSSASRGGH
FT                   SIADVIVSKGPIYDLMVTKADVLVALHQLGYDTVKDSLKEDGLLIIDTDLVKPDRDYVG
FT                   APFTRLAEETTGLALTVNMVALGYLVAKTGVVNKESVEEAIRRRVPKGTEEVNLKAFNI
FT                   GYEEGLKG"
FT   gene            complement(189321..190172)
FT                   /locus_tag="PYCH_02370"
FT   CDS             complement(189321..190172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02370"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase subunit
FT                   beta"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02370"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23936"
FT                   /db_xref="GOA:F8AGA0"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGA0"
FT                   /protein_id="AEH23936.1"
FT                   /translation="MVKQIYSKYPMVKYLRKEALPTALCPGCGGGTVLNAFANAIDQLK
FT                   IDPRDLVVVSGIGCSAWIASPYFLADTLHTTHGRAIAFATGVKVGLPDKKVVVISGDGD
FT                   LASIGGNHLIHAARRNIDITVILVNNFIYGMTGGQVAPTTPFGAKTTTTPYRNVEHPLN
FT                   IAEMVAAGASYVARWTTAHVYQLIESIKKALTVKGFSLVEVISQCPVQYGRRNRMKEPA
FT                   EMLRWFLKNAIPISKAKNMSPEELEGKFIIGEFVNRERPEFVDELNKLIDEVQESFGLK
FT                   GE"
FT   gene            complement(190172..191362)
FT                   /locus_tag="PYCH_02380"
FT   CDS             complement(190172..191362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02380"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase subunit
FT                   alpha"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02380"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23937"
FT                   /db_xref="GOA:F8AGA1"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGA1"
FT                   /protein_id="AEH23937.1"
FT                   /translation="MIIRGDEPDQIRLLRKLYKPGNYFMMGDEAVAYGAIFAGCRFYAG
FT                   YPITPSSEIAETMARELPKLGGYYVQMEDEIASIAAIIGASWTGLKAMTATSGPGFSLM
FT                   QENLGYAIMTETPIVIVDVQRSGPSTGQATKGAQGDFFQARWGTHGDHPIVAVSPVSVE
FT                   DAFWETIRAFNIAEMLRIPVIVLFDGILGHMREQIRIPAPDDIEIAYRKLPRNEEEAKL
FT                   PFGDPHGDGVPPMPLFGHGYFTHVTGSTHKENGLRDVYTPEVHDRLVRRIHRKIEKNRD
FT                   VYEKYEEHFTDDAEILVVSWGVTARPSLGAVLKAREEGIKVGLFVPKTVHPFPGERMRQ
FT                   LGKQVRAIIVPEMNLGQMILEVQRFINDDVLLKGVNKIGGVPLTVEEILREIRGVA"
FT   gene            complement(191365..191634)
FT                   /locus_tag="PYCH_02390"
FT   CDS             complement(191365..191634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02390"
FT                   /product="2-keto acid:ferredoxin oxidoreductase subunit
FT                   delta"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02390"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23938"
FT                   /db_xref="GOA:F8AGA2"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGA2"
FT                   /protein_id="AEH23938.1"
FT                   /translation="MADKENVTVVSKEGYLVIGKTQAVEIDVDTFLCKGCGICIEMCPR
FT                   KVFEWSKELSEKGVHYPVPAHAEKCVKCKLCELLCPDFAIAVRW"
FT   gene            191943..192731
FT                   /locus_tag="PYCH_02400"
FT   CDS             191943..192731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02400"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02400"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23939"
FT                   /db_xref="GOA:F8AGA3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGA3"
FT                   /protein_id="AEH23939.1"
FT                   /translation="MRAIEAENLEIYYGEYKAIEGLTFYLEQGETLLLLGPNGAGKTTL
FT                   LKVLAGFHTNYRGKVLIFGKRPDEAREFVAYVPQSFALNVRVPLSALEVVAMGALYRSG
FT                   LAHLNIPPDVVRRAQEVLEFLGIGDVANEPFRNLSGGQKQRVLIARALISNPRILLLDE
FT                   PLSALDPKARIDATAILSKIKDEMSITMVITTHDVNPLIEIGDKVMLIDRRLVAFGGPE
FT                   EVLKDEVIAKVYGSASKTIRVGERLYCIIGDVHMPREVAP"
FT   gene            192728..193558
FT                   /locus_tag="PYCH_02410"
FT   CDS             192728..193558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02410"
FT                   /product="ABC-type manganese/zinc transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02410"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23940"
FT                   /db_xref="GOA:F8AGA4"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGA4"
FT                   /protein_id="AEH23940.1"
FT                   /translation="MIPEYLFRALLASVMVGTLLGMLSPLINIKGAAFLTHATFHSLLF
FT                   GAVLGMILGLIFGNLSLIFWVSLPIAIMVVIAVAELEMRGYSADTAVGAVAGLVAGLTV
FT                   LGFGLLYKVMASRPYFALSESIVTYLTGEIFLVTLEDLWMLVLGGIIIFGLMLLFYRDF
FT                   VYLSFDPEGMESCGGHVRLYLILLYILVGATGGLIVKTVGLITLQVVAVLPGAIAMSLA
FT                   KSVRELMGISLAITLSVQLASVLLGYVLDMPPSGIATIFLGMLYGGLMVRRRLQ"
FT   gene            193555..194220
FT                   /locus_tag="PYCH_02420"
FT   CDS             193555..194220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02420"
FT                   /product="ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02420"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23941"
FT                   /db_xref="GOA:F8AIQ2"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004649"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020787"
FT                   /db_xref="InterPro:IPR023160"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIQ2"
FT                   /protein_id="AEH23941.1"
FT                   /translation="MKVAGIDEAGRGPVLGPLVIVAVVVDEKKMTELEGIGVRDSKALT
FT                   PKKREKLFERILSMVDDYSIVLVEPPEIDARAGTMNELEVEKFAQALNSLKVKPDVVYV
FT                   DSADVRSERFGLALREKLAFDAKVVSEHKADAKYPVVSAASILAKVIRDREIEKLKLEY
FT                   GDFGSGYPSDPRTRAFLEDYYRRHGDFPPMVRRTWKTVKEIEKQLGRKGQLTLDQFLP"
FT   gene            complement(194195..195724)
FT                   /locus_tag="PYCH_02430"
FT   CDS             complement(194195..195724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02430"
FT                   /product="dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02430"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23942"
FT                   /db_xref="GOA:F8AGA5"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGA5"
FT                   /protein_id="AEH23942.1"
FT                   /translation="MDYALLKRNWKTLIFLLYVLLLVGGSTYYMLMWASRVNDYMGDEV
FT                   WYVPATRNVLARLGINVHYVNGSYEGVNVILKEPEYRGEVRVSFLGLTITGKYRNYPHV
FT                   PEFARRLGIRVEIIPYNVSTLDSAHFDSLKLKVWEIANRCGFKDYVPYQNFPGVYYEIP
FT                   TNCTAEFVANVSRLGNLSVVTGFRYPDKENIHRYLNTEHPFLGKDIIALGMLLGDKPIF
FT                   WRLPGIIEHIIIDLVVLYVAYRLTKSYLAAGIALLFVALDPLLFATSIVAMLDIHVAFF
FT                   VSLFLLTLTLNRDRLSGLTLGLATATKLSGAFVFPVLWIKLIRKGSVKEFLISGILLPA
FT                   AGFLLPELPIIKAMGFVPWLQEFLASFSWHLSFKGEHPASSPFWMWFISLKPFPFHYSP
FT                   DVYAVTDPILMLSMVAFIFAIPYAARRQVKLAEIFGAFWSVVVFFALQWILGGKTQFIF
FT                   YATPLVPPGAIVLGVLGHDIIRWEYFEESLRIYWRWIRGILKEIRARIGRG"
FT   gene            complement(195706..196890)
FT                   /locus_tag="PYCH_02440"
FT   CDS             complement(195706..196890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02440"
FT                   /product="molybdenum cofactor biosynthesis protein MoeA"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02440"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23943"
FT                   /db_xref="GOA:F8AIQ3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIQ3"
FT                   /protein_id="AEH23943.1"
FT                   /translation="MEFKRLTPYQEALKLMLDDLGEVNDEEVSLKEALGRVLAEDVTTP
FT                   FEIPPFNRAAVDGYALRAEDTFAAREYSPVTLEVIEEVPAGRAPRKRVEPGKSIKVLTG
FT                   AKIPEGANAVLMQEHAIREGNLIRVLRPVAPGQNVAFAGEDVKKGQVVLRKGQILRPQD
FT                   LAILKALGVKRVRVKRRPRVGIIVTGDELIDEPSEDAFRAGKIVETNSVMLMGLVERYF
FT                   GEPVFYGVLPDDPHEIREAMEMAKKENDLVLVTGGSAFGDRDYAHHFVRLLFHGTTIKP
FT                   GRPIGYGERVFVMSGYPVAVFAQFHLFVKHALAKLVGARDCEIRVRARLMERVPSQLGR
FT                   YEFVKVRYEGGIARPIKRRGSGIMSSLVESNGYLVIPEDSEGYLEGEEVWITLY"
FT   gene            complement(196931..198304)
FT                   /locus_tag="PYCH_02450"
FT   CDS             complement(196931..198304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02450"
FT                   /product="ADP-specific phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02450"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23944"
FT                   /db_xref="GOA:F8AGA6"
FT                   /db_xref="InterPro:IPR007666"
FT                   /db_xref="InterPro:IPR011790"
FT                   /db_xref="InterPro:IPR015990"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGA6"
FT                   /protein_id="AEH23944.1"
FT                   /translation="MIDAVRGLRIYTAYNANVDVIVHIDGKTIQGLIKEFGPKAVRERI
FT                   EEYPREIREPLDFVARLVHALKFGKPVAVPLVNEDLNEWFDSRFKYEMESIGGQAGIIA
FT                   NLLASLGLRRVITYTPFLPKRLANLFHPSVLYPTVDGKLVLKPIREAYRDGDPVKVNRI
FT                   FEFRKGTEFRLGDEVIEVPHSGRFIVSARFETLSRIETRDELRPYLPEIGKLVDGAILS
FT                   GYQGLRLSYSDGKDANYYLRKAKEDIRLLKKEADIKVHVEFASIQDRKLRKRVMNNIFP
FT                   LVDSVGMDEAEIAHILNVLGYPDLADRIFLYNRIEDTVLGGKIILDELNFEILQVHTIY
FT                   YLIYITHRDNPLTEEELMRSLEFGTTLAAARASLGDIRGPKDYEVGLRVPFNDRGEYVK
FT                   LRFEEAKSRLRMREYKVVIVPTRLVPNPVSTVGLGDTISAGAFTSYLTMLKKRGALPG"
FT   gene            198418..199419
FT                   /locus_tag="PYCH_02460"
FT   CDS             198418..199419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02460"
FT                   /product="rRNA pseudouridine synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02460"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23945"
FT                   /db_xref="GOA:F8AGA7"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR026326"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGA7"
FT                   /protein_id="AEH23945.1"
FT                   /translation="MARDEVRRLPADVKREVLIKDEKAETNPKWGYPPEKRPMEMHMQF
FT                   GVINLDKPPGPTSHEVVAWIKRLFNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLP
FT                   AGKEYVALMHLHGDVPEEKIYRVMKEFEGEIIQRPPLRSAVKRRLRTRKVYYIEILEID
FT                   GRDVLFRAGVEAGTYIRSLIHHIGLALGVGAHMAELRRTRSGPFKEDETLVTFHDLVDY
FT                   YHFWKEDGIEEHFRRAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIVKLHAGIK
FT                   RGDLVAIMTLKDELVALGKALMTSQEMLQKSRGIAVDVEKVFMPRDWYPKMW"
FT   gene            199605..200591
FT                   /locus_tag="PYCH_02470"
FT   CDS             199605..200591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02470"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23946"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGA8"
FT                   /protein_id="AEH23946.1"
FT                   /translation="MEGRAKKVCVVLLLAMMLSLQFGTVQETKALTDNATSITFRRAVV
FT                   AWYDEKSRLQMNVTWINQTIDFANLTNTSCPCHNSSSCASNLTANFNVSVVTLYNMTKK
FT                   HEQLLFFGITIYNGTFNYTMYALVYRAERSQYNFTLVTRIFTDPETGAYKVFLTGMNIA
FT                   PNDENKVVLVADTIVTRDNLTLSEYYWTLNKILMKLRRGDETGWIWGRSAYELRHLLHL
FT                   VRLKLPEYNQQKAMGLTAVTDVIGITLTCITYPKHIDWWCAITSCATSIILGVLECGEC
FT                   AASLLVRKPNTKACAACVAAIGSISGDCGKCFSDWTTVCIPGYGTPA"
FT   gene            201309..201941
FT                   /locus_tag="PYCH_02480"
FT   CDS             201309..201941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02480"
FT                   /product="Ribosomal RNA small subunit methyltransferase C
FT                   (rsmC)"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02480"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23947"
FT                   /db_xref="GOA:F8AGA9"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGA9"
FT                   /protein_id="AEH23947.1"
FT                   /translation="MDITYLYKPLNEPSHMSHYYSERPSGPLRTKTIDVCIRGYCFRFI
FT                   TASGVFSFGKLDRGTELLIENMILQPGWRILDLGCGYGAIGIVAARFVDYVVMTDINRR
FT                   AVAIARKNLKINGVKNAEVRWGTLYEPVEGEKFHSIITNPPVHAGKDVLREIVINAPRH
FT                   LHDGGLLQMVIRTSHGAKFIKSLMEETFTEVREVAKGSGYRVYAGIA"
FT   gene            201928..202014
FT                   /locus_tag="PYCH_t200"
FT   tRNA            201928..202014
FT                   /locus_tag="PYCH_t200"
FT                   /product="tRNA-Ser"
FT   gene            202037..202483
FT                   /locus_tag="PYCH_02490"
FT   CDS             202037..202483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02490"
FT                   /product="30S ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02490"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23948"
FT                   /db_xref="GOA:F8AIQ4"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019977"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIQ4"
FT                   /protein_id="AEH23948.1"
FT                   /translation="MADFRHIVRVAGVDLDGHKQLRWALTGIKGVGINFATMVCRVAGL
FT                   DPFMKAGYLTDEQIKKIEEILSDPVAHGIPRWAVNRPKDYETGRDLHLITAKLDMAIRE
FT                   DIMRLRRIRAYRGIRHELGLPVRGQRTRSNFRRGQTVGVSRKKK"
FT   gene            202494..203042
FT                   /locus_tag="PYCH_02500"
FT   CDS             202494..203042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02500"
FT                   /product="30S ribosomal protein S4P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02500"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23949"
FT                   /db_xref="GOA:F8AGB0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR022802"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGB0"
FT                   /protein_id="AEH23949.1"
FT                   /translation="MGDPKRQRKKYETPPHPWIKERLDRERVLMEKYALKNKKELWKHE
FT                   TQLKNFRRRARRLLAARGKQAEIERQQLLQRLRRLGLLPADAVLDDVLSLTIEDILERR
FT                   LQTIVFKKGLARTMRQARQLIVHGHIEVNGQIIRSPSYLVLKEEEDTITYARTSPFANP
FT                   GHPERMVIEQAKQSEGGGA"
FT   gene            203039..203452
FT                   /locus_tag="PYCH_02510"
FT   CDS             203039..203452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02510"
FT                   /product="30S ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02510"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23950"
FT                   /db_xref="GOA:F8AGB1"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019961"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGB1"
FT                   /protein_id="AEH23950.1"
FT                   /translation="MSEEQVNIKKKEKWGIAHIYSSYNNTIIHITDITGAETISRWSGG
FT                   MVVKADRDEPSPYAAMIAAKRAAEEALEKGIVGVHIRVRAPGGSKSKTPGPGAQAAIRA
FT                   LARAGLKIGRVEDVTPIPHDGTRPKGGRRGRRV"
FT   gene            203484..204263
FT                   /locus_tag="PYCH_02520"
FT   CDS             203484..204263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02520"
FT                   /product="DNA-directed RNA polymerase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02520"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23951"
FT                   /db_xref="GOA:F8AIQ5"
FT                   /db_xref="InterPro:IPR001514"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR022842"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIQ5"
FT                   /protein_id="AEH23951.1"
FT                   /translation="MVKVEILEKRENAIKFILEGVSIAFANALRRTILGEVPTFAVDEV
FT                   EFYENDSALFDEIIAHRLAMIPLTTPVDRFALDSLELDDYTVTLSLEAEGPGVVYSGDL
FT                   KSDDPDVKPVTPDIPIVKLAEGQRLVFNAYAKLGRGKDHAKWQPGFAYYKYYTKIHISK
FT                   SIPGWEKLKSLAEKRGLPVEETDEEVIVTTLKPFYIPREFEEYESKEIWEEIVPEAYVF
FT                   TVETNGELPVEEVVGIALRILMRKSDRFISELRRVAG"
FT   gene            204269..204356
FT                   /locus_tag="PYCH_t205"
FT   tRNA            204269..204356
FT                   /locus_tag="PYCH_t205"
FT                   /product="tRNA-Leu"
FT   gene            204423..204785
FT                   /locus_tag="PYCH_02530"
FT   CDS             204423..204785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02530"
FT                   /product="50S ribosomal protein L18e"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02530"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23952"
FT                   /db_xref="GOA:F8AGB2"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR021132"
FT                   /db_xref="InterPro:IPR022947"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGB2"
FT                   /protein_id="AEH23952.1"
FT                   /translation="MKRTGPTDPNLRRLIRYLRKKSNEEGVKIWKDIAWRLERPRRQRA
FT                   EVNVSKINRYTKDGDMVVVPGSVLGAGKIDHRVIVAAWKFSETARRKIIEAGGEAITIE
FT                   ELVERNPKGSGVIIME"
FT   gene            204792..205220
FT                   /locus_tag="PYCH_02540"
FT   CDS             204792..205220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02540"
FT                   /product="50S ribosomal protein L13P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02540"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23953"
FT                   /db_xref="GOA:F8AGB3"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR023564"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGB3"
FT                   /protein_id="AEH23953.1"
FT                   /translation="MRIINAEGLILGRLASKVAKMLLEGEEVVIVNAEKAVITGNREDI
FT                   FAKYKQRTELRTLTNPRRGPFYPKRSDEIVRRTIRGMLPWKTDRGRKAFKRLKVYVGIP
FT                   KEFQGKELETIMEAHVSRLATPKYVTVGEVAKFLGGKF"
FT   gene            205232..205639
FT                   /locus_tag="PYCH_02550"
FT   CDS             205232..205639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02550"
FT                   /product="30S ribosomal protein S9P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02550"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23954"
FT                   /db_xref="GOA:F8AGB4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019958"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGB4"
FT                   /protein_id="AEH23954.1"
FT                   /translation="MRIIQTSGKRKTAIARAVIREGKGRVRINGKPVELVEPEIARFTI
FT                   LEPLILAGEEVWNSVDIDVRVQGGGFMGQAEAARIAIARALVEWTNDMNLKEKFMKYDR
FT                   TMLVGDPRRTEPHKPNRSTKGPRAKRQKSYR"
FT   gene            205695..205892
FT                   /locus_tag="PYCH_02560"
FT   CDS             205695..205892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02560"
FT                   /product="DNA-directed RNA polymerase subunit N"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02560"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23955"
FT                   /db_xref="GOA:F8AGB5"
FT                   /db_xref="InterPro:IPR000268"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR020789"
FT                   /db_xref="InterPro:IPR023580"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGB5"
FT                   /protein_id="AEH23955.1"
FT                   /translation="MIIPVRCFTCGKVIGDKYYEFKARVEAGEDPEKVLDDLGLERYCC
FT                   RRMLLSHVELIDDIMHYRVY"
FT   gene            205909..205986
FT                   /locus_tag="PYCH_t210"
FT   tRNA            205909..205986
FT                   /locus_tag="PYCH_t210"
FT                   /product="tRNA-Pro"
FT   gene            206007..206180
FT                   /locus_tag="PYCH_02570"
FT   CDS             206007..206180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02570"
FT                   /product="DNA-directed RNA polymerase subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02570"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23956"
FT                   /db_xref="GOA:F8AIQ6"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR020708"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIQ6"
FT                   /protein_id="AEH23956.1"
FT                   /translation="MFKYTRFEKARIIGARALQISMGAPILIDVPEGITPLEAAILEFE
FT                   KGVIPITVIRPS"
FT   gene            206186..207211
FT                   /locus_tag="PYCH_02580"
FT   CDS             206186..207211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02580"
FT                   /product="enolase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02580"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23957"
FT                   /db_xref="GOA:F8AGB6"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGB6"
FT                   /protein_id="AEH23957.1"
FT                   /translation="MSVIQNVVGRVAVLRGGKYSVEVDVITSDGFGRFAAPIEENPTLH
FT                   IAEARRAVSEVDEIIGPELIGFDSVEQELIDSYLWEIDGTDDLSHIGANTALAVSVAVA
FT                   KASANSKAIPLYSYIGGTFTTELPVPILRFASDESFDYYMVVRDLLEITDVVDAVSKVL
FT                   EAADSITLETLSKASEKVGDELGLEVSLGIGMKMPMGTEEVLALVEDNNVAYIKPLGEE
FT                   ELFLELIAGTHGVFVDGEYLFRTKNILDRRYYNALSIKPINLGTLTDLYNLVNDAKAER
FT                   ITPILSESTYESADEALPHIALGLKCPAIILDWTSIEKINELNRIAEDLGERGRIITFE
FT                   G"
FT   gene            207225..207833
FT                   /locus_tag="PYCH_02590"
FT   CDS             207225..207833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02590"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02590"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23958"
FT                   /db_xref="GOA:F8AGB7"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005707"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023454"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGB7"
FT                   /protein_id="AEH23958.1"
FT                   /translation="MADEYLVPLDQYLAAGVHIGTQQKTKDMRKFIYRVRQDGLYVLDV
FT                   RKTDERLKVAGKFLAKFEPQSILAVSVRLYGQKPVKKFGEVTGAKAMPGRFLPGTMTNP
FT                   AVKNFFEPDVIIVTDPRADHQAMKEAVEIGIPIVALVDTENLLSYVDLAIPTNNKGRKA
FT                   LALIYWILAREILYNRGEIASREDFKIPVEDFEMKIVRR"
FT   gene            207898..208776
FT                   /locus_tag="PYCH_02600"
FT   CDS             207898..208776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02600"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23959"
FT                   /db_xref="GOA:F8AIQ7"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIQ7"
FT                   /protein_id="AEH23959.1"
FT                   /translation="MIRYPAVAGQFYPLGEELVDMLKAFFRDLGEPGGERKITAGIAPH
FT                   AGYVFSGYTASRTYKAIYEDGLPETFVIFGPNHTGLGSPIAVYPEGKWVTPLGEVEVDG
FT                   ELAREIVKNSGIADLDEIAHKYEHSIEVQLPFIQYIAERAGKTVRIVPITLSIQDEEVS
FT                   EDLGGAVFEAARELGRDVVVIASTDFMHYGTFYGYVPFRARANELPNLVKEWDLRVIRR
FT                   ILDFDVEGMFREIREMDHTMCGPGGVGASVVFSRLIGAVEAELLHYTTSFDISRSTDAI
FT                   VGYASIVMRRA"
FT   gene            208781..209782
FT                   /locus_tag="PYCH_02610"
FT   CDS             208781..209782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02610"
FT                   /product="mevalonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02610"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23960"
FT                   /db_xref="GOA:F8AGB8"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022937"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGB8"
FT                   /protein_id="AEH23960.1"
FT                   /translation="MRVLASAPAKVILFGEHSVVYGKPAIAAAIDLRTFVEAELRDDGR
FT                   IRIEAHDIKVPGLTVSFSESEIYFETDYGKAAEVLSYVREAINLVLEEAGKKTGVKVSI
FT                   TSQIPVGAGLGSSAAVAIATIGAVAKLLGLELTREEIAKLGHKVELLVQGASSGIDPTV
FT                   SAIGGFIYYEKGRFENLPFMELPIVVGYTGSSGPTKELVAMVRRRYEDMPELMVPIIEA
FT                   MGKLVEKARDLITAELDEEEKLRKLGELMNINHGLLDALGVSTKKLSELVYAARTAGAL
FT                   GAKITGAGGGGCMYALAPGKQSEVATAITIAGGTPMVTQISREGLRVEATMP"
FT   gene            209812..210588
FT                   /locus_tag="PYCH_02620"
FT   CDS             209812..210588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02620"
FT                   /product="amino acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02620"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23961"
FT                   /db_xref="GOA:F8AGB9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR024192"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGB9"
FT                   /protein_id="AEH23961.1"
FT                   /translation="MIIVKLGGSVISDKKVEFSFREDVVRRIAREIAEFFPEKRFMIVH
FT                   GGGSFGHPLAKKFRIREGLTDDSKRFGFSATHLAMLDLSGRIVRAFLDEGLPAFPVSTS
FT                   SVFVTENGEVVHGDLTVVEMLLGLGFIPVLFGDVSVDVKKGIDILSGDQIIAYLARKLR
FT                   PEKVIFLMDVGGIYAGKPGEASLVEKLRPGDIEGLIERLSGAAGIDVTGGIANKLRKAR
FT                   EIAEYSEVWFVNGLVPGRLAGAIRGDTTGTVVSKRP"
FT   gene            210697..211830
FT                   /locus_tag="PYCH_02630"
FT   CDS             210697..211830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02630"
FT                   /product="Isopentenyl-diphosphate delta-isomerase (fni)"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02630"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23962"
FT                   /db_xref="GOA:F8AGC0"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGC0"
FT                   /protein_id="AEH23962.1"
FT                   /translation="MGPFDKEELTVIRKFEHIEHCLTKNVQAHVSNGFEDVHFVHMSLP
FT                   EIDKDEIDLSVEFLGRKFDYPIMIAAMTGGTKGSQLAAKINKTLAKAAQELNIPMGVGS
FT                   QRAMIRKPETWESYYVRDVAPDVFLVGNLGAAQFSENAAERYGIEEAIKAVETIQADAL
FT                   AIHMNPLQESVQPEGDTTYRGVLKALAELKAEFPYPIIAKETGAGVSMEIAVRLEAIGI
FT                   DAIDVGGLGGTSWSAVEYYRAKDELGRRLALRFWNWGIKTAISVAEVRYATDLPIIATG
FT                   GMRDGITMAKALAMGASLVGVALPLLKPAVKGDVEEVIKILKCYIEEIRNAMFLVGARN
FT                   VEELRRVPLVITGFTREWLEERINLREYLRARRSTPF"
FT   gene            211890..213209
FT                   /locus_tag="PYCH_02640"
FT   CDS             211890..213209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02640"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02640"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23963"
FT                   /db_xref="GOA:F8AGC1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030879"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGC1"
FT                   /protein_id="AEH23963.1"
FT                   /translation="MIRIYTLGGYEEVGKNMTAVEYNGEVIIIDMGIRLDRVLIHEDVE
FT                   FQKMSSKELRKLGAIPDDRPIRDKKVVAIALSHGHLDHIGAVAKLAPHYPDVPVYGTPY
FT                   TIRLAKSEVKGEQYFEVTNPMFETNYGEIVQVSENLAIEFVQITHSIPHSSIVVIHTPE
FT                   GAVVYACDYKFDNNHPYGEKPDYKRLKELGQESVKVLIAESTRVAEETKTPSEAVAKML
FT                   LEDFFLYEGMEADGLIATTFASHIARLQELIEIANKMGRQAIFIGRSLAKYTGIAKQLG
FT                   LIKMKGSRVLRSPNAISKVLKEVSQARENYLLVVTGHQGEPGAILTRMAGGELYDIGKR
FT                   DTVVFSAGVIPNPLNVAQRYALETKLRMRGVRMIKNLHVSGHASREDHRYLIRLLNPEY
FT                   IVPAHGEFRMLTHYAELAEEEGYMIGKDVFVARNGHRVDI"
FT   gene            213221..214246
FT                   /locus_tag="PYCH_02650"
FT   CDS             213221..214246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02650"
FT                   /product="bifunctional short chain isoprenyl diphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02650"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23964"
FT                   /db_xref="GOA:F8AGJ3"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGJ3"
FT                   /protein_id="AEH23964.1"
FT                   /translation="MKYDALFKRIKEKAKLVDEKMFELIPEKEPAVLYEAARHYPLAGG
FT                   KRVRPFVVLTAAEAVGGDPSKALYPAVAIELIHNYSLVHDDIMDMDETRRGRPTVHKLW
FT                   GINMAILAGDLLFSKAFEAISGADVDAEKKARILETIVRASNELCEGQAMDLEFEKRET
FT                   VTIEEYMRMISGKTGALFEAAAKVGAIVGTENEEYIGSLARWGRNVGIAFQIWDDVLDL
FT                   IADEKKLGKPVGSDIRKGKKTLIVAHFFERADERDRERFLRVFGKFAGDVRGRGIIEED
FT                   VKAEVMEAIELLKAYGSIDYAASYAKKLIREANESLKILPESEARKDLELLAEFIVERD
FT                   H"
FT   gene            214285..215118
FT                   /locus_tag="PYCH_02660"
FT   CDS             214285..215118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02660"
FT                   /product="inorganic polyphosphate/ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02660"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23965"
FT                   /db_xref="GOA:F8AGJ4"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGJ4"
FT                   /protein_id="AEH23965.1"
FT                   /translation="MKFGIVARRDREEALKLAYRVYDFLKVSGYDVVVDMDTYKHFPHF
FT                   DEGDVLPLEEFDVDFIIAIGGDGTILRVEHHTKRDIPILSVNMGTLGFLTEVEPSETFF
FT                   AINRLLEGDYYIDERIKLRTFIDGKGNIPDALNEVAILTGVPGKIIHLKYYVDGGLADE
FT                   VRADGLVVSTPTGSTGYAMSAGGPFLDPRLDTMVIVPLLPMPKTSVPIVIPGTSTVEIE
FT                   LITEREIILVVDGQYYEHLPSNVWITVKKSPRKAKFVRFSREIYPKYTMKIKERH"
FT   gene            complement(215115..216077)
FT                   /locus_tag="PYCH_02670"
FT   CDS             complement(215115..216077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02670"
FT                   /product="homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02670"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23966"
FT                   /db_xref="GOA:F8AGJ5"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGJ5"
FT                   /protein_id="AEH23966.1"
FT                   /translation="MKVVRVSIFGFGTVGRALAEIMAERGRRFGVELRIVSITDRSGTI
FT                   WGDIDPLEAKEVKETMGRLSAWDEYEVFDFSPEELVQEVRPDILVDVSSHDEAFSMYET
FT                   ALKEGIGVVTSNKPPIANHYRELMKAAEEGGAGLFFEATVMAGTPVIGLLRENLLGDDV
FT                   LSIEAVLNASTTFILTEMERGSSFEKAVEKAKEQGILEEDPSKDIDGIDAMHKAKILHW
FT                   VAFGQEAEEVEVKGIREVTDARRVRLIAEVSKGRIRVQPKRLSEGSPLLTEGVLNAAVI
FT                   RTDLLGELVIKGPGGGGKVTASGVFSDILKAASYMKPLR"
FT   gene            216131..216682
FT                   /locus_tag="PYCH_02680"
FT   CDS             216131..216682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02680"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23967"
FT                   /db_xref="InterPro:IPR021683"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGJ6"
FT                   /protein_id="AEH23967.1"
FT                   /translation="MKYRFDLRKHEKGVMILAVLLFLLSLSLSPPVRWPPYSLLEYVIY
FT                   CSIAPVLLVIALHEGLHAVVARLQGARVEFGITKLGKSWVAMAPYTAVRTPLPVKMWIP
FT                   VLLAPFSLSPLFYILGSATGSPIWVMAFLINTSGLAGDIVVLLVLIRMPKDALVVDEGI
FT                   EMVSEIPFPEPWPELLRLGK"
FT   gene            complement(216732..217091)
FT                   /locus_tag="PYCH_02690"
FT   CDS             complement(216732..217091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02690"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23968"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGJ7"
FT                   /protein_id="AEH23968.1"
FT                   /translation="MSVDEETFRRDVLSRIPLRNEPPLPPDCLPIAKNERQRAHLELYN
FT                   LREEIFEALFGRKDDLHYLPLERLKELVEKASGEVIESGTFEPALPQLSRLYPAGVPQG
FT                   DKGRTKACRTFKAVG"
FT   gene            complement(217292..218530)
FT                   /locus_tag="PYCH_02700"
FT   CDS             complement(217292..218530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02700"
FT                   /product="Archaeal ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02700"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23969"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGJ8"
FT                   /protein_id="AEH23969.1"
FT                   /translation="MKIIERRELRDVLNVRWLLIYGRRKTGKTFYIRERAKYSHYFIVT
FT                   SGREIFEIKKGEIYSFSEFMRVLPLLLDQGRIVIDEFHRLGESFFSILQGLSGRGGLIL
FT                   ITSTRHYFKKLIGNNSPLLGLFYVRELSLVDPRDAINFVNELGYKGKAMVELAVLVQEP
FT                   WLAPAVESLGERVFSTLGSTLKGNVPSLIGEIFTEEERELTRRYSAILETVADGKSSSG
FT                   EIAKELYSRGLIEKETHSAVAPYLETLVNMGILERISLFGKRKKIFKYRHLSPVVDFAY
FT                   YLNAKYGFFETELPDETVERIFREKMPHYVERFFERLLVKHYSLQPIRIEMPDLEVDVA
FT                   LLKNRKLHLVAEVKWKEKIKEKDIRKVEEKFEEINAKKKLLIVPDRNDLPRAPENAEIL
FT                   DWRDAVELSRALI"
FT   gene            complement(219457..222354)
FT                   /locus_tag="PYCH_02710"
FT   CDS             complement(219457..222354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02710"
FT                   /product="leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02710"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23970"
FT                   /db_xref="GOA:F8AGJ9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR004493"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020791"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGJ9"
FT                   /protein_id="AEH23970.1"
FT                   /translation="MAELNFKAIEEKWQKRWLEEKVFEPQRDPRKPKFYITVAFPYLSG
FT                   HLHVGHARTYTIPDVIARFKRMQGYNVLFPMGWHITGAPIVGIAERIKNRDPKTIWIYR
FT                   DVYKVPEEILWTFEDPVNIVKYFMRAAKETFIRAGFSVDWSREFHTTSLFPPFSKFIEW
FT                   QFIRLKEMGYIVKGAHRVRWDPVVGTPLGDHDLMEGEDVPILEYVLIKFELREDGEVIY
FT                   LPAATLRPETVYGVTNMWVNPEAIYVKAKIRRGDREETWIISREAAYKLSFQDREIEIL
FT                   EEFKGEKLIGKYVRNLVTGDEVIILPAEFVDPDNATGVVMSVPAHAPFDHVALEDLKRE
FT                   TEILLKYDIDPRVVEEISYISLIKLEGYGEFPAVEEVEKLGIKSQKDREKLEQATKTIY
FT                   KAEYHKGIFKVEPYAGKPVQEVKELIAKELQEKGIAEIMYEFAEKNVISRFGNRAVIKI
FT                   IHDQWFIDYGNPEWKAKAKEALDQMTIYPESRRAQFEAVIEWLDKKACARKVGLGTPLP
FT                   WDPEWVIESLSDSTIYMAYYTISRHINKLREEDKLDPEKLTPEFFDYIFREGFSEAKEK
FT                   ELAEKTGIPAEIIHEMKEEFEYWYPLDWRCSAKDLIPNHLTFFIFNHVALFRREHWPRG
FT                   IAVNGFGTLEGQKMSKSKGNVLNFIDAIEENGADVVRLYIMSLAEHDSDFDWRRKEVGK
FT                   LRKQVERFYELVSEFASYEAKEGIELKSIDRWMLHRLNKSIEGTTKALEEFRTRTAVQW
FT                   AFYTIMNDLRWYLRRTEGRDDAAKRYVLRTLADVWVRLMAPFTPHICEELWEKLGGEGF
FT                   VSLAKWPEPRKEWWNEALEIGEEFIKSLIEDIKEIVEVAKIENPKRAYIYTAPEWKWRV
FT                   VEVVAEKRDFKAAMAELMKDEEIRKHGKEVAKIVQRLIKERAFDVKRIDEEKVLREAKE
FT                   FIEKELGLEIVINPKEDKGGKKKQAMPLKPAVYVE"
FT   gene            222539..223558
FT                   /locus_tag="PYCH_02720"
FT   CDS             222539..223558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02720"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23971"
FT                   /db_xref="InterPro:IPR008553"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGK0"
FT                   /protein_id="AEH23971.1"
FT                   /translation="MPLAEYVDLLMLIVSLLTSAYLFTAYLKASKEYTLFGAFGWAMLA
FT                   FHEAMRLFNGLEFLQEGLLYGFSLGTSLYILSIVEELSPTAIRLFKLFLLIPLVHIVYR
FT                   LLWVIMGIKYPGVGGIAGDSGTILLISAYVVWRVLGREGRLMALSAVPLSVALLLYKIC
FT                   HSTYVELVLVAIGAVMLSWVTVRTSSRVLFRPGSEGSADLPKGLLMLPEREFRVMLKDL
FT                   EDNSLLLFTREVRDYPESWTVFYVTNAPTANSVRPTSLEKMTHLAVRYLREAREMGTRG
FT                   IVALDCLEYLRMYNDFSSLLKFLHNLRDYAIVEVGTALVSFVPEAWDERERALLMGVS"
FT   gene            223595..223774
FT                   /locus_tag="PYCH_02730"
FT   CDS             223595..223774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02730"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23972"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGK1"
FT                   /protein_id="AEH23972.1"
FT                   /translation="MLAEVECTGGSGTLEIVDLFSGEQVFSTPSTESSQKNLLFLTRVP
FT                   IMWPILATALFPAF"
FT   gene            223880..224500
FT                   /pseudo
FT                   /locus_tag="PYCH_02740"
FT                   /note="putative ABC transporter / fragment"
FT   gene            224744..225373
FT                   /locus_tag="PYCH_02760"
FT   CDS             224744..225373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02760"
FT                   /product="50S ribosomal protein L15e"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02760"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23973"
FT                   /db_xref="GOA:F8AGK2"
FT                   /db_xref="InterPro:IPR000439"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR020925"
FT                   /db_xref="InterPro:IPR020926"
FT                   /db_xref="InterPro:IPR024794"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGK2"
FT                   /protein_id="AEH23973.1"
FT                   /translation="MFPDGRTTNEEGVKGMGMYKYIREAWKSPKKSYVGQLLKQRMIKW
FT                   RREPVVVRIERPTRLDRARALGYQAKQGYVIVRVRVRRGGRKRPRWRAGRKPSKMGMVK
FT                   YSPKKSLQWIAEEKAARKFPNLEVLNSYWVGEDGMYKWFEVIMVDPHHPVIKSDPKIAW
FT                   IALKVHKRRVFRGLTSAGKKGRGLRNKGKGAEKVRPSIRANEGKGK"
FT   gene            complement(225374..225868)
FT                   /locus_tag="PYCH_02770"
FT   CDS             complement(225374..225868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02770"
FT                   /product="nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02770"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23974"
FT                   /db_xref="GOA:F8AGK3"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGK3"
FT                   /protein_id="AEH23974.1"
FT                   /translation="MAEVERTLVIIKPDAVVRGLIGEIISRFEKRGLKIVGMKMIWIDR
FT                   ELAEKHYAEHKGKPFFEALIEYITKAPSVVMVVEGRYAISVVRKMAGATDPKDAEPGTI
FT                   RGDYGLDIGDAIYNVVHASDSPESAEREINLYFKPEELFEYCKAADWFYRTKKKAKCEE
FT                   L"
FT   gene            complement(226093..228018)
FT                   /locus_tag="PYCH_02780"
FT   CDS             complement(226093..228018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02780"
FT                   /product="DNA repair helicase rad3"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02780"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23975"
FT                   /db_xref="GOA:F8AGK4"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR013020"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGK4"
FT                   /protein_id="AEH23975.1"
FT                   /translation="MLEYFPYESLRPNQEEFIRLVSDAVRKGKNLIVEAPTGFGKTISV
FT                   LAGILPHAIAMGYKVVYLARTHKQMDRVIEELKAIGRKAKVSGVEFRSRKELCLHPYIQ
FT                   TFSPDAYNAMVVCKNLKKLGKCPFYENFKEKREGVSELVEFFLTTPGHPSEIVHYCRLL
FT                   ELCPYEVTRRVGEKATVIVASYLYMVSPPIREAFLEGLGLEYSDLILVFDEAHNLPDQA
FT                   VSALSDRLSLRSLERAVKEAQEYGEGDIESFLLILLRGLELLYEERLKNYEAYEVPIRP
FT                   EDIFRHVIEVTGYLGRAIVRMLNDMVEVGDAIREDRIERNLPPRSYIGRVGEFLLTWLS
FT                   LANSEDYLHLMSREKGLSLEIVALDPSRALDFVEEVHSAIFMSGTLSPLEAFRDIIGVE
FT                   AELKKFPRIVKRENALVLVARDVSTRGEERSPGLYRRLAEYIFEAVRLTPKNVGVFTAS
FT                   YEVLDGLISTNIHVKIEEELGKKVFIEKKGASSRENDALVAQFKAEAKGNGAVLFGVMG
FT                   GRNSEGQDYSGDEMNGVVLVGIPYARPTPRVQAQIRYFEKKFPGKGRYYGYVLPAHRKL
FT                   AQAAGRVHRSAEERGSIVILDYRVLWKNVKKDLPDWMVETMRAVTLPTMRLYLRKFWRG
FT                   KDEGGN"
FT   gene            228126..228203
FT                   /locus_tag="PYCH_t215"
FT   tRNA            228126..228203
FT                   /locus_tag="PYCH_t215"
FT                   /product="tRNA-Ala"
FT   gene            228218..228295
FT                   /locus_tag="PYCH_t220"
FT   tRNA            228218..228295
FT                   /locus_tag="PYCH_t220"
FT                   /product="tRNA-Val"
FT   gene            complement(228328..229698)
FT                   /locus_tag="PYCH_02790"
FT   CDS             complement(228328..229698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02790"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02790"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23976"
FT                   /db_xref="GOA:F8AGK5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGK5"
FT                   /protein_id="AEH23976.1"
FT                   /translation="MDYPKIVVKPPGPKVRELVERESRVLSPGIGVKLFPLVPRRGFGP
FT                   FIEDVDGNVFIDFLAGAAAASTGYSHPKLVEAVREQVALIQHSMIGYTHNERAIEVAER
FT                   LTTIAPVNEPRIIFGMSGSDAVDMAVKVAKFSTGRPWLLAFIGAYHGQTLGATSVAAFQ
FT                   SSQKRGFSPLMPNVFWIPYPNPYRNPWGINGYENPDELINRVLDYLEHYVFAHITPPDE
FT                   VAALFAEPIQGDAGIVVPPEDFFVQLKGLLEEHGILLVMDEVQTGIARTGKWFASEWFR
FT                   IEPDLLIFGKGVASGMGLSGVIGRAELMELTSGSSLLTPAANPVISAAAKATLEIIEKE
FT                   NLLENALRVGAFIMKRLREMQEEFEIIGDVRGKGLMIGVEIVRDERPDPELTGKICWRA
FT                   FELGLILPSYGMFGNVIRITPPLVITEEVAERGLEIMETAIRDALAGRVYKKVVTWH"
FT   gene            complement(229746..231299)
FT                   /locus_tag="PYCH_02800"
FT   CDS             complement(229746..231299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02800"
FT                   /product="Sodium/alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02800"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23977"
FT                   /db_xref="GOA:F8AGK6"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGK6"
FT                   /protein_id="AEH23977.1"
FT                   /translation="MGGIVDFINWLDGEVWGPPIIVLLIGTGLLLTIVLGGIQFRRLGW
FT                   AIKFTLSEGRKKTGEGDITPFQALMATISGTVGIGNIAGVATAIHYGGPGALFWMWVTA
FT                   LVGMATRYSEGLLGVAFRGKLPDGTMIGGTFNFLEKGFAEVKGTGISRAIAAILMLLFA
FT                   AFIARDGLGLAGGLKVLAFIIAILFAILGLALLQESKLPVIGKILAVLFALFAAIAAFG
FT                   IGNMTQSNSVADAIETAFGIPAWVTGLALAILTFIVVIGGIKRIGEVAEALVPFMAIVY
FT                   FLFAIGVWIKFAGQIPSAIAMIIKDAFTGRAVAGGAIGQVIIWGVKRGLFSNEAGLGTA
FT                   TLAHAAAKTDHPARQAHVAMLGPFIDTLIICSLTGISIVVTGAYTKYPDLNGAPLTQAA
FT                   FAEAFGHLGEIMVAIGIILFAYSTILAWSFYGRQNIMYLAKWITRDPEKFARLYPKLHL
FT                   VYNLLFVVFIYIGAVTKLETVWNFSDMMNGLMAIPNLVGLIVLYPIIKQYTKDFLAKNP
FT                   "
FT   gene            231449..232285
FT                   /locus_tag="PYCH_02810"
FT   CDS             231449..232285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02810"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23978"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGK7"
FT                   /protein_id="AEH23978.1"
FT                   /translation="MHQGKARLTATFFCLILLMAFLPSGTARIGTTRIEDLMTALAVLL
FT                   LALYVFLTVFLVILLLSWRDISAKEEAYDGFLRRFLTMLAPLVASVILYFFVLPRLPAP
FT                   LSNTSASQETILGPVEAPSIVPLRPVETRAGGEAGSYYAYGLAALGILAMGLALLTLVR
FT                   ELVKIGRKRAVKRSLQAFDSRLEEEGLDLFSNPRDAVIELYKKAVLWLEVLGNPYKESW
FT                   THWEHAARVSYRRQAYVTLAKLFEKAKYAPERITREDAKRAYELYMAIRGEENEIH"
FT   gene            232272..232682
FT                   /locus_tag="PYCH_02820"
FT   CDS             232272..232682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02820"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23979"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGK8"
FT                   /protein_id="AEH23979.1"
FT                   /translation="MRFTRTLVAILFLGAFLFGSYPLRWICVLLTGIMLFVMLLGSYEG
FT                   KAVRVPAGRVRRRDDFKRLTDIVRRARPSKGTVARKLIEDRIAEIYANLGRSHEDIREN
FT                   PPEALRVLRSYDDFLAGLEKALELVGADLNEG"
FT   gene            232672..233625
FT                   /locus_tag="PYCH_02830"
FT   CDS             232672..233625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02830"
FT                   /product="ATPase, AAA family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02830"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23980"
FT                   /db_xref="GOA:F8AGK9"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR016366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGK9"
FT                   /protein_id="AEH23980.1"
FT                   /translation="MKVEEVYEKGQAVLKEVKRAIVGKDNVLRLILAAILADGHILIED
FT                   LPGLAKTLMAKSFARALGLEFKRVQFTPDLLPSDILGVSVFNQKTLEFEFRKGPVFTNL
FT                   LLADEINRAPPKTQSALLEAMQERQVTIEGRTYELPRPFIVIATQNPIEQEGTYPLPEA
FT                   QLDRFLVRLRVGYPTKDEEKEILRRRIEREREEVEIRPILTAKDVVEMQKAIEDVYVSD
FT                   PVLEYITSLVWATREDKREIEVGASPRGSLALLKLSRAYAILDGRDYVIPDDVKAVAVP
FT                   ALSHRIILKRELWYTRVSQESIIEKLLEKVPVPKFE"
FT   gene            233631..234854
FT                   /locus_tag="PYCH_02840"
FT   CDS             233631..234854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02840"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23981"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGL0"
FT                   /protein_id="AEH23981.1"
FT                   /translation="MRPTGKALQLLSVTWLSVLLSFLLLRWDMIYLTLPILTLFFVAVL
FT                   FFKPIIDVKVERVLLRERVLEGEEVEITVRVRALARIPFLFIRDELPEGVELVEGSNSW
FT                   VLSLAEGEEKVLRYRVRVRRGIHEFRGFYVAYRDPFGLFEEERFVDVYGEIVGVPRLEE
FT                   VITPYSTRGTKVTVGPLPSPRVGEGVEFHAVREYQPGDPFKIINWKATARTGKIMANEF
FT                   ESERKVDVIFVVDATYKGEAVFDYLIRAAASLMLDSLNNGTSFGLLLSESVPLWIGVDY
FT                   GKRHFFRCIDALSAAKPDKNNMIAYQVDHLARTRFPPRAQILYFSPLITEEGREALRIL
FT                   YLYGYRVVVISPNPCSLIEPRSREEELALKLLMLERKAVIRKLSAYGPIIDWDVRKPLK
FT                   TAIAEVLR"
FT   gene            234851..235264
FT                   /locus_tag="PYCH_02850"
FT   CDS             234851..235264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02850"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23982"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGL1"
FT                   /protein_id="AEH23982.1"
FT                   /translation="MRIRASIIPLIILTLLLSSMPYGALLVPLAVLSLFSYLLGVVFLG
FT                   FLLAFLIFEGVGGAPGVFLVSMALLTVEVAHLDRARAIPIHYAWVIFSVFLSLPLYLLI
FT                   RLLSYFAPSLEVTALATLFLLVLYVFSREVMLK"
FT   gene            complement(235278..236474)
FT                   /locus_tag="PYCH_02860"
FT   CDS             complement(235278..236474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02860"
FT                   /product="major facilitator superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02860"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23983"
FT                   /db_xref="GOA:F8AGL2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGL2"
FT                   /protein_id="AEH23983.1"
FT                   /translation="MGRWRLVILDTLLMTAGFGTLTMMGVAKNEVITHFGISGDLYEWQ
FT                   HIAYVFGLFIAFLLGHTRIYEGSFKRSVAIALSWAAIPQIIIPFIGNWYVVVFLRFVQG
FT                   FVVTLVPLFSTQIARYFVAERPFAKGIILSGIFWGGVFGSMSARYLLGYVEWKVGFIIT
FT                   GIIMYTILLLWWILTEDFEIRHAPSEEVRVSVWKMPFTWLLGFTFFPALWVIFTIIGFS
FT                   TSLGYEMGWTKEHVATLSTSLNVSKALWSIAMGFVGYQLSRKNTNPRGLFNAVVKVMIA
FT                   SYFIAFLGLLVYSKAMLSGNYSLALASLVLVGALQGTGPAFWTSAPATYPKDIVPRANF
FT                   ALGLISNSANAVAPTVTELLARHGEAIALAELTFMPLLGIAALIAVSRMKLPVEELGE"
FT   gene            complement(236487..236750)
FT                   /locus_tag="PYCH_02870"
FT   CDS             complement(236487..236750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02870"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23984"
FT                   /db_xref="GOA:F8AGL3"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGL3"
FT                   /protein_id="AEH23984.1"
FT                   /translation="MKEILYVFIAIFLAELGDKTQLATIAFASKYGWWKAFLGAISGLT
FT                   LVNLIGALIGEKLGDTLPTELVHKAAGILFIIFGILMLIGKL"
FT   gene            complement(236762..237934)
FT                   /locus_tag="PYCH_02880"
FT   CDS             complement(236762..237934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02880"
FT                   /product="aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02880"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23985"
FT                   /db_xref="GOA:F8AGL4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGL4"
FT                   /protein_id="AEH23985.1"
FT                   /translation="MRYRKKYFIAGRMGLIQRSKIRELFEKAAKIENVISLGIGEPDFD
FT                   TPKNIKEAAKKALDEGWTHYTPNAGIPELREAIGEYYKKFYDIEVPPENVIVTAGAYEA
FT                   TYIAFETLLEQGDEVIIPDPAFVSYIEDAKLAEAKPVRLPLREENGFQPDPDELLELVT
FT                   KRTRMIVLNYPNNPTGAVLDKEVAKAIADIAVDYNLYILSDEPYEHFLYDGAKHHPMLK
FT                   FAPENTILVNSFSKTFAMTGWRLGFAIAPEQIIRDMIKLHAYVIGNVASFVQVAGIAAL
FT                   REEESWKAVEVMRNEYNERRKLVLKRLKEMPHIEVPEPKGAFYIFANISKTGMGSEEFS
FT                   EWLLEKARVVVIPGTAFGKQGEGYVRISYATSREKLIEAMDRMEKALEEL"
FT   gene            complement(238006..238434)
FT                   /locus_tag="PYCH_02890"
FT   CDS             complement(238006..238434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02890"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23986"
FT                   /db_xref="InterPro:IPR013926"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGL5"
FT                   /protein_id="AEH23986.1"
FT                   /translation="MKIVRIERNEEEICIAKIHISDPESLLEILDETMQAVSVECWEEV
FT                   AFATLLALRAFKNGRAKAKTVKGEILIRLAGTPQIRDAIAKVGARRGKNYLVAFGKGAC
FT                   EKLKDVIQKLKLDTVPISNCAEEELKKRFEEMALVEAK"
FT   gene            238621..238812
FT                   /locus_tag="PYCH_02900"
FT   CDS             238621..238812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02900"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23987"
FT                   /db_xref="GOA:F8AGL6"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGL6"
FT                   /protein_id="AEH23987.1"
FT                   /translation="MSRMKIISVQLPPSLIHGLDALVKRGLYPNRSEAIRNAIRELLKR
FT                   ELYKEEIERESLPEYIVR"
FT   gene            238834..240060
FT                   /locus_tag="PYCH_02910"
FT   CDS             238834..240060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02910"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02910"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23988"
FT                   /db_xref="GOA:F8AGL7"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGL7"
FT                   /protein_id="AEH23988.1"
FT                   /translation="MFKLLEQAGINLDFDDGEKTKAGEYLGGLDDLIKIAIIGVGGSGN
FT                   NTISRLYDLGVQGAELIAMNTDAQHLAQTKAHKKILLGKNITHGKGSGGDPRIGYMAAE
FT                   ASAQDIAEAVKDVDLVFITAGMGNGTGTGAAPVVARIVKETARNNGRFQEPLVVSVVTF
FT                   PFKNEGTIRTEKAKAGIKLLLEYSDTVIIIQNDKLLELVPKLPINAAFRFADEIIARMV
FT                   KGITETIKLPSMVNIDFADVYSVMKGGGPALIGIGESDSNNRAVDAVMNALNNKMLDVE
FT                   FGSGDKALVHFTVGPDVSLGEINAAMNVVYERLGEKSEIKWGAMVDEDMGKTVRAMVIM
FT                   TGVRSPQILGNVNALVDSTSIVMPSRREFLKDSKVDKIFGSIPDPRRERQLRSTPKELD
FT                   YIFADFYEL"
FT   gene            240110..240883
FT                   /locus_tag="PYCH_02920"
FT   CDS             240110..240883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02920"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02920"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23989"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGL8"
FT                   /protein_id="AEH23989.1"
FT                   /translation="MAIIISIANQKGGVGKTTIALNLGHALARIGKKVLLVDIDPQFNL
FT                   TFALIGMDVLKYEENNVGTLMTRESDVRETIVEVNENLHLLPSHLNLSAKEIEIINAYN
FT                   RERRLERALRPVLPDYDYVIIDNPPSMGIFLVNSLTASDYVLIPLELSYFGVIGMQLMF
FT                   NLMKMIREETNESLTLLGIVPNKFTRQTKVPQMRLRELRETYPDAPLLTTIPKAISLEK
FT                   AQAEGLSIFDYEPDGRAARAFEKLAKEVVEIVEEG"
FT   gene            240867..241199
FT                   /locus_tag="PYCH_02930"
FT   CDS             240867..241199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02930"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23990"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGL9"
FT                   /protein_id="AEH23990.1"
FT                   /translation="MSRKDDAKIPKLFSGSIDELKKPGKRAEKGKDLKREKMQKTLYIT
FT                   LDTNRKLIELYAEEGRRQSRIIEDAVNLYYYLRMALGERKFGELVEAVRREDPEFLREY
FT                   LRKLKV"
FT   gene            complement(241200..241616)
FT                   /locus_tag="PYCH_02940"
FT   CDS             complement(241200..241616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02940"
FT                   /product="glycerol-3-phosphate cytidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02940"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23991"
FT                   /db_xref="GOA:F8AGM0"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGM0"
FT                   /protein_id="AEH23991.1"
FT                   /translation="MGGVFDILHVGHVHFLKMAKELGDELVVIVAHDETVKRRKGRPPI
FT                   NPAEDRAELLRAIRYVDDVVIGEPGEISPDLIKKLDPDIIALGPDQEFSCEELKKRLRE
FT                   HGIKAEVVRLPYLYKHDRAKTSKIIERIIETFCE"
FT   gene            complement(241625..242143)
FT                   /locus_tag="PYCH_02950"
FT   CDS             complement(241625..242143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02950"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23992"
FT                   /db_xref="GOA:F8AGM1"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016437"
FT                   /db_xref="InterPro:IPR022430"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGM1"
FT                   /protein_id="AEH23992.1"
FT                   /translation="MELRVKHPLSKKEIKNILRELSRMFGEDIAGKLLKKKDDVVVAEF
FT                   DKMTQILLVNGKPRFIKRGELIFPLVIALYELSDEEDLRRWPRRVVVDGGAVPHILNGA
FT                   DVMAPGIVDADEDIGEGDLVFVVEEEYGRPLAIGIALMDGKDMKERRKGKAVKVIHHAR
FT                   DRIWELTAR"
FT   gene            complement(242128..242763)
FT                   /locus_tag="PYCH_02960"
FT   CDS             complement(242128..242763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02960"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02960"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23993"
FT                   /db_xref="GOA:F8AGM2"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGM2"
FT                   /protein_id="AEH23993.1"
FT                   /translation="MIVLALDVYERERALRIAEDVREYISMIKVNWPLILGSGIGIIRE
FT                   LKERTGLPMIADLKLADIPNTNRLVAKKVFEAGADYIIVHGFVGRDSVRAIMELGEIIM
FT                   VVEMSHPGAEEFIQPVADKLIEIANEIEPFGVIAPGTRPERVRYIRKMLKKGIKIFTPG
FT                   IGAQGGSARKALEAGADYIIVGRRIYGAEDPRRAAEELYKEVRAWSSG"
FT   gene            complement(242760..243362)
FT                   /locus_tag="PYCH_02970"
FT   CDS             complement(242760..243362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02970"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23994"
FT                   /db_xref="GOA:F8AGM3"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR029349"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGM3"
FT                   /protein_id="AEH23994.1"
FT                   /translation="MGWKRGAYPEYTLEDAVGTIFLLKELLGRKQISELLDLGEGSVRT
FT                   LLRKLTSNGLIGSKQRGHFLTKKGEALREELLKEFSEPVPLPSVDGYPACGIVIRRPGP
FT                   FKSLELRDEAIRFRARGALILLMKDGKIVFPEDERPLADTYPELDAEIMRRLSPEGGDL
FT                   VVVTWADEPPWAFKSAIHVALFLKGGKIPGELKEVIR"
FT   gene            243481..244533
FT                   /locus_tag="PYCH_02980"
FT   CDS             243481..244533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02980"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23995"
FT                   /db_xref="InterPro:IPR002723"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014435"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGM4"
FT                   /protein_id="AEH23995.1"
FT                   /translation="MREIVEKVKTKTRIPVYERSVENVLSAVLASDDIWRIVDLSEEPL
FT                   PLVVAILETLNELGYVSFEDGVKLTERGLSFLEEMGIGKRVDYTCTHCAGKTVDLNPFS
FT                   DLLEQFKEITKDRPQPKHEFDQAYVTPETTIARVVLMHIRGDLENKEVFVLGDDDLTSI
FT                   ALMLSGLPKRIAVLDIDERLTKFIERVADEIGYNDIDIFTFDLRKPLPDYALHKFDTFI
FT                   TDPPETIEAIRAFVGRGIATLKGPRCAGYFGITRRESSLDKWREIQRLLINEFNVVITD
FT                   VIRNFNEYVNWGYAEETRAWRLIPIKSLPKHNWYKSYMFRIETLEGSRGFEDEITVGSE
FT                   LYNDEEASTT"
FT   gene            244589..245326
FT                   /locus_tag="PYCH_02990"
FT   CDS             244589..245326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_02990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_02990"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23996"
FT                   /db_xref="GOA:F8AGM5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017271"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGM5"
FT                   /protein_id="AEH23996.1"
FT                   /translation="MLEKEKETLAKRIAGEIVLSSDPGKTMRKWREIFGISQTELAEYL
FT                   GVSSSVISDYEGGRRKSPGASTIRKFVEALLEIDERRGGNVIKAFSRTLGSDFPTSAIL
FT                   DIREFAIPVTVRDVVEAVKGEIVANADLVDRRIYGYTVVDSIQAILEMSADEFLKLYGW
FT                   TTERALVFTKVTTGRSPMIAVRVQGLKPAMVVLHGVKNLDGLAVKIAEKERVPLVVSRA
FT                   ENEGELIARLRRLAGSVEERVIR"
FT   gene            complement(245319..246104)
FT                   /locus_tag="PYCH_03000"
FT   CDS             complement(245319..246104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03000"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23997"
FT                   /db_xref="InterPro:IPR002855"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGM6"
FT                   /protein_id="AEH23997.1"
FT                   /translation="MVRIPKSHPRYWSLLYREKIIESMEEGITAKAGLIAHGRGEAFDY
FT                   LIGERTIEPAERAMKVAVAKLLLAEYPVISVNGNVAALVPRETVELAKAVNAKLEVNLF
FT                   YRTEERVRKIAALLKEHGAGEVLGLNPTKKIPGLESERGKVDENGIWKADVVLVPLEDG
FT                   DRTEALVRMGKFVITVDLNPLSRSARMAHVTIVDNIVRAYPRMIELAREMRDYDRKELE
FT                   KIVKEYDNERTLSDVLRHIRDRLTRLAEEGIWRRERLVT"
FT   gene            complement(246104..246571)
FT                   /locus_tag="PYCH_03010"
FT   CDS             complement(246104..246571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03010"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23998"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGM7"
FT                   /protein_id="AEH23998.1"
FT                   /translation="MFKFLRRKQRRKGPLVYLSEPTILYHTKTEKAILEIIEEKLGSTN
FT                   VIVPSDYGLRDVSHRIREAEYLVAVAPLGKFTTLVCREVKKARGLGVKVYTLTVARKDN
FT                   ELLYLFEEGVPDHIEWLDEKETREFLNEFLGSEFMDTAFRGFFLGSRRREW"
FT   gene            complement(246678..247265)
FT                   /locus_tag="PYCH_03020"
FT   CDS             complement(246678..247265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03020"
FT                   /product="uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03020"
FT                   /db_xref="EnsemblGenomes-Tr:AEH23999"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGM8"
FT                   /protein_id="AEH23999.1"
FT                   /translation="MSSKEELMKRLEERIQTCKKCLLGNLRTNAVPGSGSYDAKVMFVG
FT                   EAPGYWEDQKGLPFVGKAGKVLDELLSMIGLRREDVYITNIVKCRPPNNRDPREEEIRA
FT                   CSPYLDMQIDIIRPRVIVPLGRYSMSYILRKFGFEPEPISRVHGKVYEASTLFGRVYIM
FT                   PVYHPAVALYKPQLREELKRDFLKLKELLSRA"
FT   gene            complement(247271..247630)
FT                   /locus_tag="PYCH_03030"
FT   CDS             complement(247271..247630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03030"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24000"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGM9"
FT                   /protein_id="AEH24000.1"
FT                   /translation="MPAREMRMEMFLRALLRRDFDKAKAHLDKLQKVVGDDEWGRGYSK
FT                   AINGFMSALKDGDSDALIVKLINEPNPDEIRKLLKRFEDIKTQEFRDDYERGYYTAWVE
FT                   LLQAYLSQKTLTGSR"
FT   gene            complement(247641..248444)
FT                   /locus_tag="PYCH_03040"
FT   CDS             complement(247641..248444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03040"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24001"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGN0"
FT                   /protein_id="AEH24001.1"
FT                   /translation="MKVGVSIYPHFISGTKSLPSILAEVKIKDYDFVQIFPHALGLIKN
FT                   GTVVENHLGDIETALRGVGIDYIVRMPVSVNLRDSVYYSRHFKVAKATLDVAIKLGAKI
FT                   IVMQSGKTGRLDLEIEAIQSLADIASKFDIRIALENTFSVKDTLYVIDNVNRENVGFAL
FT                   DVAHAFLSAQGDENKLLEDVKLGVEKTILLMVHDNFGKMFPQVEPEDALAYGVGDLHLL
FT                   PGEGKIPFGKVLRLFDDVPILLKVKDRKTFESLPMKAELVEKLKK"
FT   gene            248529..248638
FT                   /locus_tag="PYCH_t225"
FT   tRNA            248529..248638
FT                   /locus_tag="PYCH_t225"
FT                   /product="tRNA-OTHER"
FT   gene            248694..249734
FT                   /locus_tag="PYCH_03050"
FT   CDS             248694..249734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03050"
FT                   /product="NAD(P)-dependent glycerol-1-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03050"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24002"
FT                   /db_xref="GOA:F8AGN1"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR023002"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGN1"
FT                   /protein_id="AEH24002.1"
FT                   /translation="MHLIEFPREVLLGENLKSEVKNVARRLNLGERVLVLYGPKTKEIA
FT                   GKEVELDLKDAFDVHSLTVWGPYMKEVEKVEKKILDLAIEWVVAVGGGSIIDVAKLASF
FT                   RANVPFVSFPTTASHDGIASANASIKDLGAKTSVKARPPIAVIADVRVIKTAPHRYLAA
FT                   GVGDVISNITAVRDWKLAHKIKGEYFSEYAAALSLMSAKMVMKNADVIRLGNEDAVRKV
FT                   VKALISSGVAMSIAGSSRPASGAEHLFSHALDMLASKPALHGEQTGVGTIIMAYLHGIN
FT                   WRKIREALKRVGAPTNAYELGIDPEIIVEALTIAHTIRPERYTILGRDGLTKEAARRAA
FT                   EITGVI"
FT   gene            249751..250176
FT                   /locus_tag="PYCH_03060"
FT   CDS             249751..250176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03060"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24003"
FT                   /db_xref="InterPro:IPR005369"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGN2"
FT                   /protein_id="AEH24003.1"
FT                   /translation="MVITLVGEKLAKPGLEFIYYGPAEPCKTCRLARVCTGNLEPGRRY
FT                   KIVRVRNIEHPCPLHEGKVRVVEVVEPAIEVAVEPRLAIVGSKIKLSFVDCDDPEKAEL
FT                   VRPEGLFEGDTVKILDIVGEFECRGRTYKIVKVMREG"
FT   gene            complement(250178..252067)
FT                   /locus_tag="PYCH_03070"
FT   CDS             complement(250178..252067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03070"
FT                   /product="arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03070"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24004"
FT                   /db_xref="GOA:F8AIQ8"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIQ8"
FT                   /protein_id="AEH24004.1"
FT                   /translation="MLERLKGEVGKAVADVVRELAPGWEGRIEFADTPSPEMGDFGTAV
FT                   AFQLARVLRKAPKLIAEELAERLRDRLPEGIREVRAVNGYINFFIDYGAFARALIREIL
FT                   TKGDRYGEGIVGRGRKVIVEHTSVNPTKPLHMGHARNAVLGDTMARIMRFLGYEVEVQN
FT                   YIDDLGVQFAQVYWGYLNLREEFERIMAELKEKGLKKNPIDHALGLLYVEVNRRLEENP
FT                   ELEGQIRALMKQLEEGNEEGRKLAEEVVRAQLETTRRLGIEYDLLSWESDIMRSGIFEE
FT                   AMEMLQGNENFYTPEEGKYKGAFVMDLRKLFPDMKNPFLVLVRSDGTATYTGKDIAYHL
FT                   WKFGKVKADMLYKPWDGKTWTTAPDGKEMPGRFGRADVVINVIGAEQRHPQMAIKYALQ
FT                   LLGFEESAENFHHLAYEHVVRPEGKFSGRKGTWVGFTVDEVLDEAVKRARELVEEKNPN
FT                   LSEEEKWEIAEKVGVGAIRFNLLKYSPDKVITFRWEDALNFEGESAPYVQYAHARCASI
FT                   LRKAEEGGLNIEWESLLQRADFSKLTEKERELLMLLAKFPEVVETAGKDVRPHLLAWYA
FT                   NELASLFNKFYMDHPVLRAEKGVREARLLLVMAVKQVLRNVLWLMGIEAPERM"
FT   gene            complement(252078..253148)
FT                   /locus_tag="PYCH_03080"
FT   CDS             complement(252078..253148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03080"
FT                   /product="cell division protein pelota"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03080"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24005"
FT                   /db_xref="GOA:F8AGN3"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR023521"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGN3"
FT                   /protein_id="AEH24005.1"
FT                   /translation="MEILEENPKEGKVKLKVETLDDLWHLYHIIDEGDVVYAKTLRKQS
FT                   QRSDSLRPEKVEAVPVFLGVRAEKINLHRFVNQLRVTGPIVYASRDDVPLGRYHTIAIE
FT                   PGTVITVQKEMWKAHHIERLREAVEASKRARMMIVALEDGEAEIAVMREYGLDFMATVR
FT                   HNLSGKRYNSKREDEEMKFFHDLAKTMLEIMERENVERAIVAGPGFTKENFAAFLRENY
FT                   SELAKRIVLDDVSTGGRTGVYEVIKRGTVDKVYRENRVAKEVRLVERVIEEIAKNGPVA
FT                   YGLREVEEAVNYGAVETLLVLDELLKGDMRAKVEELMETARNLRANVVVVSGEHEGGDK
FT                   LRALGGIAALLRFKIR"
FT   gene            complement(253153..253515)
FT                   /locus_tag="PYCH_03090"
FT   CDS             complement(253153..253515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03090"
FT                   /product="ribonuclease P protein component 2"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03090"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24006"
FT                   /db_xref="GOA:F8AIQ9"
FT                   /db_xref="InterPro:IPR002759"
FT                   /db_xref="InterPro:IPR016434"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIQ9"
FT                   /protein_id="AEH24006.1"
FT                   /translation="MREKPKTLPPTLRDKHRYIAFQIIGERPLKRNDVKRLIWEASLRV
FT                   LGELGTAEAKPWFIDFDEESQTGIVRCDRNHVERIRFALALITEFNGTRLIVRTLGVSG
FT                   TIRRLKRKFLSEFGWR"
FT   gene            253648..254550
FT                   /locus_tag="PYCH_03100"
FT   CDS             253648..254550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03100"
FT                   /product="transcription initiation factor IIB"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03100"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24007"
FT                   /db_xref="GOA:F8AGN4"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023484"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGN4"
FT                   /protein_id="AEH24007.1"
FT                   /translation="MNKQRVCPVCGWTEFIYDPERGEIVCAKCGYVVEENIIDMGPEWR
FT                   AFDASQRERRSRTGAPESILLHDKGLSTDIGIDRSLTGLMREKMYRLRRWQSRLRVSDA
FT                   AERNLAFALSELDRITAQLKLPKHVEEEAARLYREAVRRGLIRGRSIESVIAACVYAAC
FT                   RLLKVPRTLDEISDISRVDKKEIGRSYRFIARNLNLTPKKLFVKPTDYVNKFADELGLS
FT                   EKVRRKAVEILEEAYRKGLTSGKSPAGLVAAALYIASLLEGEKRTQREVAEVARVTEVT
FT                   VRNRYKELVEKLGIKVPIA"
FT   gene            complement(254555..255580)
FT                   /locus_tag="PYCH_03110"
FT   CDS             complement(254555..255580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03110"
FT                   /product="flap endonuclease-1"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03110"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24008"
FT                   /db_xref="GOA:F8AGN5"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019973"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR023426"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGN5"
FT                   /protein_id="AEH24008.1"
FT                   /translation="MGVPIGELLPRKEIELENLYGKKVAIDALNAIYQFLSTIRQRDGT
FT                   PLMDSKGRITSHLSGLFYRTINLMEAGIKPAYVFDGKPPAFKKKELEKRREAREEAEER
FT                   WREALERGNIEEARKYAQRATRVNEALVEDAKKLLELMGIPVIQAPSEGEAQAAYIAAK
FT                   GAVYASASQDYDSLLFGAPRLVRNLTITGKRKLPGKDVYVDVKPELIVLEEVLKALKID
FT                   REKLIELAILVGTDYNPGGVKGIGPKKALEIVRHSKDPLAKWQKVSDVDLYAIKEFFLN
FT                   PPVTDNYELKWKEPDEEGILKFLCDEHDFSEERVKNGIERLKTAVKAGKQVTLESWFGK
FT                   K"
FT   gene            complement(255586..255939)
FT                   /locus_tag="PYCH_03120"
FT   CDS             complement(255586..255939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03120"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24009"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGN6"
FT                   /protein_id="AEH24009.1"
FT                   /translation="MALIGMAIYRMFFAIISGENLNAILDDFMLVIIFVEVYELLSLYL
FT                   KEHHVSMRRVAELGMMAIVRKLVITTDFRELGPYLLFGLAALVFALGWVYGKVGDDEPS
FT                   PHLISDEHTGRLR"
FT   gene            complement(256068..257048)
FT                   /locus_tag="PYCH_03130"
FT   CDS             complement(256068..257048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03130"
FT                   /product="dipeptide ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03130"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24010"
FT                   /db_xref="GOA:F8AGN7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGN7"
FT                   /protein_id="AEH24010.1"
FT                   /translation="MGEPVLKVENLKKYFPVRGLIRTIGWVKAVDGVSFEIDRGETFGL
FT                   VGESGCGKTTTGRTILRLIEPTDGKIIFMGKEVTKLKGEEMKWFRRKAQIMFQDPYSSL
FT                   NPRQTVFQIIMEPVRFHGIEVDDPEEFVVGLLKSVGLNEMHLYRYPHEFSGGQRQRIAL
FT                   ARILALKPEFIVLDEPTSALDVSVQANILNTLKELQEKHGFTYLFISHDLGVVKYMSDR
FT                   IGVMYLGKLVEVGPSDRIFENPLHPYTQMLLSAIPVPDPDIAREMKAKRQPIKGEPPSP
FT                   INPPKGCRFHPRCPFAKAGLCDGKEPTIVEAEKDHYVACWLYAKA"
FT   gene            complement(257060..258049)
FT                   /locus_tag="PYCH_03140"
FT   CDS             complement(257060..258049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03140"
FT                   /product="dipeptide transport ATP-binding protein dppD"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03140"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24011"
FT                   /db_xref="GOA:F8AGN8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGN8"
FT                   /protein_id="AEH24011.1"
FT                   /translation="MRRVPEPILQVRDLTVHFYTYAGIVKAIEKVSFDVYRGETFALVG
FT                   ETGCGKSVTSRALTQLIESPGRIVSGQVLYHKEDGSVVDLLKLKEEEIRQIRGNEIAYI
FT                   FQDPHASLDPLYTVGYQIAEAMGVHGKVKDIKEGIKRAIEILRSVLIPDPERRVKNYPH
FT                   ELSGGMKQRVVIGIGVANNPRILIADEPTTALDVTVQAQILDLLERMKEMYKATVILIT
FT                   HNLGVVAEIADRVAVMYAGKIVEIGSVDQIFKNPLHPYTQGLLRAVPNPMTKIEKLEAI
FT                   PGTVPNLINPPSGCRFHPRCPRVMSICKEKVPELKEMEPGHFVACHLY"
FT   gene            complement(258033..259184)
FT                   /locus_tag="PYCH_03150"
FT   CDS             complement(258033..259184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03150"
FT                   /product="dipeptide transport system permease protein dppC"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03150"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24012"
FT                   /db_xref="GOA:F8AGN9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGN9"
FT                   /protein_id="AEH24012.1"
FT                   /translation="MQEEYKKTILDKLADKLVYGLGKFISLFKKGWIEKNRSKLEEWRL
FT                   MLYALNRSPPALIGLFLVLIFIFLGIFGPYLAPWKYNFFPTLYTANYDQVYLVPPGSRA
FT                   TLEFYNNTVVYYPLGSDHYGRDLLSLILQGARTSFVISIIVIALGVPLGIILGLIAGYY
FT                   GGKIDELIMRITDMFLAFPALILAIAFSAVLPDRIQGFISAHPALQDFILALFALDQRE
FT                   AGNIGRLLAVIVAMIIVWWPGYARITRGSTLTEREKLYVEAARAIGLPSRTIMLRHILP
FT                   NIIGPILVYITLDFGGVVLMEAGLSFLGLGATPPIADWGRIVYDGAQYFPRCWWLVFYP
FT                   GLVVLLTALGWNLLGDGLRDILDPKTRRSIEFKVKKKEGEEGA"
FT   gene            complement(259195..260196)
FT                   /locus_tag="PYCH_03160"
FT   CDS             complement(259195..260196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03160"
FT                   /product="dipeptide transport system permease protein dppB"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03160"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24013"
FT                   /db_xref="GOA:F8AGP0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGP0"
FT                   /protein_id="AEH24013.1"
FT                   /translation="MANLKKFLIRRMLTFIPTIIGVTLIVFLIAYKIPADPARAWAGGE
FT                   KASQEAIERIIREYHLDKPWYDQYIFLMKGLLTNSIIDPRTSNPVMTDISRRFPVTLQL
FT                   AIIAFTFMLIIGIPLGLISALKRNSWVDTLVRIFALLGVSTPAFWLGYLMIYVFFVKLR
FT                   VTTLAGVPPTPATQITHVPMIDALLTGDFALFKQHLARFWLPGFTLGFLGMGVVARFVR
FT                   NSFLEALSSDFVQFLKAKGVPKMRVYRHALKNALVPIVTVLGLQFGGLLGGTPITETVF
FT                   SLPGMGRYAVQAIQNLDFPVVIAVTFIYAIIYVTTNLIVDILYAIIDPRVRY"
FT   gene            complement(260272..262392)
FT                   /locus_tag="PYCH_03170"
FT   CDS             complement(260272..262392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03170"
FT                   /product="dipeptide transport system permease protein dppA"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03170"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24014"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGP1"
FT                   /protein_id="AEH24014.1"
FT                   /translation="MKRTIFSLLLVSVLIFGTIASGCIGGGETGTTTTAPRPTQTGPTE
FT                   TQPQGVTQAILELDKVAVIDTGTAIVVVGPKGEEPTVSIPSGKKVIRVTYVVDEANTPD
FT                   VKTLMEQGQGFGAINPAFFRETHVDALVIAARRETQPEIRTELFKALYILGNYYVPEVI
FT                   LGQNRQLRVYWDWVKGRYYHPTLPERYDLLWEDPNAPSVDTGIGSYKNDAETLVIGTIG
FT                   WPESFDPAWTYETFGWEIWHEIGDTLVTYWKEETEHVTPDLAVAWAHNKEGTEWYFVIR
FT                   GGVVAYDPWNEKTYPIDAVDVLFTFWRVQRLGHSVSWMVAEFMDVSASQALTEEEFNNY
FT                   LKDHPLIAEYNGKTKEIRSLDELLQFFGYSGKTAGVFKLVLPHPYAAILNIVADPFLSV
FT                   VPMEYLLGDKYEEALKASNYGKNPDAWADYVKEGADDATHQLMHRQPVGTGPFYVKDYQ
FT                   ENSYIVLEYNPYYWNATANPGHKRVIYIINDDAVSRVNLFLTGTVDIVALPTEKIEDVK
FT                   GKTLGNYKVVVQTELLQPILTFIVFNTQREPFNNVKVRQALAYAIPYDQIANVVYNGLL
FT                   ERNWGPIPKPWPGYTEYGIIKYDYNLAKAKQLLQEAGIDPSKYSIKLYYNAGNSQREKI
FT                   MTLLQNIWSQLGFQVTVESYEWPVYLQKTSHGDYDVYVVGWVPDYLDSDNWVGPFLYGA
FT                   TKFKEVNIEVSG"
FT   gene            complement(262615..263325)
FT                   /locus_tag="PYCH_03180"
FT   CDS             complement(262615..263325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03180"
FT                   /product="uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03180"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24015"
FT                   /db_xref="GOA:F8AGP2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR011818"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGP2"
FT                   /protein_id="AEH24015.1"
FT                   /translation="MRVVFDIGGSVLVPDEPDVDFISRVAYELTKVSEEHEVAVVVGGG
FT                   RTARKYIMAAGKLGANETFKDYLGILVTRANALLLIAALRERAYPKVVEDFREAWRIIQ
FT                   LKKIPVMGGTHPGHTTDAVAALLAEFLNADLFVIVTNVEGVYDSDPKKNPEAKKIPKMR
FT                   ASELVEIVARAEGKAGESTVVDLLAAKVIQRSGIRTYIVGREDALRLFDVIKGKHSGTV
FT                   IEPDPAPFVDNHRQ"
FT   gene            complement(263373..263459)
FT                   /locus_tag="PYCH_t00"
FT   tRNA            complement(263373..263459)
FT                   /locus_tag="PYCH_t00"
FT                   /product="tRNA-Ser"
FT   gene            complement(263471..263779)
FT                   /locus_tag="PYCH_03190"
FT   CDS             complement(263471..263779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03190"
FT                   /product="30S ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03190"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24016"
FT                   /db_xref="GOA:F8AGP3"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGP3"
FT                   /protein_id="AEH24016.1"
FT                   /translation="MQKARIKLASTNVRSLDEVANQIRQIAERTGVRMSGPIPLPTKRI
FT                   RITTRKSPDGEGSATFDRWELRIHKRLIDIEADERAMRQIMRIRVPEDVTIEIELIS"
FT   gene            complement(263816..265102)
FT                   /locus_tag="PYCH_03200"
FT   CDS             complement(263816..265102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03200"
FT                   /product="elongation factor 1-alpha"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03200"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24017"
FT                   /db_xref="GOA:F8AGP4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004539"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGP4"
FT                   /protein_id="AEH24017.1"
FT                   /translation="MPKEKPHVNIVFIGHVDHGKSTTIGRLLYDTGNIPETIIKKFEEM
FT                   GEKGKSFKFAWVMDRLKEERERGITIDVAHTKFETPHRYITIIDAPGHRDFVKNMITGA
FT                   SQADAAVLVVAATDGVMPQTKEHAFLARTLGINHIIVAINKMDMVNYDQKVYEKVKAQV
FT                   EKLLKMLGYKDFPIIPISAWNGDNVVKRSDKMPWYNGPILIEALDQIPEPPKPVDKPLR
FT                   IPIQDVYSIKGVGTVPVGRVETGKLKVGDVVIFEPASTIFHKPIQGEVKSIEMHHEPLQ
FT                   EALPGDNIGFNVRGVSKNDIKRGDVAGHTDKPPSVVRTKDTFKAQIIVLNHPTAITVGY
FT                   SPVLHAHTAQVPVRFEQLLAKLDPRTGNIVEENPQFIKTGDSAIVILRPMKPIVLEPVK
FT                   EIPQLGRFAIRDMGMTVAAGMVMSIQKAE"
FT   gene            265377..266126
FT                   /locus_tag="PYCH_03210"
FT   CDS             265377..266126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03210"
FT                   /product="lipoate-protein ligase a related protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03210"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24018"
FT                   /db_xref="GOA:F8AIR0"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIR0"
FT                   /protein_id="AEH24018.1"
FT                   /translation="MRFVPLIVARPEVQMAIDEAIFRARIEGKVPDTVRLYVFKPSSVT
FT                   IGRFQSIRHDVDIERARDLGIPVVRRITGGGSVFHDEYGEITYSVIIGEDYHPSLRNVQ
FT                   ESYRYLAGPLIDALKELGLNAEFSGLNDVVVRGKKISGSAQTRAKGVILQHGTFMYATR
FT                   LDVLASVLKVSREKLKDKGVSSIYERVTTLEREGVRLSRSEAYELLKESFFRAFPLEEA
FT                   PLTDYELELAERLVEERYGNPNWNLSK"
FT   gene            complement(266119..266979)
FT                   /locus_tag="PYCH_03220"
FT   CDS             complement(266119..266979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03220"
FT                   /product="cobalt/zinc/cadmium cation efflux pump protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03220"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24019"
FT                   /db_xref="GOA:F8AGP5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGP5"
FT                   /protein_id="AEH24019.1"
FT                   /translation="MEEAYKPIAVSIVGNLLLAALKIAVGIISSSIALISDGIHSLSDL
FT                   VTSVIGFVGIRISKKPPDSTHPFGHSRFEPLFAFFMGELLLLAAYEIGRDSLERIIRGV
FT                   PIEVTPVMIGVALISILLKEAMTQYTLAVGKRLNNSILIADAYHHRSDVLSTVAVLIGL
FT                   ILEKGGMAWGDGVAGVIVSLFIAKVAIEIILENVHYLTGKAPPLEVCKKIEEAALSVPN
FT                   VLGVHDLRAHYVGSRLHVELHIEVPPMMTLKEAHDISEEVKKKIERLPEVEVAFVHVDI
FT                   KGVTT"
FT   gene            complement(267126..267639)
FT                   /pseudo
FT                   /locus_tag="PYCH_03230"
FT                   /note="Sugar fermentation stimulation protein / fragment"
FT   gene            267765..268190
FT                   /locus_tag="PYCH_03250"
FT   CDS             267765..268190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03250"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24020"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGP6"
FT                   /protein_id="AEH24020.1"
FT                   /translation="MRLRIPAELLEEIVSAASESNVEVCGFLFGERRGDEWVVRKVTFV
FT                   KNRLNSPTAFEMEPEDMVKALDDAEKENLEVVGIFHSHVSCPPRPSSKDVKGMTLWPVP
FT                   WLIVTGHKVAAFMLEKGKPKEIELKIISRCQSSRTLP"
FT   gene            complement(268156..268395)
FT                   /locus_tag="PYCH_03260"
FT   CDS             complement(268156..268395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03260"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24021"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGP7"
FT                   /protein_id="AEH24021.1"
FT                   /translation="MTEIRHYKIGEDRFKISEDEVARRELKVTKVADDVIQIQEEIHGI
FT                   IALVGATSTVNIKKDELKELIKIVREEFGWTDIC"
FT   gene            268512..268587
FT                   /locus_tag="PYCH_t05"
FT   tRNA            268512..268587
FT                   /locus_tag="PYCH_t05"
FT                   /product="tRNA-Asn"
FT   gene            268592..268669
FT                   /locus_tag="PYCH_t10"
FT   tRNA            268592..268669
FT                   /locus_tag="PYCH_t10"
FT                   /product="tRNA-Met"
FT   gene            complement(268669..269421)
FT                   /locus_tag="PYCH_03270"
FT   CDS             complement(268669..269421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03270"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24022"
FT                   /db_xref="GOA:F8AGP8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGP8"
FT                   /protein_id="AEH24022.1"
FT                   /translation="MLLYASLTSLTVFTFAVLVKKPKGWNSLRKNLQSAILGFLNPFLY
FT                   YLVLFNAYSILPAQEAQALNYTWPLILTVFAWLFLSQPLRVRGIFGVFMGFLGALIVSS
FT                   KGSIGSLSLSNILGDLLALSSALIWASYWVLNLRDGRKAEVKMFWNFLFGSLYILTYVA
FT                   WRGKLVLDALGIIGSVYVGLFEMGVTFLLWLRALEKEEASKVAGLVYLTPVLSLFFITT
FT                   IVREPLRASTIVGLALILMGARIARGRG"
FT   gene            269420..269539
FT                   /locus_tag="PYCH_03280"
FT   CDS             269420..269539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03280"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24023"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGP9"
FT                   /protein_id="AEH24023.1"
FT                   /translation="MLAGLILERVSLNAEATVDQRRIASRALWFMGENRERSF"
FT   gene            complement(269629..269829)
FT                   /locus_tag="PYCH_03290"
FT   CDS             complement(269629..269829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03290"
FT                   /product="50S ribosomal protein L24e"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03290"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24024"
FT                   /db_xref="GOA:F8AGQ0"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR023438"
FT                   /db_xref="InterPro:IPR023441"
FT                   /db_xref="InterPro:IPR023442"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGQ0"
FT                   /protein_id="AEH24024.1"
FT                   /translation="MARWNICSYCGKPFEPGTGKMFVRNDGRVFFFCSRKCERYFFMGR
FT                   NPRKLKWTKAYQEARLQRGKK"
FT   gene            complement(269835..270050)
FT                   /locus_tag="PYCH_03300"
FT   CDS             complement(269835..270050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03300"
FT                   /product="30S ribosomal protein S28e"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03300"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24025"
FT                   /db_xref="GOA:F8AGQ1"
FT                   /db_xref="InterPro:IPR000289"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR028626"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGQ1"
FT                   /protein_id="AEH24025.1"
FT                   /translation="MAEDEGYPAEVIEIIGRTGTTGDVTQVKVRILEGRDKGRVIRRNV
FT                   RGPVRVGDILILRETEREAREIKSRR"
FT   gene            complement(270093..270464)
FT                   /locus_tag="PYCH_03310"
FT   CDS             complement(270093..270464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03310"
FT                   /product="50S ribosomal protein L7Ae"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03310"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24026"
FT                   /db_xref="GOA:F8AGQ2"
FT                   /db_xref="InterPro:IPR000948"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="InterPro:IPR022481"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGQ2"
FT                   /protein_id="AEH24026.1"
FT                   /translation="MAKPSYVKFEVPKELAEKALEAVEIARDTGRIRKGTNETTKAVER
FT                   GQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEP
FT                   GKAKELVEEIAMKVRELMK"
FT   gene            270573..271169
FT                   /locus_tag="PYCH_03320"
FT   CDS             270573..271169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03320"
FT                   /product="Peptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03320"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24027"
FT                   /db_xref="GOA:F8AIR1"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIR1"
FT                   /protein_id="AEH24027.1"
FT                   /translation="MGANLRNLVKYFPATAGLLTIIALVFIYELIVGFDTAIVQLAQIN
FT                   LLVFYAGQWWRLVTAIFVHMGFIHFALNTFWLFYLGMDLEGIVGSKRFLLVFFLSAIVG
FT                   NVLSLFTLPLDVASGGASGGLFGIVGASLAIEGVLKRNMQKALMNAIILFLINSIFPGV
FT                   NIVAHFGGLAAGLALGYIYGRWLRRKLMDMSYWFE"
FT   gene            complement(271170..271874)
FT                   /locus_tag="PYCH_03330"
FT   CDS             complement(271170..271874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03330"
FT                   /product="endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03330"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24028"
FT                   /db_xref="GOA:F8AGQ3"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGQ3"
FT                   /protein_id="AEH24028.1"
FT                   /translation="MGKRGSGSLSPEGFAFEESWAEKKRRAEEIVRILKEVYPRERHVS
FT                   GEPYRTLIKCIISQRNRDEVTDRVAEELFRKYPTINDIANASVEKMQEFLRSLKVGLWR
FT                   SKGRWIVEVSRIILERYDGRVPDTLEELMKLPGIGRKCANIVLAYGFGKPAIPVDTHVN
FT                   RVSKRLGLAPLEASPEKVEEYLKVLIPKEEWLYVNHAMVDHGKKVCRPIKPKCNECPVR
FT                   NLCPKVGIKFGT"
FT   gene            complement(271840..272271)
FT                   /locus_tag="PYCH_03340"
FT   CDS             complement(271840..272271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03340"
FT                   /product="Cell division protein 48 (CDC48), domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03340"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24029"
FT                   /db_xref="GOA:F8AIR2"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIR2"
FT                   /protein_id="AEH24029.1"
FT                   /translation="MRLVLKPLFDVELPVGFEDILRAKLKGRVVKTGQEIEVDLLGKPL
FT                   RFQVLYAEPEPLIVNDRTRVEITGGDTFILDIEFDEPVKGVIPFEKGFVIVFPKKVLIL
FT                   NQNGQKIYSDEFEELNEVSVSGDVVVIVHGEKRVRLIKP"
FT   gene            complement(272272..272718)
FT                   /locus_tag="PYCH_03350"
FT   CDS             complement(272272..272718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03350"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03350"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24030"
FT                   /db_xref="GOA:F8AGQ4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGQ4"
FT                   /protein_id="AEH24030.1"
FT                   /translation="MLDELDRGILQILQEDGRVSYAEIARKLGVPESTVRLRVRKLVER
FT                   GVIRKFAALINPFKAGYEVVAVIAVDTEPSKVKKVAEELAKLPEVDVLGIATGAHDIFM
FT                   QVTVRSLRELEEFLIEKLGKIDGVKSTETSILTSVKKWGYARVF"
FT   gene            272837..274168
FT                   /locus_tag="PYCH_03360"
FT   CDS             272837..274168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03360"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03360"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24031"
FT                   /db_xref="GOA:F8AGQ5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGQ5"
FT                   /protein_id="AEH24031.1"
FT                   /translation="MDPEEVVAGYERVIAPANRTTYFPLVPVRAENARIWDVKGREYID
FT                   FLSDAAVQNVGHNNPRIVMAIKEQAERLLHASFIYAFPIEPLLLAEKLVQLVPIRNAKV
FT                   SFGLSGADANDGAIKFARAYTGRLTILSYMRSFYGSTYGAMSITGLDFHVRALVGELSG
FT                   VHYIPFPNCYRCPFGKESGKCRFECVEYLKEKFEGEVYAEGVAALFAEAIQGDAGMVVP
FT                   PENYFKRIERILDEHGILLVVDEIQSGLGRTGKWFAIEHFGVEPDIITVAKPLGGGLPI
FT                   SATIGRAEIMDALPPLSHAFTLSGNPTAARAALAVIEEIEEKDLVKRAERLGEKAKRRL
FT                   ERMKARHELIGDVRGLGLMLGVELVKDRETKERALDETKKVVWRAFELGLIVAFLQGNV
FT                   LRIQPPLTIEEELLEEGLERLEEAIEDVEAGKVPDDVVKKVRGW"
FT   gene            274320..274775
FT                   /locus_tag="PYCH_03370"
FT   CDS             274320..274775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03370"
FT                   /product="transcriptional regulator, PadR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03370"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24032"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGQ6"
FT                   /protein_id="AEH24032.1"
FT                   /translation="MERPRLRGYLKLLILHMLRENPMHGYAIMSELEKRYGIPGPSAGA
FT                   VYPVLSELKRLGLIEVTGQGKREKKVYSITQEGFEFLEENKGKLEEILRKVEAYKEFSK
FT                   LGGRELAKTMKELLEKLPEMSEEEKEKIREEILEFTRKIRLILLGGD"
FT   gene            274776..275762
FT                   /locus_tag="PYCH_03380"
FT   CDS             274776..275762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03380"
FT                   /product="ABC-type multidrug transporter, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03380"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24033"
FT                   /db_xref="GOA:F8AGQ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGQ7"
FT                   /protein_id="AEH24033.1"
FT                   /translation="MYAIEVENLVKKYGDFEAVRGISFKIKRGEIFAFLGPNGAGKTTT
FT                   VHVLTTLLRPTSGRAIVAGHDVVEEPMEVRRKIGIVFQDPSVDRELTAWENMYIHGRIY
FT                   GLGGRELRERIERLLKFVELWEFRDRPVKFFSGGMQRRLEIARALLHEPEVLFLDEPTI
FT                   GLDPQTRAKIWEYIRTMKEEHDMTIFLTTHYMDEAEQLADRIAIMDHGKIIAEGAAEEL
FT                   KKLVGNDIIYLRLESPEEELKRLKAEFIRGCKLLPDGRVRLDVENAAEALPKLFELAQR
FT                   SGVKILEVTYHRPTLNDVFLHLTGREIRDEGSDGNVARMIMRARMRR"
FT   gene            275768..276535
FT                   /locus_tag="PYCH_03390"
FT   CDS             275768..276535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03390"
FT                   /product="ABC type transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03390"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24034"
FT                   /db_xref="GOA:F8AGQ8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR005942"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGQ8"
FT                   /protein_id="AEH24034.1"
FT                   /translation="MRVLTTMIYRELKRFLHSRARVVGSLLNPLIWLIFFGKGWAGAFK
FT                   FPGANMLFGGVDYMTFMVPGIVAMTVFNMGFMQGITLIWDRQFGFLKELLVAPASRVEA
FT                   IIGRSVGGALMAIIQGTIILALSFLIVDGLKLSGVFPTLALAFLVGVAVSGLGMAIGMR
FT                   MTTMEGFQIIITMLMLPMTFLSGAFYPVSTMPDWMQFLAKLNPLTYAVDGARYYLAGIE
FT                   PTFGIATDWAVLSTLAVVFVGIAALEFRKATID"
FT   gene            complement(276595..279756)
FT                   /locus_tag="PYCH_03400"
FT   CDS             complement(276595..279756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03400"
FT                   /product="translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03400"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24035"
FT                   /db_xref="GOA:F8AGQ9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004544"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR028992"
FT                   /db_xref="InterPro:IPR029459"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGQ9"
FT                   /protein_id="AEH24035.1"
FT                   /translation="MKRIRQPIIAVLGHVDHGKCLLPEERVVVPGLGSLTLEELFEIAD
FT                   EIVERDDEKEIRKLRIPLTAVDGNGAIAMVEGSYVWRLRHRGKIVRVKLKNWHSVSVTP
FT                   EHPFLTTRGWKRADQLKPGDYVAVPRYIHGNESRERFMAFVYSKLSKRDGRYARLPRSD
FT                   DEWRAFFYFAGVMFGDGSQKVTNDYAEVFERLESIEKLGVELKLLRVLFDYSDGIPDVL
FT                   FLAPKDYVAEFLRGYFDVHGSLEDDRVEVTGASREFIEGLSLVLLRFGIVSKIYRSGYT
FT                   TLVISGRRNLDAFRRHIGFTVREKAEMLKRAIDKSRGSEAYPIFEELKRLRLLFGFTRA
FT                   ELDSEVPFYSKYEESEAPSYETLMQILDAIERGSPTLAKKIAVLEGRAKDVNYLKALER
FT                   DGLIKDGHLTELGRELLEVWRNREFDSRDVEYVRNIAESLVFIPVEAVEELDYDGYVYD
FT                   LTTETHNFIANGVLVHNTTLLDRIRKTNVAAKEAGGITQHIGATEVPIEVVKKIAGPLI
FT                   KLWKAEIKLPGLLFIDTPGHEAFTSLRARGGSLADLAVLVVDINEGFQPQTIESIEILR
FT                   RYKTPFVVAANKIDRIRGWVIEEDEPFLVNIKKQDQRVVQELETKLWELIGKFYEMGFQ
FT                   ANRFDRVQNFTRELAIVPISAKYGIGIPELLVLIAGLSQKYLEEKLRIEVEGPGRGTIL
FT                   EVREEPGLGTTIDVIIYDGTLRKDDIIVVGGKDKAIVTKIRALLKPKPLDEIRDPRFRF
FT                   DQVEEVTAAAGVKIAAPDLEEALAGSPVIAARTEEEIERAKQEILSQIQSVVISTGKVG
FT                   VIVKADTLGSLEALSKELQEKNIPIRKADVGNISKTDVMEALSVKEEEEKYGVVLGFNV
FT                   KVNEDAEEVAKAKGVPIFVGNVIYKLIEDYEAWMKAEEEKKKRELLSRVTFPGVIRLYP
FT                   DERYVFRRSNPAIVGIEVLEGRIKPGVTLIKQNGQKVGVIKSIKSRDEFLQEARKGQAV
FT                   AIAIEGAIVGRHIHPGEILYVDIGRDDAIILLKQLRSELEDTDIKALKMTAEVKAKEDP
FT                   FWRAI"
FT   gene            279819..280007
FT                   /locus_tag="PYCH_03410"
FT   CDS             279819..280007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03410"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24036"
FT                   /db_xref="InterPro:IPR026486"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGR0"
FT                   /protein_id="AEH24036.1"
FT                   /translation="MALKLQTAVPPEELGEIKKRAGANVELRVLGKDGRLWVVEVLGSS
FT                   GELQKFMEKLRLARAGG"
FT   gene            280076..280690
FT                   /locus_tag="PYCH_03420"
FT   CDS             280076..280690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03420"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24037"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGX9"
FT                   /protein_id="AEH24037.1"
FT                   /translation="MEEVRELKEVLERVEGKLIAAGKIYAAINFAFWLLVMAIYYVVIG
FT                   LTELPGWANGLYWGSAVVVAIFFIGKVWGRFVKLYRAVEKGGEIGRAWILPIVASWMIG
FT                   SVIGWGIIPRTSMAVNETARLAVGFLTFIGISLLGQWLVLTGGHWREREMIPSFLLPLL
FT                   AVPIAWKMENGAIVWAGFVVTVGFTATVLLYLYSAFRAIER"
FT   gene            280695..280946
FT                   /locus_tag="PYCH_03430"
FT   CDS             280695..280946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03430"
FT                   /product="Transcription regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03430"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24038"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR027395"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGY0"
FT                   /protein_id="AEH24038.1"
FT                   /translation="MEALMLYLLLREKALFKELLDVLEVTPGNLDSHLKALERAGYVKL
FT                   YKVFADRPRTAVRITGKGTEETLRYLRVLRSVVERLEG"
FT   gene            complement(280897..281541)
FT                   /locus_tag="PYCH_03440"
FT   CDS             complement(280897..281541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03440"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24039"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGY1"
FT                   /protein_id="AEH24039.1"
FT                   /translation="MVETREETVIKASIFVVLLGLITGIVYGRTDHIYRSTTALIGLSL
FT                   PLLLPRFWKPPEKLEPFVRPLYNRGTIAVLAVFIAVHVSLVNVPFTTIDLFHKEWRDAD
FT                   MISHFLGGLTTWLITAEILTGLNDTWFRLERKKLILYSFIVFFALSVAWEVAEKLSESQ
FT                   ISFIRETPANKGRDLVMNTLGALFGLWMVEKREYPFSLRAFQLRSSEPSDT"
FT   gene            complement(281652..282041)
FT                   /locus_tag="PYCH_03450"
FT   CDS             complement(281652..282041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03450"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24040"
FT                   /db_xref="GOA:F8AGY2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGY2"
FT                   /protein_id="AEH24040.1"
FT                   /translation="MRVVVTARNTRELLRKLDEMLGEDVTEVYINMRPTKEIIVRILEN
FT                   APNVRLIGCPPSLYPKVSKKVIRALEQMGIKLVPVERRRGRPRKYDEETVRRIQELIRS
FT                   GKTAREISETLGIPLRTLYYMISGR"
FT   gene            complement(282047..283294)
FT                   /locus_tag="PYCH_03460"
FT   CDS             complement(282047..283294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03460"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24041"
FT                   /db_xref="InterPro:IPR007503"
FT                   /db_xref="InterPro:IPR014496"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGY3"
FT                   /protein_id="AEH24041.1"
FT                   /translation="MPTTEELVARINKILDDIAIDTPGLFEDPDVPHIFFTLRSRLEVL
FT                   KELEEELERRVGDFGPIPVFKDKKSKDPHLSWLYRKRHYRVLTLERLRSAITAHKIALA
FT                   ILETSYSFRKGRSEVEPESLKGKDLGKIKVVEKSPRLARVDILPYLAYSGDVLKLLGQR
FT                   GLDVREHFKFIKGKLREEGTLRKESFRIEVEYWEGGKLKKERVELPVDADIEGELRKRF
FT                   GKRFRWRVLSYVKTVGVLINNHYTVDNLALAYSSLDPSRGAELLAMDLFRYYFLTSEKE
FT                   RETLTIYPGIRGCVDCHYSLFDLPFRGRKDFKVGFGSMLLIRKCEIERLLTRRRSEIAG
FT                   IPNYLLGGVILYAISPFNETEVSELLGIEEGELKEAIRKFVVSGLHESLFTNIEKFEKF
FT                   MPKSERAKKFLELLQG"
FT   gene            complement(283301..284449)
FT                   /locus_tag="PYCH_03470"
FT   CDS             complement(283301..284449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03470"
FT                   /product="DNA topoisomerase VI subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03470"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24042"
FT                   /db_xref="GOA:F8AGY4"
FT                   /db_xref="InterPro:IPR002815"
FT                   /db_xref="InterPro:IPR004085"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013049"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGY4"
FT                   /protein_id="AEH24042.1"
FT                   /translation="MRLKRGKPKEKFSYDPQKVLRKIEELGRRILEDVKAGKNPYFDVP
FT                   TRGLTNVYFDEEAKLIRMGDKLSRRYFLNVAHARKFMQTLLLMAYIKRLVSEGKHASLR
FT                   EAYYANKHTIPGTRENTFEDQSESDPIIEDLERMLGILREEMHITADRRGYVYGDIVIK
FT                   DGEDEFNASKLGMGGWAVPGTVEHIQFPEINVDYVLVVETAAMADRLIEEKYPKRERAL
FT                   IIATQGQASRGVRRLIHRLHYEEGLPIIVFTDGDPYGWYIYSTIKQGSINLAYLSEKLA
FT                   TPGAKFVGMTMDDIKEYGLENVTEKLKGIPPDKKGGPTGDYKRLIEELNYPWFQNKEWQ
FT                   RQLKLALKWGVRIEQQALANKSLEFVAKEYLPEKIREGKLLP"
FT   gene            complement(284439..286130)
FT                   /locus_tag="PYCH_03480"
FT   CDS             complement(284439..286130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03480"
FT                   /product="DNA topoisomerase VI subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03480"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24043"
FT                   /db_xref="GOA:F8AGY5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005734"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015320"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGY5"
FT                   /protein_id="AEH24043.1"
FT                   /translation="MAEAKDIFKEFKVQSVSEFFRRNAAMLGYTGKVRSLTTIVHEAVT
FT                   NSLDACEEAGILPYIRVEIEELGKEHYKIIVEDNGPGIPEKFIPHVFGKMLAGTKAHRN
FT                   IQSRGQQGIGISGAVMFAQITSGKATRVITSTGGDIVEAWVKIDVQKNEGKIVKKVRHP
FT                   NPKGWRGTRIELEVKDVRYVRSKQGVYWYLKLTAIANPHAHIELIEPDGKLIIFPRSSE
FT                   EIPKPPVEMKPHPKGVMTDDVYTMAHKTGRSTVRRFLVSEFSRISDKKVDELVKYIAAL
FT                   RLIKEEDDKAVRDQIYERLANGDVDGVLKSFGRKWRKVVREVEKIMEKPPEKLTWHEAE
FT                   EIVEAFKLMKFLAPPTHGLRPIGEENIEKGLMGILKPEFVTAVTRAPRVYAGGIPFQVE
FT                   VGLAYGGQITGPEILRYANRVPLLFDAGSCVITSAVRSIDWKRYRIDSFENAPLVVMVN
FT                   VVSVHVPYTSTGKQSIADVEEIYNEIRLAIMDAARKLATYLGGKYRRLYQVKRRKTFEK
FT                   YLPEITRSLHIITGEPEEKIKEYFLNLIESRFQSIEGIEEVAENEA"
FT   gene            complement(286141..286803)
FT                   /locus_tag="PYCH_03490"
FT   CDS             complement(286141..286803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03490"
FT                   /product="putative RNA-processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03490"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24044"
FT                   /db_xref="GOA:F8AGY6"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR019964"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGY6"
FT                   /protein_id="AEH24044.1"
FT                   /translation="MEEEFEKLLKKFEKVSKDGEPIEEEEDEWEEEFRQEEYVKIPKER
FT                   IAVLIGKKGSTKREIERRTKTRIEVDSETGEVWITSTKETNDPLAVWKARDIVLAIGRG
FT                   FSPERAFRLLNEGEYLEIINLTDMIIGNEKNALPRVRGRIIGRKGRTREIIEEMSGASV
FT                   SVYGKTVAIIGNPIQIEIAKTAIEKLARGAPHGTVYRYLERRKKDLELEGAMYYENL"
FT   gene            complement(286787..287575)
FT                   /locus_tag="PYCH_03500"
FT   CDS             complement(286787..287575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03500"
FT                   /product="rio1 protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03500"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24045"
FT                   /db_xref="GOA:F8AGY7"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017407"
FT                   /db_xref="InterPro:IPR018934"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGY7"
FT                   /protein_id="AEH24045.1"
FT                   /translation="MERLDREIAEVLGLRERREKDSELFKVFSEVFDRTTVETISYFYR
FT                   RGKIDLLYGVLSTGKEANVFAGFDAQGNRIAVKIYRTYTTEFRRIWEYLAADPRVGYLP
FT                   KDIRKLVFVWTRREFKNLQRAMKYAVRAPEPIAFRNNVLIMEFIGDETPAPRLKDVEKS
FT                   LEKKDFEELYDFAMGSIERLWKRGDMVHGDLSEYNILIWEEPVIIDWSQATVKRNRMSL
FT                   TLLYRDIKNITSYFARKGVSVDDPEEKFRELAGDEYGGRI"
FT   gene            complement(287582..287923)
FT                   /locus_tag="PYCH_03510"
FT   CDS             complement(287582..287923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03510"
FT                   /product="translation initiation factor IF-1A"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03510"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24046"
FT                   /db_xref="GOA:F8AGY8"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGY8"
FT                   /protein_id="AEH24046.1"
FT                   /translation="MPKKERKVEGEEVIRVPLPEGNQLFGVVEQALGAGWMDVRCEDGK
FT                   VRRCRIPGKLRRRVWIRVGDLVIVQPWPVQSDKRGDIVYRYTQTQVDWLLRKGKISQEF
FT                   LTGGGLTFE"
FT   gene            288017..289054
FT                   /locus_tag="PYCH_03520"
FT   CDS             288017..289054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03520"
FT                   /product="putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03520"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24047"
FT                   /db_xref="GOA:F8AGY9"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGY9"
FT                   /protein_id="AEH24047.1"
FT                   /translation="MRSERGLVDNVERGVWKYLTFILALILGFSLVANVLLYVQVGTLQ
FT                   KTSFDNVTRTIVIRENATSSTFENVSLLKVQIEEMRREIEYLRAQLRASRGTFGNATIA
FT                   VVPIFGPIDDYLALHVVRILRELRDNSSVGGVLLWIESPGGYIGPVRAIYEEVKKLAYE
FT                   KPVVAYTAGYADSGAYYIACAAEKIIADPLAEVGSIGVIYVHFNAEQYYAMNGIKVDVF
FT                   KTGPHKDMGADWRGLTEEEKKIITEQIDAYFQEFLRVVSESRNMTLNKTKEFADGRVWF
FT                   AYQVKGTLVDDTGDMDYALKVLVDMMGVEGARVIVYDSPTSDFGIAQSSALYMPARYVY
FT                   SYIGR"
FT   gene            289060..289530
FT                   /locus_tag="PYCH_03530"
FT   CDS             289060..289530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03530"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24048"
FT                   /db_xref="InterPro:IPR023110"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGZ0"
FT                   /protein_id="AEH24048.1"
FT                   /translation="MQCEEKLEVFENGFEDGKFNIRVEVYGGDARKVLLALIYELYLPD
FT                   YGSDYIYPFECAKEFWGIYMDGSEVEPEEMKLSEPKFVSRSVIDKLDKVLKGLDAPQEV
FT                   KALVDLERAKIYKVKEGYLAVGKNFLLDHRDRLFIFNKPSVAEMLLKYIGRW"
FT   gene            289532..290551
FT                   /locus_tag="PYCH_03540"
FT   CDS             289532..290551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03540"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24049"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGZ1"
FT                   /protein_id="AEH24049.1"
FT                   /translation="MERETIVWTAVALIVIFLVWKTIAPLFTPIVFGFAAAYILHPFHV
FT                   RLSEKVGNRASSLIITSLMLVASIGFLIGAALWVTDVLRNIYVYLDKFFIWLKGLNVPP
FT                   ALNAVFDALSESFPERLSHILLGYTLSLPKLVLQIVVFLAVFYGALLNADFLSTEVYRL
FT                   LPSTNRELGEKLIEKAKETLDAILKTWLFLSVTKGFLLALGFYIFGISNITGSIAAGIL
FT                   CVVLELLPVVGGWIMWAVGAFLLVHRSLLLAILFALYGAIFISPVPDIIVKPKLVARRA
FT                   RVSSVVALVGIFGGIIAFGAVGIVIGPIALGLLSALLDAWKEKETAKQPSRAHRSRAA"
FT   gene            complement(290511..291488)
FT                   /locus_tag="PYCH_03550"
FT   CDS             complement(290511..291488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03550"
FT                   /product="hydrogenase expression/formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03550"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24050"
FT                   /db_xref="GOA:F8AGZ2"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGZ2"
FT                   /protein_id="AEH24050.1"
FT                   /translation="MLPGKVPPEVLESIVFKGLKKNGRVLVGPGVGIDAAALDFGETIL
FT                   VASTDPITGAEERIGFYAVHVNANDVATLGAKPKWFLVTILLPEGADEIMLAKIMEEIR
FT                   ENAERLGVTIVGGHTEVTLGLKKPIVIGTMLGEVEREKLVIPRPRAGDAIVLTKGVGIE
FT                   GTAIIAYEREEELAGVFGRSFVERAKAFIEEISVVEEAMIAREWATAMHDPTEGGVANG
FT                   LHEMADVANLGFRVFAEKIPIRNETRKICRFYDLDPLALISSGTLLISVPRDHARILVE
FT                   KLEARGIRAGIIGEFLAEKKRVIIEGGVERPLRRPESDELWKVV"
FT   gene            complement(291493..291633)
FT                   /pseudo
FT                   /locus_tag="PYCH_03560"
FT                   /note="hypothetical protein / fragment"
FT   gene            291718..292185
FT                   /pseudo
FT                   /locus_tag="PYCH_03570"
FT                   /note="hypothetical protein / fragment"
FT   gene            292182..292346
FT                   /pseudo
FT                   /locus_tag="PYCH_03580"
FT                   /note="hypothetical protein / fragment"
FT   gene            complement(292333..294036)
FT                   /locus_tag="PYCH_03590"
FT   CDS             complement(292333..294036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03590"
FT                   /product="glycyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03590"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24051"
FT                   /db_xref="GOA:F8AGZ3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022960"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGZ3"
FT                   /protein_id="AEH24051.1"
FT                   /translation="MDKYEYLQDLMRRRGFAWGSFEIYGGARGFYDYGPLGATIKRKIE
FT                   EKIRRAFIREGFFEIETPDITPERVFIASGHVEKFVDPLVECKKCGARFRADHLIEEAL
FT                   NIETEGLSAEELTRIIREHELKCPECGGELSDVWYFNLMFETYIGPYKDKKAYLRPETA
FT                   QGIFVNFKRLNAFARNRLPFGVFQIGKAYRNEISPRQGMIRLREFTQAEAEIFFDPRNP
FT                   EHPHFDEVKDEVLRLYPTEHQLKGLGEIEITAEEAVKKGYVLNTLFAYYMVMVKRILLD
FT                   IGIPEKAIRFRQQLPEERAHYSTDTWDAEIHSERFGWVECVGIAYRTDYDLKRHIKESG
FT                   ADLTVMIHYDEPKVVKRLQVSLNMKRVGPRLKGDAKKVNERLKAMSQEELERLVKEVEE
FT                   KGKVTVEGYELEKEDFVIKEIEEKVTGEKIIPHVLEPSFGIDRPFYLLLENSLVEEDGR
FT                   IYLKIKKDMAPIEVAVLPLVAKEPLTSIAYEIFRTLQKEGFIVVYDEKDSIGKRYLRYD
FT                   EIGTPYCITIDNQTPEDGTVTIRDRDTREQERVKIEELPKRLRELLFSSS"
FT   gene            294124..295383
FT                   /locus_tag="PYCH_03600"
FT   CDS             294124..295383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03600"
FT                   /product="molybdenum cofactor biosynthesis protein a
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03600"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24052"
FT                   /db_xref="GOA:F8AGZ4"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGZ4"
FT                   /protein_id="AEH24052.1"
FT                   /translation="MIRLRLPNSRFEDLGDFVRLVWRKTLIADFKKGELERAVRRKFRV
FT                   EVSVGAEDGALTVTTDNPDVERFIAFYIQSNLGAMLRNRYTGRRVIYIHEGMDVPLLGY
FT                   NAFGLIDRGTNLIQVRGVSGCNMSCIFCSVDEGPYSRTRALDFVVDVEYLMKWFDWVAR
FT                   EKGKGLEAHLDAQGEPLLYPFIVELVQALRDHPHVSVISMQSNGTLLDDRLVEELAEAG
FT                   LDRVNLSIHSLNPEKAKILMGRKDYDLEHVLEMAEALVNAGIDVLIAPVIIFGVNDDEA
FT                   EAFIEFARRIGAGKRWPAIGFQNYIPYKFGRNPAIARPIPFKEFYAWLRRLEEKTGMKP
FT                   LVLRPEHFGMHRRPFIPLAFQRGEVVKAEVVLPGRMEGEMIAKARNRLIQVIDANARVG
FT                   EKIKVKIVRTRHGIYVGTRA"
FT   gene            295550..296242
FT                   /locus_tag="PYCH_03610"
FT   CDS             295550..296242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03610"
FT                   /product="calcineurin superfamily metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03610"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24053"
FT                   /db_xref="GOA:F8AGZ5"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGZ5"
FT                   /protein_id="AEH24053.1"
FT                   /translation="MIALISDIHSNWEALRAVWKEIRDADMIVCLGDLVGYGASPNEVV
FT                   EFFRRLRERKNVICVRGNHDNAVAFGTDWGFNPYARQAVRWHQRVMSVENLEFLRGLPV
FT                   RASFTAGNRVYYVIHGSPRAPLDEYLFPWLPDSEFRAVLGFIREDDLLVGHTHVPMLVK
FT                   VGDRRIINPGSVGQPRDGDWRASYALLDEETGEVSFYRVEYDVEEAARKILEAGLPRFL
FT                   AERLFEGF"
FT   gene            complement(296253..297386)
FT                   /locus_tag="PYCH_03620"
FT   CDS             complement(296253..297386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03620"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03620"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24054"
FT                   /db_xref="GOA:F8AGZ6"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGZ6"
FT                   /protein_id="AEH24054.1"
FT                   /translation="MRPAIIFGTRPEIIKLSPVVRALLERSVEPLIVHTGQHYDYEMSE
FT                   VFLEELELPPIDYHLEVGSGTQGEQTGKAMIEIENVLMKEKPDVTIVQGDTNTVLAGAL
FT                   ASVKLLIPVAHVEAGLRSFDRTMPEEINRILTDHASEVLFAPTEEAKRNLEREGITENV
FT                   YVVGNTIVDAVLQNSEIAEKKSNILERLGLKEKEYILVTAHRKENVDNPNMLKKLVEIL
FT                   EALPITLVYPVHPRTEKRLKAFGLWERLEKAEHVILTKPLAYLDFLKLERNAKIIMTDS
FT                   GGIQEEAIILNVPCLTLRYNTERPETLKAGGNVLVGLEKERALAYVERLLSDSEFYEKM
FT                   ASASNPFGDGKAGERIAEILLDLYTKGALKVKSSRFI"
FT   gene            complement(297383..298639)
FT                   /locus_tag="PYCH_03630"
FT   CDS             complement(297383..298639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03630"
FT                   /product="UDP-N-acetyl-D-mannosaminuronate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03630"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24055"
FT                   /db_xref="GOA:F8AGZ7"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGZ7"
FT                   /protein_id="AEH24055.1"
FT                   /translation="MRIAVIGLGYIGLPTAIMFASAGHEVVGLEIREDIVKKLNSGRAH
FT                   IAEPEVEERLRRAVEEGKLRATTNPEDIKGADAFIICVQTPLKDGKVDLSYLENAVRTV
FT                   AGVIERGALVIIESTVPPGTTLRMARLIEELTGLKVGQDFHMAHAPERVMPGRIFHELV
FT                   YNSRIIGGVTPESAKRAEILYHSFVRGEILLTDATTAEMVKLMENTFRDVNIALANEFA
FT                   LLAHQYGVNVIEAIRLANTHPRVSIHWPGIGVGGHCLPKDPYLLLSGAREDFGLIRKAR
FT                   EINEDMPLFAKDLLFDAFKEAGVPREDAIVVVLGLAYKGDSDDTRNSPALAFIEAIEGD
FT                   VADVRTYDPFVGGTHESVEKAVKGADAIVIATDHSIFRSLNWEQLGRLMRTRILVDGRH
FT                   VVKDPPKGFVFRGIGRGDV"
FT   gene            298913..300007
FT                   /locus_tag="PYCH_03640"
FT   CDS             298913..300007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03640"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24056"
FT                   /db_xref="InterPro:IPR007152"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGZ8"
FT                   /protein_id="AEH24056.1"
FT                   /translation="MKVWVDITNSPHAHFFKGVIRELEKRGHEVLVTTREFDGLTGILD
FT                   MLGIEYVVVGKHGGASLEGKLLASTERVHLLARLIVKERPNVALYKNNPEAPRIAFGLK
FT                   IPSIGFVDNETAIPQNKLMFPFTSRLIYPRAIDAYELLKCGADPNSLRPINGIAEIANV
FT                   YGFMPSEEPLKELGLKRYSYIVMRPEPVKANYFTGDPERSVLEDVIPLLPDLPIVLFPR
FT                   TEEQARIFSRFENVIIPERPLDSLSLLYYAKLMIGAGGTMNREALVLGTPAISTYPGKL
FT                   LAVTRWLIELGVNFHSTNPIEVAAKAWEILRKNGAYRRQIREVTSSMENPVDAIVEEVE
FT                   ALSYTGQLRSYEGLYEGRHKQEGY"
FT   gene            complement(300489..300773)
FT                   /pseudo
FT                   /locus_tag="PYCH_03650"
FT                   /note="lipoate-protein ligase A / fragment"
FT   gene            300881..301312
FT                   /locus_tag="PYCH_03660"
FT   CDS             300881..301312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03660"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24057"
FT                   /db_xref="GOA:F8AGZ9"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="UniProtKB/TrEMBL:F8AGZ9"
FT                   /protein_id="AEH24057.1"
FT                   /translation="MVEFKDLPIKVSAKALSPTKTLVRCGDYEVITDKLGGEAPSPIEY
FT                   ILAALAGCINIVGHMVAKDMGFEIEGLEIEVEGTFNPAKFMGKNGDRAGYKDVKVVVKV
FT                   RADVDEETLGEWLKRVEERCPVSDNLVNPTPTEVVVEKI"
FT   gene            301402..301740
FT                   /locus_tag="PYCH_03670"
FT   CDS             301402..301740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03670"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24058"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH00"
FT                   /protein_id="AEH24058.1"
FT                   /translation="MKVLKEWNIKVKLVKTKRGAILHMIELEPGHFYLEQNPLKDSKYG
FT                   VAYRKIKENFPEFYMFWEIKDNRYTGKLLAGAFLEKPEIDEFITLLAKTEDFKKFEEIL
FT                   EEIEEVGE"
FT   gene            complement(301780..303546)
FT                   /locus_tag="PYCH_03680"
FT   CDS             complement(301780..303546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03680"
FT                   /product="ATP-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03680"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24059"
FT                   /db_xref="GOA:F8AH01"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR022865"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH01"
FT                   /protein_id="AEH24059.1"
FT                   /translation="MEGDGWRDIKVVRNPYFSLRIVPTVVPMRYLELAQLYQRLEKTTL
FT                   KTLKTRLVADFLKKVPNDLLEIIPYLILGDVFPEWDERELGVGEKLLIRAVSMATGVDA
FT                   KEIENSVKETGDLGESVALAIKKRKQRSFFSQPLTIKRVYDTLVKVAEISGEGSQDKKL
FT                   KYLANLFMDAEPIEAKYLARTILGIMRTGVAEGILRDAIAEAFHVKVELVERAYMLTSD
FT                   FGFVTKVAKLEGNEGLAKVTIQVGKPIKPMLAQQAASIKDALLEMGGEAEFEIKYDGAR
FT                   VQVHKDGDRIIVYSRRLENVTRSIPEVVERLKRAIKAEKAIVEGELVAVGEDGRPLPFQ
FT                   YVLRRFRRKYNIEEMIEKIPLELNLFDVLYVGGKALIDEPFIERRKTLEGIIEADGWIK
FT                   VAENLITKSVEEAESFYRKALGMGHEGLMAKRLDSVYEPGNRGKKWLKIKPTMENLDLV
FT                   IIGAEWGEGRRAHVFGSFILGAYDPHTGEFVEVGKVGSGFTDEDLIEFTKMLKRLITKE
FT                   EGKRVWFEPKVVIEVTYQEIQKSPKYRSGFALRFPRYVALRDDKGPEDADTIERIAQLY
FT                   ELQERMKGKKIA"
FT   gene            303629..304072
FT                   /locus_tag="PYCH_03690"
FT   CDS             303629..304072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03690"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24060"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH02"
FT                   /protein_id="AEH24060.1"
FT                   /translation="MFDEGDMVFLYIARGDLYTLKRTMRRLGLTEEQTLTRRGTIAGGF
FT                   EVGEVIKADFETLWELTKDTSGLTFVHGESEGRRWLKSYINDYGYAFVIERPFLFKEPV
FT                   TRVELKARYGVHVEGIIHISTRTRRPWVKSLLEDLMCREVMYL"
FT   gene            304158..305039
FT                   /locus_tag="PYCH_03700"
FT   CDS             304158..305039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03700"
FT                   /product="MRP family nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03700"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24061"
FT                   /db_xref="GOA:F8AH03"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH03"
FT                   /protein_id="AEH24061.1"
FT                   /translation="MTIKAPTINVPGLGVDPLVQRIKEKEKKWKYKVAVLSGKGGVGKS
FT                   TVAVNLAAALAKMGYFVGVLDADVHGPNIAKMLGVEKTEVLAEKVDERFEMIPPTADFM
FT                   GQVTPIKVMSMGMLVGEDQPIIWRGPLVTKAIKQLLGDVKWGELDFMIIDFPPGTGDEI
FT                   LTVIQNISLDAAIIVTTPQEVALLDTGKAVNMMKQMEVPYIAVIENMSYLICPHCGNKI
FT                   DIFGEGGGERLAQKEGVEFLGKVPIDLKAREASDLGIPIVLYGDTPAAKAFMTIAEKLV
FT                   EKLKGLKDGGEE"
FT   gene            305023..305832
FT                   /locus_tag="PYCH_03710"
FT   CDS             305023..305832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03710"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24062"
FT                   /db_xref="GOA:F8AH04"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH04"
FT                   /protein_id="AEH24062.1"
FT                   /translation="MEERNKGVALALFGMFIYGLEPIVIKANPSNPVSFAFFSALFAAI
FT                   FLAFYPGAVREAANGIRKGFFVGLFGTALAYISYSYGAKLSTATNAALITRAEVLFSFL
FT                   LAGMLLRERITGARLINALIVLTGVVLVLTHGAAVKPGVGDVLLLLVPLFWQLGHVIAK
FT                   TMDISPQSIALLRNSFGALLLFPAALLTGLEFTPYAVLEGLIIALGQVVWYASIRRIEL
FT                   SLATAIITPAPVVAIGMSLLLGESVTFWHLAGFVLITLGTLGLIRSS"
FT   gene            complement(305816..306673)
FT                   /locus_tag="PYCH_03720"
FT   CDS             complement(305816..306673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03720"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase
FT                   (panB)"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03720"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24063"
FT                   /db_xref="GOA:F8AH05"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH05"
FT                   /protein_id="AEH24063.1"
FT                   /translation="MREVTPRRIIEMKGKEKITMITAYDYPSALIADKAGIDIIFVGDS
FT                   LGMVVYGEKNTLNVSMEQMVLHTGAVAKAVKRALVLADMPFASYEIDVEEGVRNAVRLI
FT                   RAGADAVKIEGGYDHRKLVRKLVRMGIPVMGHTGLTPQRYLQLGGYRLMGETEEEIEEI
FT                   LRDAKSLEKSGAFAIVIEFTLADVARLVTEEVSIPTIGIGAGPYVDGQVLVWHDVLGLY
FT                   ENQPPFAKRYANLREVILEALVKFREDVKAGRFPGRDHYWEFLDKEDFEGKKRRVLERL
FT                   KNYE"
FT   gene            306816..307244
FT                   /locus_tag="PYCH_03730"
FT   CDS             306816..307244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03730"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24064"
FT                   /db_xref="GOA:F8AH06"
FT                   /db_xref="InterPro:IPR002804"
FT                   /db_xref="InterPro:IPR022952"
FT                   /db_xref="InterPro:IPR023572"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH06"
FT                   /protein_id="AEH24064.1"
FT                   /translation="MRTWEHYEHTADIGIRGYGDTLEEAFEAVALALFDVMVDVRKVES
FT                   KEVREVEVEGEDLEALLYSFLEELLVLHDMEGLVFGDFRVKIEKTENGYKLMAEAYGEL
FT                   LDPEKHEPKEEVKAITYHDMKIERLPDGRWMAQLVPDI"
FT   gene            307254..308195
FT                   /locus_tag="PYCH_03740"
FT   CDS             307254..308195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03740"
FT                   /product="nucleolar protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03740"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24065"
FT                   /db_xref="GOA:F8AH07"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR011023"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH07"
FT                   /protein_id="AEH24065.1"
FT                   /translation="MNAKEEFKKMNRAFYERYSRLDDSDDFWAYLFKPVRQSIRINTLK
FT                   APLELVLERLSERYELEPVPWVREGFFIRPPGGGTVNFGEMPEYSLGLVIPQEASSMIP
FT                   PVVLEPKPGELILDMAAAPGSKTTQIAQYMENEGCIIANDAKRDRANILIANLNRAGVL
FT                   IAKVTVRDGAYFGRYENTFDRVLLDAPCSSVGMVRKNFKFAYTWSIHKVLYHTRIQRKL
FT                   ILAAYRALKPGGVLVYSTCTVDPLENEAVVDFLLQRTDAKLEKIKLPVKGREPILEWEG
FT                   REFSPEVKKTLRIHPQDNDTEAFFVAKIRKPR"
FT   gene            308201..308449
FT                   /locus_tag="PYCH_03750"
FT   CDS             308201..308449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03750"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24066"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH08"
FT                   /protein_id="AEH24066.1"
FT                   /translation="MLFKKKGVFTVEDALKVIEIASRENASEIIVMAEKVTEEAKRRLW
FT                   DYQKGVMLMADLIGEERSVRVEILEGYVSDRVKGIEL"
FT   gene            complement(308494..309819)
FT                   /locus_tag="PYCH_03760"
FT   CDS             complement(308494..309819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03760"
FT                   /product="zinc-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03760"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24067"
FT                   /db_xref="GOA:F8AH09"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH09"
FT                   /protein_id="AEH24067.1"
FT                   /translation="MENLIRFGEKFFDELEIATYREREVGVGVELNEVSIAGVKSRAIT
FT                   IIRGVKDKRLGLAVIDGEEPAKIREAIETAAKMAKLNSPDEKWVSLPEPGKYRERPKPN
FT                   EELKEVSPDILVEMTVRSIKLAREKDPHITVAGGSTTVSWLESSIINSHGIDVHQAFGN
FT                   AFMFLELVGRKEGVVTPGIFEFDARTDLNLDVEGVVERALKKVKWAYNVKASKNEEVPI
FT                   ILSPWAIAGLFSFALFPAFSGERLVKGTTPLAEKIGEQVANDVLTMYDDPFHELSLAKM
FT                   VADGEGVPTRRNVLIEKGIFKGFVWDNYWAKVYGTESTGNGKRDLRSGGISIGLNTVVI
FT                   EPGKRSLEDMISEIERGYLVDGLQGAHSSNPDNGNFAVTANPAYLIEDGEVKGASVFLI
FT                   AGNVYELLKQAREVSKELTVMPAMYTVITPHILFENVKIAGK"
FT   gene            complement(309830..311197)
FT                   /locus_tag="PYCH_03770"
FT   CDS             complement(309830..311197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03770"
FT                   /product="zinc-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03770"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24068"
FT                   /db_xref="GOA:F8AH10"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH10"
FT                   /protein_id="AEH24068.1"
FT                   /translation="MEALEKALRWAEDNLKAEYIELRYENLKKTALSLKDGVFVGFTTK
FT                   FQRGVAIRVLADGAWGFSSTSRLENLEKAIEEAYKLAKAAAQTKKEKITLAEIKPVEDF
FT                   VKSKMRVKPVEVDIEEKVAHLRELEKLLKEDKAVKSVQIRYEDGSGEKILLTNEGTRIE
FT                   WDYNYLWQGTYITGKKEGRLAMARDSIGAVDYGWELMTDIEPNEKVTERLLRKMHSQLN
FT                   GVAPKRGEWPIVAGPIVVGLIAHEALGHLAEADLTINSPFKDLIGKQIAPEFVTMSERY
FT                   VEGGFGNDKYDDEGVPVKDIHIIENGILKEIMLNREYAAKWGMEPNGHARAQDYTYPPI
FT                   IRMRNTIFEPGDYSFEELIEDIKFGYYVVDFRGGQAQLNSAFQVGIQEGYVIRNGEIAE
FT                   PIRDTSITGVAIEALKKISAVGKDFGLEVGFCGKGQTAFVSSGGPHMRFDGGILIG"
FT   gene            311470..312201
FT                   /locus_tag="PYCH_03780"
FT   CDS             311470..312201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03780"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24069"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH11"
FT                   /protein_id="AEH24069.1"
FT                   /translation="MLRRALLAMFVVLLLIGAYGAYVVSYPKYPEVNGCVNPFRVTTPV
FT                   SRVQENWSKAHVFLKLATSRDFWKLAKPWDVDYSHVKIVKHTIEYNGEKITMLAMGIPL
FT                   KDGKHVIALYEFSKPVQGVKVRGYRIDVSEGKLKPELISVNGGKTTTLGSCRHECSSNA
FT                   DCPGPREYCTEYCCSYDRGAAIDCCLNAGRCGAVCGIGATICLINPIGCVICTACVVAN
FT                   CYFCIEESCLEWGTGCEYHGS"
FT   gene            312212..312622
FT                   /locus_tag="PYCH_03790"
FT   CDS             312212..312622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03790"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24070"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH12"
FT                   /protein_id="AEH24070.1"
FT                   /translation="MENRKLSFGMLFILFLMLFISYSGISRGTFWENPLRGTLTGLGIG
FT                   LGLLLPPLIVVLTLMNRTSLYVAVVIAAGTELLLSGILALSGYTGYARVFVEATVIGLP
FT                   AGLLMAWVVAQERGDSKITKQKESETIINREA"
FT   gene            312648..312995
FT                   /locus_tag="PYCH_03800"
FT   CDS             312648..312995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03800"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24071"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH13"
FT                   /protein_id="AEH24071.1"
FT                   /translation="MKAEIKNLIDRGTYQKLPLFEGDLPEGSYAQIVEVKPRQTVKKHY
FT                   HERQYELFYIIGGEARLGIGDTEYLAKPGDIFLVKPRTVHWVINESDEPFRLFIVKLDY
FT                   YGDDTVWLELE"
FT   gene            complement(313013..313513)
FT                   /locus_tag="PYCH_03810"
FT   CDS             complement(313013..313513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03810"
FT                   /product="Regulator of amino acid metabolism, putative,
FT                   containing ACT domain"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03810"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24072"
FT                   /db_xref="GOA:F8AH14"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR014424"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH14"
FT                   /protein_id="AEH24072.1"
FT                   /translation="MWGRIEHYFEEYPVRKLIAKTLLRYGLKVSEDMKIKAGNVEVPYT
FT                   KIAKALDVDRRVVKETVAMILKTPELREIYMNLEPTVHMKYVGRHVGYGVIEIEPEPRA
FT                   VGILAKIAQKIADRGINIVQVVAEDPELYPEATLTIITEKPVPGDLINELSKLEGVKRI
FT                   SIY"
FT   gene            313630..314463
FT                   /locus_tag="PYCH_03820"
FT   CDS             313630..314463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03820"
FT                   /product="proteasome subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03820"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24073"
FT                   /db_xref="GOA:F8AH15"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR019982"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH15"
FT                   /protein_id="AEH24073.1"
FT                   /translation="MGRYISLTQDKLMGGWEMAFVPPQAGYDRAITVFSPDGRLFQVNY
FT                   AREAVKRGATAAGVKCEEGVVLAVEKRITSRLIEPESYEKIFQIDDHIAAASSGIIADA
FT                   RVLVDRARLEAQIYRLTYGEPAPLPVLVKKICDLKQMHTQYGGVRPFGAALLLAGVNEK
FT                   PELYETDPSGAYFAWKAVAIGSGRNTAMAIFEEKYRDDMRLEDAIKLAIFALAKTMENP
FT                   SAESIEVAVITVKDRRFRKLTKEEISKFLEEVMKEIEQEQVEEKEEDYSELDSNY"
FT   gene            314474..315184
FT                   /locus_tag="PYCH_03830"
FT   CDS             314474..315184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03830"
FT                   /product="putative RNA-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03830"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24074"
FT                   /db_xref="GOA:F8AH16"
FT                   /db_xref="InterPro:IPR002140"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR018023"
FT                   /db_xref="InterPro:IPR018978"
FT                   /db_xref="InterPro:IPR019783"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH16"
FT                   /protein_id="AEH24074.1"
FT                   /translation="MPISVDKAVIARLKIHGETFEILVDPYLARDFKEGKDVPIEEILA
FT                   TPYVFKDAHKGDKASEHEMEKLFGTSDPYEVAKIILRKGEVQLTAQQRREMMEEKKRQI
FT                   ATIIHRHAVDPRTGYPHPVDRILKAMEEVGVRVDIFKDAEAQVQDVIKALRRVLPLKIE
FT                   VKIIAVKIPSEYVGRAYGEVRKFGKIKREEWGSDGSWMFLIEIPGGVEEEFYEKLNALT
FT                   KGNVQTKLVERKGL"
FT   gene            315181..315954
FT                   /locus_tag="PYCH_03840"
FT   CDS             315181..315954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03840"
FT                   /product="exosome complex RNA-binding protein Rrp4"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03840"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24075"
FT                   /db_xref="GOA:F8AH17"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023474"
FT                   /db_xref="InterPro:IPR025721"
FT                   /db_xref="InterPro:IPR026699"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH17"
FT                   /protein_id="AEH24075.1"
FT                   /translation="MKRVFVQNRELVVPGTLLAQGPFKNGRGTFREGSRIYSTVIGLVD
FT                   IKGNLIRVIPLEGPYIPEVGDNVIGKVVDVKFSSWTVDIGAPYQATLRIQDHTDEKIDL
FT                   IKTDLKKFFDIGDIIYAKVKAINEVNNIDLTTKGMPFNGGPLRGGQIVKITPSKVPRLI
FT                   GKGGSMINMIKRLTMTRIIVGQNGWVWISGKKEELEKLAIEAILKVDRESHTKGLTDRI
FT                   KELLLDRLQELKERGVIEEIPQLEEEQNGEEGEEA"
FT   gene            315951..316700
FT                   /locus_tag="PYCH_03850"
FT   CDS             315951..316700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03850"
FT                   /product="exosome complex exonuclease Rrp41"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03850"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24076"
FT                   /db_xref="GOA:F8AH18"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR011807"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH18"
FT                   /protein_id="AEH24076.1"
FT                   /translation="MMDKPEGLKLIDENGRRIDGRKKYELRPIKMEVGVLKNADGSAYV
FT                   EWGKNKILAAVYGPREIHPKHLQRPDRAILRVRYNMAPFSVEERKKPGPDRRSIEISKV
FT                   IKGALEPALLLELFPRTAIDIFIEVLQADAGTRVAGITAASLALADAGIPMKDLVAACA
FT                   AGKIEGQIVLDLNKEEDNYGEADVPVAIMPMKNDITLLQMDGYLTREEFIEAVKLAIKG
FT                   AKAVYQKQREALKEKYIKIAQEVEAGE"
FT   gene            316702..317508
FT                   /locus_tag="PYCH_03860"
FT   CDS             316702..317508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03860"
FT                   /product="exosome complex RNA-binding protein Rrp42"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03860"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24077"
FT                   /db_xref="GOA:F8AH19"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020869"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH19"
FT                   /protein_id="AEH24077.1"
FT                   /translation="MEVMAGIMRDHILSILKEGKRIDDRGFEDYRPIEIQVGVIEKAEG
FT                   SALVKLGNTQVLVGIKLDLGEPFPDTPNMGVMTTNVELVPLASPTFEPGPPDERAIELA
FT                   RVVDRGIRESKALDLEKLVIVPGKLVRVVFIDVHVLDHDGNLMDAIGIAAIAALLNAKM
FT                   PKVEYDEEKGEVTILDEWEPLPVQKIPIPVTFAKIGGTLVVDPNLEEEQVMDGKLTITT
FT                   DETGHISAVQKSEGGAFKLEEVMYAVEVAFKKAEEIRKLILEAVQG"
FT   gene            317549..317625
FT                   /locus_tag="PYCH_t15"
FT   tRNA            317549..317625
FT                   /locus_tag="PYCH_t15"
FT                   /product="tRNA-Thr"
FT   gene            317627..317704
FT                   /locus_tag="PYCH_t20"
FT   tRNA            317627..317704
FT                   /locus_tag="PYCH_t20"
FT                   /product="tRNA-Pro"
FT   gene            317723..318343
FT                   /locus_tag="PYCH_03870"
FT   CDS             317723..318343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03870"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24078"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH20"
FT                   /protein_id="AEH24078.1"
FT                   /translation="MYYDHFPTFGGYIFGMILYFALIPLVFLVVLRAEWDYIGKKMWKK
FT                   VMRPFIICLLLASSLTSLLQFKLTNDYLYVYSLTRTDTCLTASCLVSEMERNEYYKFNV
FT                   TAIQKLGMPRFGLMRAFRLVDKKFNKMKFGYEQVNAVVITRSMFPLPITEVWSYEVDPK
FT                   DSHKITGLKKFYVYYPYNPGTLLSRFYDFEFTMFLWDIGGAPG"
FT   gene            318387..318463
FT                   /locus_tag="PYCH_t25"
FT   tRNA            318387..318463
FT                   /locus_tag="PYCH_t25"
FT                   /product="tRNA-Thr"
FT   gene            318593..318841
FT                   /pseudo
FT                   /locus_tag="PYCH_03880"
FT                   /note="RNA polymerase Rpb5 / fragment"
FT   gene            318860..322216
FT                   /locus_tag="PYCH_03890"
FT   CDS             318860..322216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03890"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03890"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24079"
FT                   /db_xref="GOA:F8AH21"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019969"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH21"
FT                   /protein_id="AEH24079.1"
FT                   /translation="MRGPTVVEVTPDDLWVVMESYWQEKGLVRQHLDSYNAFIERGLQE
FT                   VVNEFGGVKPDIPDFEVKFGRIRVGEPEFQEAHGQRKPLYPMDARIRNLTYSAPLYLEM
FT                   IPVVKGIEQEPVEVRIGELPIMLKSKVCRLYGLSDEELIKLGEDPKDPGGYFIINGSER
FT                   VIVSIEDIAPNRTLVEKDERQERYLAKCFSYRHGYRALITVERRKDGILYVSIPNVPKP
FT                   VKFVYVMRALGLEKDKDIVDAVGNDPEVQQVLFDNLEDASDIQTQMEALELIGRLVAPG
FT                   QAREYRLKRAEYVIDNNLLPHMGVNPEDRIRKAYYLGMMALKVIELSLGRRDEDDKDHY
FT                   ANKRLRLAGDLLKDLFRVAFAQLVKDIQYQMTKTYQRKGEKYTFGNIHRFIRNSIRPDV
FT                   LTERIEHSLATGAWPGGRTGVSQLLDRTNYMSTLSHLRRVTSPLDREQPHFEARDLHGT
FT                   HWGRICPTETPEGPNCGLVKNLALMAQITTAVPEKEVREYLMKLGIIPIEVRRPSPELW
FT                   RVYLNGVLIGTIEDGKALVERIKKDRRSGKISDVINVAYYEDIKEVYVNSDDGRVRRPL
FT                   IIVENGKPKLTREHVEAVKQGRLKWSDLIKMGIIEYLDAEEEENAYVAMWPWEVTEEHT
FT                   HLELMPAAILGLPASLVPYPEHNAAPRNTYGAGMAKQSLGLGWANFRIRVDTRGHLLHY
FT                   PQVPLVNSRIMKAVGYEDRPAGQNFVVAILAYQGYNMEDAIIINKASIERGLARSTFFR
FT                   TYEAEEKKYLGGQTDRFEIPDPTVRGYRGEKYYRNLDEDGLIFPESKVDGKDVLIGRTS
FT                   PPRFLEERGGLGGMILQERRETSVAVRPSEKGIVDKVIITETGDGTKLVKVTVRDLRIP
FT                   ELGDKFASRHGQKGVIGLIVPQEDMPWTESGIVPDLIVNPHGIPSRMTVGQLIEAIGGK
FT                   VASLKGRRVDGTAFIGEPEERLRKELEELGFKHNGREVMYDGITGKRLVADIFIGVIYY
FT                   QRLHHMVADKIHARSRGPVQVLTKQPTEGRAREGGLRFGEMERDVLVGHGAAMLLIERL
FT                   LEESDKTEVWVCENCGHIALEDKRRGKVYCPVCGEEERISKVEMSYAFKLLLDELKAMI
FT                   IRPKLNLTERV"
FT   gene            322222..324945
FT                   /locus_tag="PYCH_03900"
FT   CDS             322222..324945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03900"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03900"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24080"
FT                   /db_xref="GOA:F8AH22"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012758"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH22"
FT                   /protein_id="AEH24080.1"
FT                   /translation="MQSVKKVIGSIEFGILSPQEIRKMSAVEVTVPDTYDDDGYPIEGG
FT                   VMDKRMGVIDPGLRCETCGARAGECPGHFGHIELARPVIHVGFAKTIHRILESTCRECG
FT                   RIKLTDEEIEEYMKKLELAGNRRSEVNKILKEIHKKARERMVCPHCGAPQFPIKFEKPT
FT                   IYWEIRKDEQGNEYRHRMMPTEVRDRLEKIPDKDLPLLGLHPEKSRPEWMVLTVLPVPP
FT                   VTVRPSITLETGIRAEDDLTHKLVDIIRINNRLKQNIEAGAPQLIIEDLWDLLQYHVTT
FT                   YINNETSGIPPAKHKSGRTLKTLAQRLKGKEGRFRGNLSGKRVNFSARTVISPDPMISI
FT                   NEVGVPIEIAMELTVPEKVTEFNIEKLRKMVLNGPEKYPGANYVIDPEGRRIRIMDSNR
FT                   ELLAERLDIGWTVERHLLDGDIVLFNRQPSLHRMSIMAHRVRVMPYKTFRLNLAVCPPY
FT                   NADFDGDEMNLHVPQTEEAQAEARILMEVQNHIISPRYGGPIIGGIQDHISGGYLLTRE
FT                   GAYFTREEVEQMLMFAGVDVKELPEPDKYENGKPLWSGKTIFSLLLPDDLTVWYRNKLC
FT                   DEPERCEALEKLIEEKLMPDPEEVRKLAYDGFVYIQNGKLLSGAIDKKAYGREDGIILD
FT                   LIVREYGVERARQFLDQVTKLAIWVITHKGFTTAIDDEDLPQEAIDRIKEIIREAEERV
FT                   ERLIEAYRRGELEPLPGKTIEETLESKIMAVLAEARDNAGSVAERYLGMDNHTVIMAKT
FT                   GARGKILNITQMAALLGQQSIRGKRLYRGYRGRVLTHFKPGDLGARARGFVVNSYKSGL
FT                   TPQEYFFHAMGGREGLVDTAVRTAQSGYMQRRLINALQDLKVDYDGTVRDPNGVIVQFR
FT                   YGEDGIDPMKSWGGKTVDVDRIIMRTLFKMRVNGKA"
FT   gene            324956..326146
FT                   /locus_tag="PYCH_03910"
FT   CDS             324956..326146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03910"
FT                   /product="DNA-directed RNA polymerase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03910"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24081"
FT                   /db_xref="GOA:F8AH23"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR012757"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH23"
FT                   /protein_id="AEH24081.1"
FT                   /translation="MVSPSTIKSLVEKKGSLLPKSVKEELYQKLVKYNEKYKLKKAEIE
FT                   AIIEEVVREYERALVEPGEAVGTVAAQSIGEPSTQMTLNTFHYAGVAEINVTLGLPRII
FT                   EIVDARKNPSTPMMTVYLDEEHRHDRAKAEEVARRIEGTTVENLARSTTIDLINMEFIV
FT                   EIDPERLEKSGLSMERILKKLQGSFKSAEFEVEGYTLIVRPKKAEKISDLRRLAEKVKK
FT                   HRLKGLSGVGKTIVRKEGDEYVIYTEGSNFKQVLKVPGVDPTRTRTNNIHEIAEVLGIE
FT                   AARNAIIEEIVNTMREQGLEVDIRHIMLVADIMTLDGIVRPIGRHGVVGEKESVLARAA
FT                   FEITTQHLFEAAERGEIDNLNGVIENVLIGQPVPVGTGIVRLAMKLPLRPQKEEEV"
FT   gene            326150..326449
FT                   /locus_tag="PYCH_03920"
FT   CDS             326150..326449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03920"
FT                   /product="50S ribosomal protein L30e"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03920"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24082"
FT                   /db_xref="GOA:F8AIR3"
FT                   /db_xref="InterPro:IPR000231"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR022991"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIR3"
FT                   /protein_id="AEH24082.1"
FT                   /translation="MDLAFELRKAMETGKIVLGSNETIRLAKTGGAKLIIVARNAPKEI
FT                   KDDIYYYAKLSDIPVYEFEGTSVELGTLLGKPFVVASLAIVDPGESNILALAKK"
FT   gene            326462..326899
FT                   /locus_tag="PYCH_03930"
FT   CDS             326462..326899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03930"
FT                   /product="transcription elongation factor NusA-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03930"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24083"
FT                   /db_xref="GOA:F8AH24"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010212"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH24"
FT                   /protein_id="AEH24083.1"
FT                   /translation="MPLKLNTEQIKYIALFESFTGATVLDCLIDSERNRLIYVIKKGEM
FT                   GLALGKRGINVRRIEGMIGKEIDLVEHSENPEEFIKNIYKTMGVKVKKVHITEKRDGKK
FT                   VALLDVSPRDKPRAIGRGGHNINIVRELMERHHGIHDVIII"
FT   gene            326916..327359
FT                   /locus_tag="PYCH_03940"
FT   CDS             326916..327359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03940"
FT                   /product="30S ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03940"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24084"
FT                   /db_xref="GOA:F8AH25"
FT                   /db_xref="InterPro:IPR005680"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022863"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH25"
FT                   /protein_id="AEH24084.1"
FT                   /translation="MPGKKAPNGEFAGRKLKLKRKKFRWSDIRYKRRVLRLKEKSDPLE
FT                   GAPQARGIVLEKIAVEAKQPNSGMRKAVRVQLIKNGKVVTAFCPGDGAINYIDEHDEVI
FT                   IEGIGGPKGGSMGDIPGIRYKVVKVNRVSLKELVKGRKEKPRR"
FT   gene            327366..328013
FT                   /locus_tag="PYCH_03950"
FT   CDS             327366..328013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03950"
FT                   /product="30S ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03950"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24085"
FT                   /db_xref="GOA:F8AIR4"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR026018"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIR4"
FT                   /protein_id="AEH24085.1"
FT                   /translation="MAKPLTERFFIPKEIKVMGRWSVEDVEVRDPSLKPYINLEPRLLP
FT                   HTHGRHAKKHFGKANVHIVERLINKVMRSGGSHYKVAGHFMRREHRSLMSKKMKAYEVV
FT                   KEAFKIIEQRTGKNPIQVLIWAIENAAPREDTTSVMFGGIRYHVAVDISPLRRLDVALR
FT                   NIALGASAKCYRTKMSYAEALAEEIILAANKDPKSYAYSKKLEIERIAESSR"
FT   gene            328086..328913
FT                   /locus_tag="PYCH_03960"
FT   CDS             328086..328913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03960"
FT                   /product="universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03960"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24086"
FT                   /db_xref="GOA:F8AH26"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH26"
FT                   /protein_id="AEH24086.1"
FT                   /translation="MFKRILYPTDFSEVSRKALLECVPSIATGAELILLHVVDITLAEM
FT                   EAFQMSDVAEEELKKLAEALREKGITVETIVRIGIPSLEIAEVAKEKDVDLVVVPSKGE
FT                   NILRQMFLGSTASNLVRATHRPVLLLRYEVEDGTLKALQDCSTIFKRPLVALDFSECSA
FT                   RVIEVVKELPEVEEVILAHVVDYGKVEKLEENIREAERKLKEYARELPWKTEVEVLAGI
FT                   ASRGIIGLALTKNATVVVIGKRGRSVLRELLLGSTAERIIRECRLPVLLVPCE"
FT   gene            328933..329289
FT                   /locus_tag="PYCH_03970"
FT   CDS             328933..329289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03970"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03970"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24087"
FT                   /db_xref="GOA:F8AH27"
FT                   /db_xref="InterPro:IPR002833"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH27"
FT                   /protein_id="AEH24087.1"
FT                   /translation="MFYYKQVMVVRKDLKISKGKLAVQVAHGAVTAAFEAYRKRREWFE
FT                   AWFREGQKKVVVKVENEEELFQLKAQAEKLGLPTALIRDAGLTEIPPGTVTCLAIGPAP
FT                   EELVDKVTGHLKLL"
FT   gene            329299..330540
FT                   /locus_tag="PYCH_03980"
FT   CDS             329299..330540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03980"
FT                   /product="tRNA pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03980"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24088"
FT                   /db_xref="GOA:F8AH28"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH28"
FT                   /protein_id="AEH24088.1"
FT                   /translation="MDFRELFRRFRHLSETPGIGGRIKVYPEDFIVREVLPKAAFRGPC
FT                   LLFLLKKRNWETMAAIKEIAKRLGIHYSEIGFAGTKDRHAVTYQYISICRPELKERVNS
FT                   IKMKGVELRFVGKGRRLKLGMLLGNRFLIRVRGPERPENLPEIIGELKEKGGFPNYFGP
FT                   QRFGERRVVNHLVGKLLLLGDFESAARLFLGYAEGDMEGDEARRNFWETGDVERALEEF
FT                   PKFLRYERAMLYRYRETGSWKKAFLVLPRPIARIFIHAYQAYLFNLYLSRRIEEGMSLA
FT                   EAIPGDIVVQVKGGIPLRSRTYRVTETNVDFVNEKIKAGEAMVTGPIFGLLMRRARGLP
FT                   GRLETEILEGEGISLEAFKRLPKPLREPGGRRELLIKPLHFAYKIEERSVLFRFFLPKG
FT                   VYATSVLREIMKDH"
FT   gene            330592..330930
FT                   /locus_tag="PYCH_03990"
FT   CDS             330592..330930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_03990"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_03990"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24089"
FT                   /db_xref="GOA:F8AH29"
FT                   /db_xref="InterPro:IPR002836"
FT                   /db_xref="InterPro:IPR022889"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH29"
FT                   /protein_id="AEH24089.1"
FT                   /translation="MAEDIEEIRKRKLLELQRKYLEQQRAREEEARQQALIEAQIQAIL
FT                   RKILTPEARERLARVKLVRPELARQVELILVQLYQTGQIREPLTDAQLKRILAQIEART
FT                   RREFRIKW"
FT   gene            330924..331346
FT                   /locus_tag="PYCH_04000"
FT   CDS             330924..331346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04000"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24090"
FT                   /db_xref="InterPro:IPR007171"
FT                   /db_xref="InterPro:IPR023131"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH30"
FT                   /protein_id="AEH24090.1"
FT                   /translation="MVREVIRCRGHPNVRATHRSTFEITKEDFLTPRGDCIICVSADKA
FT                   LKDLSEDFKRALRAGKRVRIIIRVDELEEEVVAWGHPGLSLESDVSIVVRKSDYLDGRT
FT                   LAIRANKAAKDLKRDLVEKLKDPETVAVVELVVDDE"
FT   gene            complement(331387..332649)
FT                   /locus_tag="PYCH_04010"
FT   CDS             complement(331387..332649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04010"
FT                   /product="3-octaprenyl-4-hydroxybenzoate decarboxylyase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04010"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24091"
FT                   /db_xref="GOA:F8AIR5"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIR5"
FT                   /protein_id="AEH24091.1"
FT                   /translation="MLKEIIGRFKDELVVIEEPVSRELEITKFLLRYRDRPILFRDVEG
FT                   WEVVGNLWSTRERIARFLNTDRRGLLFLLTDAIENPRTYRVVEDAPFLKNVEKADLEAL
FT                   PVPKFYSKDGGRYFTSAMVIAKRDDFVNVSFHRMMVLDSERAAIRLVPRHLYAMWKEKA
FT                   EMGEELDVRIVVGNPVHLLLAGATSVAYGVSELEIASAISEIAFGKPLEVVDVGGIPVP
FT                   VESEFVFEARILPELTDEGPFVDITGTYDHVRKQPIVVFERMYHVDDPIFHVLLPGGYE
FT                   HYMLMGLPKEPQIYASVKRVVPKVHGVRLTEGGCMWLHAVVSITKQHEGDGKNAILAAF
FT                   AGHPSLKRVIVVDEDVDIYDDREVEWAIATRFQPDRDLIIVPNARGSSLDPSGEDGLTA
FT                   KWGIDATKPLKGKEKFERASL"
FT   gene            complement(332615..333829)
FT                   /locus_tag="PYCH_04020"
FT   CDS             complement(332615..333829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04020"
FT                   /product="RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04020"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24092"
FT                   /db_xref="GOA:F8AH31"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR005912"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH31"
FT                   /protein_id="AEH24092.1"
FT                   /translation="MIIVKKAAEVLGKVELCNHCLGRLFAKLGKGSNEERGKAIRFVLN
FT                   MERAASELPLLKEPKRCELCGGVFERLEEYANRCLNAVEREGIEFDTFLVGSRFPKEVL
FT                   EKEEEIWKRFGIEWGEPINREFNRELGKLLEGLLGKKVNRERPDVVFIVEPASGRVELQ
FT                   VNPIYVYGRYRKLVRGIPQTPLPGFRDSVASIICRAFSRAFGGKCVFKGAGREDVDVRM
FT                   LGRGRPFIVEIKRPKRRKANLEKIAEDIAASGKVEVLEMKFVGPKEAEKVLTERHRKLY
FT                   EALIFVREGVMPEEVRKVVETLRGAEIRQRTPRRVLNSRSDTVRVRRVYEAWGEPIDET
FT                   HFRLRLLTDGGLYIKELISGDGGRTRPSVAEILGKDAWCELLDVLDVLDGGDEIAEGDN
FT                   WEVQG"
FT   gene            333889..334722
FT                   /locus_tag="PYCH_04030"
FT   CDS             333889..334722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04030"
FT                   /product="translation initiation factor IF-2 subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04030"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24093"
FT                   /db_xref="GOA:F8AH32"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011488"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022964"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR024054"
FT                   /db_xref="InterPro:IPR024055"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH32"
FT                   /protein_id="AEH24093.1"
FT                   /translation="MEMPRRAREFPEEGEFVVATVKRVHHYGAFLELDEYPGKEGFMHI
FT                   SEVASTWVKNIRDYLREGQKVVAKVIRVDPEKGHIDLSLRRVTQQQRKAKLQEFKRAQK
FT                   AENLLKMAAGKLGKDFETAWREVWVPLEEEYGEVYAAFEEAAKEGIEVLKGLIPDEWLP
FT                   VLKEIVENYVEVPTVTIDAEFEITVPKPNGIEIIREALIKARDRVNKEKDIEVKFTYQG
FT                   APRYRIDITAPDYYKAEEVLEDIAEEILRVIKQAGGEATLLRKEKRIRKVKRRKK"
FT   gene            334724..334912
FT                   /locus_tag="PYCH_04040"
FT   CDS             334724..334912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04040"
FT                   /product="H/ACA RNA-protein complex component Nop10p"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04040"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24094"
FT                   /db_xref="GOA:F8AIR6"
FT                   /db_xref="InterPro:IPR007264"
FT                   /db_xref="InterPro:IPR023532"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIR6"
FT                   /protein_id="AEH24094.1"
FT                   /translation="MRFRIRKCPECGRYTLKDVCPVCGAKTKVAHPPRFSPEDPYGEYR
FT                   RRLKREILGIRRKEEGA"
FT   gene            334909..335709
FT                   /locus_tag="PYCH_04050"
FT   CDS             334909..335709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04050"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24095"
FT                   /db_xref="InterPro:IPR004426"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH33"
FT                   /protein_id="AEH24095.1"
FT                   /translation="MRETTIVVYERPDIYDPIFIEGLPGIGLVGKLAAEHLIQELNAKK
FT                   FAELYSPHFMHQVLIRKNSTVELMKNEFYYWKSPDDEHRDLIIITGDTQVPPTDSYGHF
FT                   EVVSKMLDFVAEFGTREIITMGGYQVPELQGEPRVLAAVTHEDLIDYYKAKLEGCSVEI
FT                   IWREDEGGAIVGAAGLLLGIGKLRGMYGISLLGESLGYIVDAKAAKSVLSAVTKILGLE
FT                   IDMTALEERAKETEEILRKVEEMQRAMLEQQLPRPHEEEDRGYL"
FT   gene            335732..336997
FT                   /locus_tag="PYCH_04060"
FT   CDS             335732..336997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04060"
FT                   /product="phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04060"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24096"
FT                   /db_xref="GOA:F8AH34"
FT                   /db_xref="InterPro:IPR005287"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH34"
FT                   /protein_id="AEH24096.1"
FT                   /translation="MLVDADLHIHSHYSKAVSRTMVFPVIAENARLKGLGIVGTGDILN
FT                   PKWEKELLKYGKEVDEGTYEVKGVRFLLTAEIEDEKRVHHLLVFPNIEAVREMRTRIGN
FT                   IESEGRPHVNLSAEEIAELAGELDVLIGPAHAFTPWTSLYKEYNSLKEAYGDAKIHFLE
FT                   LGLSADSEMADRIKAHHKLPYLSNSDAHSPMPHRLGREFNRFEIQEATFEEVRKAILGR
FT                   GGRRIVLNAGLDPRLGKYHLTACSRCYTKYSLDEARALKWRCPRCGGRIKKGVRDRILE
FT                   LADTEERPKDRPPYLKLAPLAEIIAMALGKGVETKAVKIVWERFLKEFGSEIQVLVDIP
FT                   IEALADVHEDVAKAIWAYRKGKLIVIPGGGGKYGEIKLPPEIMKARVDELESVDVEVPS
FT                   EDVRPRQTTLFKFLRRVNCFKA"
FT   gene            complement(336987..337997)
FT                   /locus_tag="PYCH_04070"
FT   CDS             complement(336987..337997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04070"
FT                   /product="Sugar-specific transcriptional regulator TrmB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04070"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24097"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH35"
FT                   /protein_id="AEH24097.1"
FT                   /translation="MNIFLSIFFLVLRIFFKGNFLTSGGAGMKSKAAILLAIALMILPF
FT                   ISGQYSVESLSLTVYSDGYVKVSEVIIPENYTVSFSISLLATNVEGLTVIDENGNPLPY
FT                   KINGSILTVYFENAIPIKITYYTPDLTSKKGAIWSVHFTSEIPVKITFPDNAVIVDLTD
FT                   IPLKIDGNSILMPPGNQTVSYVLEYRPARTEAPASGTATESFNSTAPSSLGSSSQSSST
FT                   SSESSTNWAMVGILTLLAIAAGSFVYMRRGSKEKVVGISREDFEKLLKKYELTKDEEKV
FT                   LLYLFDRGGKARQAEVREMLGIPKTTAWRMFNRLEKQGLVRVYKKRRENWVELKL"
FT   gene            complement(337994..339307)
FT                   /locus_tag="PYCH_04080"
FT   CDS             complement(337994..339307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04080"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24098"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH36"
FT                   /protein_id="AEH24098.1"
FT                   /translation="MKMSMKTLLVLFIGALIPLSTAWGATNTTAVSNVSVVNATNVTST
FT                   TPVNMTNVTNTTNTSAVQAYNLLLILDKVANYSESLMAELNASNVTISNYTLELYSQAE
FT                   AMHTKAWKLYNAGNYSESINASINALYLYKEVIEELTDHYKEHIEEQYEYYEYYELIMD
FT                   AKEELQRASEYFPYVEKVIAEAKAEGLNVTYVMELYNETKAAYMVVAQDLASGNVTTLK
FT                   TDLEYAEELMDKLEDAVEELQEQIVSAKADEISQAFMEKLQEQMKLMNELLAMLQNSTI
FT                   NATYLQENLMELQTMYEQFNALVESGQYEEALDMLHDINEELHDIVEEVKELQEEYYEK
FT                   EHDEYEQDHEDDHDEHIEENESEHEDDHGEHDEKYAEEESEDDQNESYEEQSDNDYGNN
FT                   GNYEEQESHDDDNGQYEDSEDNNGDGKHNGEDELEDEE"
FT   gene            339546..339821
FT                   /locus_tag="PYCH_04090"
FT   CDS             339546..339821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04090"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24099"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIR7"
FT                   /protein_id="AEH24099.1"
FT                   /translation="MMKVVGVLGILAILGYVYLVLRFENRDERFRTINAKSHIWAVMLL
FT                   LFVNLLVQTLNYLNKTDKMFVLGFTAAVIVVSIGYILGFVYYSKVM"
FT   gene            339822..340292
FT                   /locus_tag="PYCH_04100"
FT   CDS             339822..340292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04100"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24100"
FT                   /db_xref="InterPro:IPR019235"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH37"
FT                   /protein_id="AEH24100.1"
FT                   /translation="MNEAIVNFIIWAFLAIITTLILLQLSKSDEKKKTLIPAMLVILTM
FT                   GYLMGYAVSNGNLPLAFSVFLVGGIMLNLYYASMKRRGYVLEDERTLRIEEISARRTLQ
FT                   VFMIGLAFAVIYLSVAQQKNPALRDAFILAEALLVAVMLLHMAFRAYYSRVM"
FT   gene            340294..340500
FT                   /locus_tag="PYCH_04110"
FT   CDS             340294..340500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04110"
FT                   /product="Hypothetical transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04110"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24101"
FT                   /db_xref="GOA:F8AH38"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH38"
FT                   /protein_id="AEH24101.1"
FT                   /translation="MKNRLRELREARGLTQEELAKALGVTRQTIIAIEKGKYDPSLRLA
FT                   FKIARFFGVKIEDVFIYEGDEDE"
FT   gene            340493..340858
FT                   /locus_tag="PYCH_04120"
FT   CDS             340493..340858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04120"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24102"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH39"
FT                   /protein_id="AEH24102.1"
FT                   /translation="MSKKLAGLMVYLLGTGLGIAKPPIERLACMEVPSGDVCTGVNTPL
FT                   LILELGLVMMGALLMGLSHGFKNHHELNGWLGVSSGLGVAIIGSYAGIMELFLLGVTLA
FT                   TLGLLVYKVGRAENAHG"
FT   gene            340845..341573
FT                   /locus_tag="PYCH_04130"
FT   CDS             340845..341573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04130"
FT                   /product="ABC-type sodium efflux pump system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04130"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24103"
FT                   /db_xref="GOA:F8AH40"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH40"
FT                   /protein_id="AEH24103.1"
FT                   /translation="MPMVEVLNLEKDYGKVKALKGISFEVHEGEIFGLIGPNGAGKSTT
FT                   LRILATLLRPTAGKVTIAGYDVVEEAEEVRKLISYLPEEAGAYKNLTGLEYLQFMARLY
FT                   AKDKRRAKEMLELGIRLSGLGDRLGDKVSTYSKGMTRKLLLARALMVKPKLAILDEPTS
FT                   GLDIMNAYEVRKTIKAFAREGVTFLISSHNMLEVEFLCDRVAMISNGQIIEVGTPRELK
FT                   ERYNAQNLEEVFMKAVEGRA"
FT   gene            341570..342832
FT                   /locus_tag="PYCH_04140"
FT   CDS             341570..342832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04140"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04140"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24104"
FT                   /db_xref="GOA:F8AH41"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH41"
FT                   /protein_id="AEH24104.1"
FT                   /translation="MSDFWVIFMKELKHMLRDRGLIFGIIIVPLILYPALGQVVQLGME
FT                   QAQEETKVVIANFDEGPYGALLIKALIAAPNVTVVQINASSVDEALQEAINGDQNVLVI
FT                   IPANFSESIEANEKAVVEVYGIFGGMSLGMRESVSEGRINAVVNVLGEELSKLKLKNFG
FT                   NPEAVLHPIEVRGYSVLRGKIIDMPPSVVANVLASQAFSIPLVIFIMLTLVSQMAAGTM
FT                   ASEKENKTLETLLTLPVSRTAIVAGKMMGTGVMGLIAAIAYMIGMKRYLGTFSQSNISL
FT                   EELGLHVTPLGMALFALTIFLAITFALSLAMLLGIFAEDIRSAGTLVSAVMMPLLFPTF
FT                   IFMVTDVEALPAIIKYALLAIPFSHPVLASRAMLLGDYGHLYVSVAYLAFVSAAMLYVT
FT                   ARFFRTEKLLTARLKFGKKKR"
FT   gene            complement(342864..343709)
FT                   /locus_tag="PYCH_04150"
FT   CDS             complement(342864..343709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04150"
FT                   /product="predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04150"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24105"
FT                   /db_xref="GOA:F8AIR8"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR011589"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIR8"
FT                   /protein_id="AEH24105.1"
FT                   /translation="MIILDNHFHVDPFKGLFLEAVKQFHRAGGTHLVVVYKTAHDYGFP
FT                   GLKAEDFIKAMDFHVELVERINKETPVKAYAVVGVHPAEFVYLAEQKGLEYAKGEVMKA
FT                   LEYAQKLCLEGKAIAIGEIGRPHFDVPSEVWEASIELMKYGMTLAKEADCAVQLHTESF
FT                   DEAKFRELGEIVREVGIKPYRVVKHFSPPLVRVAEEVGVFPSIIASRKNIEEAIRQGNR
FT                   FMMETDYIDDKRRPGAVLGPKTVPRKTKAFLQSGLFREEDVYKIHVENPEKVYGVEMTE
FT                   "
FT   gene            complement(343706..344017)
FT                   /locus_tag="PYCH_04160"
FT   CDS             complement(343706..344017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04160"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24106"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR029459"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH42"
FT                   /protein_id="AEH24106.1"
FT                   /translation="MGLLDRLFGRKIERIQIASREPIGSFRVEDVFRVMGRHVLVGEVL
FT                   GGVIYPGYKVKGEGVAEIYKIQMERREVEFAISGDRVALILEGSLKARKGDVLEVYRA"
FT   gene            344088..344552
FT                   /locus_tag="PYCH_04170"
FT   CDS             344088..344552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04170"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH43"
FT                   /protein_id="AEH24107.1"
FT                   /translation="MQEWYQSRGLYEMVLKLIERGNFETAIQVASTIPDRSMRAKSLAK
FT                   IAVEMAKRGLDYRDALKKAEEAIFSLNGDSVAKFLMSLAFDLLEVEKFEDALEVASLIK
FT                   DISAASKVKAEVALVLAKRGRIEEALRIIKEILDEDVKTWAMSRLATEIS"
FT   gene            complement(344553..345869)
FT                   /locus_tag="PYCH_04180"
FT   CDS             complement(344553..345869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04180"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04180"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24108"
FT                   /db_xref="GOA:F8AH44"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004523"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH44"
FT                   /protein_id="AEH24108.1"
FT                   /translation="MLRTHYSNEITEELNGQRVKVAGWVHEIKDLGGIKFLWIRDREGI
FT                   VQVTAPKKKVSEEVFKLIPRLGSEDVVAVKGIVNFTPKAKLGFEILPEEIIVLNKAEKP
FT                   LPLDPTGKVKAELDTRLDNRFMDVRRPEVMAIFKIRSSVFKAVRDFFQKEGFIEIHTPK
FT                   IIATATEGGTELFPMKYFERDAFLAQSPQLYKQMMMATGLDRVYEIAPIFRAEEHNTTR
FT                   HLNEAWSIDAEVAFIESEEDVMELLEGLVAYTIDYVRENNERELKTLGFELEAPKRPFP
FT                   RLTYDRALEILMDLGKEIPWGEDIDTEGEKLLGKYMIETEEAPLYFICRYPTEAKPFYI
FT                   MKYEDRPEICKAFDLEYRGVEIASGGQREHRADKLVEQIKEKELNPESFEFYLRAFRYG
FT                   MPPHGGFGLGAERLIMRMLNIGNIREVILFPRDRRRLVP"
FT   gene            complement(345918..346430)
FT                   /locus_tag="PYCH_04190"
FT   CDS             complement(345918..346430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04190"
FT                   /product="transcription elongation factor NusA-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04190"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24109"
FT                   /db_xref="GOA:F8AH45"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="UniProtKB/TrEMBL:F8AH45"
FT                   /protein_id="AEH24109.1"
FT                   /translation="MKAPICEVCLKTDGILCPADEKKLQDGVITELDVKISRMLYKLLG
FT                   DADVEFRKAVEAGDLVVLIVGEGDVPVVIGKGGKNIKLLMRELGKRVRVIEGREIKGTD
FT                   DVKKLATDLLYPAGVFGVNIVYKPGGGQYYKVLVLGRDKNKLPEKAEVLENILTQITGM
FT                   ETKIAFL"
FT   gene            346559..348436
FT                   /locus_tag="PYCH_04200"
FT   CDS             346559..348436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04200"
FT                   /product="threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04200"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24110"
FT                   /db_xref="GOA:F8AIR9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015011"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIR9"
FT                   /protein_id="AEH24110.1"
FT                   /translation="MRVLLIHSDYIEYEVKDKALKEPEPIPEEMKKGRMEEVLVAFISV
FT                   EKVDEKNPEEVVARAVKEIVEVAEQVKTKNVFVYPFAHLSSELAKPSVALEVLKKVEEG
FT                   LRNAGYNVGRAPFGYYKAFKLSCKGHPLAELSRTIVPEGIVEEEVPEALKKEETELVSY
FT                   WYILTPEGELIEVDKFDFTGHENLRKFVNYEIAKNRIAEREPPHVRLMLEQELVDYEPG
FT                   SDPGNLRYYPKGRLIKSLLEQYVTEKVIEYGAMEVETPIMYDFEHPALEKYLNRFPARQ
FT                   YIVLSGDKKYFLRFAACFGQFLIKKDAIISYRNLPLRMYELTRYSFRREKRGELSGLRR
FT                   LRAFTMPDMHTLAKDIEQAKEEFKKQFKLSMEVLEGVGLTPEDYEVAIRFTEDFWKENR
FT                   NFIVELVKIIGKPVLVEMWKQRFFYFILKFEFNFVDNLDKAAALSTVQIDVENAERFGI
FT                   TYYGENGEEKHPLILHCSPSGAIERVMYAILEKQARLMAQGKKPMFPLWLSPIQVRVIP
FT                   VSGEYLDYALYIAGKLEGAKIRVDVDDEDDRLNKKIRKAEKEWIPYIVVVGQREKENGT
FT                   ITVRRRSDGKQYETRIEELIREIKSQTEGFPYKPRPLPLLLSMRPKFRG"
FT   gene            complement(348426..349169)
FT                   /locus_tag="PYCH_04210"
FT   CDS             complement(348426..349169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04210"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24111"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHB4"
FT                   /protein_id="AEH24111.1"
FT                   /translation="MEKEEANEVLEVFKITPEPGTVVSIIHDTYSAGWQIFFGIIAELL
FT                   EKGYFPVISNYNLPLPNLFKRASAVGLNMRRELENDKMAIIDVFGSKYGLTYDFKNTYY
FT                   LQGVDPDTLNPKISMIYDMLRPKMKGKELIRAVYTLGGAAMMLGEEEVLKLLSITVAQR
FT                   IIQFPNSILLMLMNRDVLSKRFIAWVSEMSDYVIVTRSELTSEGIMERLYVVKSPSEGF
FT                   MPSAYRLHIAEEKTKERIRVERLSP"
FT   gene            complement(349254..350324)
FT                   /locus_tag="PYCH_04220"
FT   CDS             complement(349254..350324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04220"
FT                   /product="translation initiation factor IF-2B subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04220"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24112"
FT                   /db_xref="GOA:F8AHB5"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHB5"
FT                   /protein_id="AEH24112.1"
FT                   /translation="MLKYRPEELTKLPRSVEYKAGTVYIIDQTKLPAEFKIIALRTVEE
FT                   VAEAIKTMKVRGAPAIGATAAFGLALYAETSKAKTKEDFFAGFYKAYETLKNTRPTAVN
FT                   LFWALNRVKELAEEHREDSLDEIKRLIVEEAQRIADEDVEANLRMGHYGAEVLPEGNVL
FT                   THCNAGSLATVHLGTVGAVLRVMHKEGTLKLLWVDETRPVLQGARLSAWEYSYDGIPLK
FT                   LIADNAAAFVMQQGKVDAIIVGADRIVANGDFANKIGTYMLAVLAREHGIPFFTVAPLS
FT                   TIDMSLKSGKDIPIEERSPEEVLRCGGCRVAPDVDVYNPAFDVTPHKYLTGIITDRGVV
FT                   WPPFKRNLKKLFGEIY"
FT   gene            complement(350416..351855)
FT                   /locus_tag="PYCH_04230"
FT   CDS             complement(350416..351855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04230"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24113"
FT                   /db_xref="GOA:F8AHB6"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHB6"
FT                   /protein_id="AEH24113.1"
FT                   /translation="MVPLKRIDKIRWEIPKFDRRMRVPGRVYADEVLLQKMKQDRTLEQ
FT                   AANVAMLPGIYKYSIVMPDGHQGYGFPIGGVAAFDVNEGVISPGGIGYDINCGVRLIRT
FT                   NLTEKDVRPRIKELVDTLFKNVPSGLGSQGRVRLHWTQLDDVLADGAKWAVDNGYGWER
FT                   DLERLEEGGRMEGADPNAVSQRAKQRGAPQLGSLGSGNHFLEVQVVDKVFDPEIAKAYG
FT                   LFEGQVVVMVHTGSRGLGHQVASDYLRIMERAVRKYGLPWPDRELVSVPFQSEEGQKYF
FT                   SAMKAAANFAWANRQMITHWVRESFQEVFRQDPEDMGMEIVYDVAHNIGKVEEHVVNGK
FT                   KVRVIVHRKGATRAFPPGHEAVPKVYRHVGQPVLIPGSMGTASYVLAGTEGAMEETFGS
FT                   TCHGAGRVLSRKAATRQYRGDRIRQELLQRGIYVRAASMRVVAEEAPGAYKNVDNVVKV
FT                   VSEAGIAKLVARMRPIGVAKG"
FT   gene            complement(351892..352572)
FT                   /locus_tag="PYCH_04240"
FT   CDS             complement(351892..352572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04240"
FT                   /product="Putative effector of murein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04240"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24114"
FT                   /db_xref="GOA:F8AHB7"
FT                   /db_xref="InterPro:IPR005261"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHB7"
FT                   /protein_id="AEH24114.1"
FT                   /translation="MPETFGIFATLLLYWLFSGLYARKRSPLLNPVLLSIAAIATFLWI
FT                   SGIPYEDYMASARFLSFLLGPAVVSLAVPVYKQRRIIAEYGKEIAVGIAFGCLTAFFSV
FT                   YLIAKGLGAGEDILRSLAPKSVTTAIAVGVSEKIGGIPALTAVFVILTGIMGNAFGVEL
FT                   MKFLRIRDRVARGLAMGVTSHGLGTARIILDDELSGAVSGLAMALNGVLTAVILPYLLR
FT                   LLNL"
FT   gene            complement(352565..352909)
FT                   /locus_tag="PYCH_04250"
FT   CDS             complement(352565..352909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04250"
FT                   /product="LrgA"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04250"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24115"
FT                   /db_xref="GOA:F8AHB8"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHB8"
FT                   /protein_id="AEH24115.1"
FT                   /translation="MFRGLAIIFGFLFLGQLLEETFNLMAPGSVIGMLFLLLALLTGLV
FT                   KLEHVEREAEFLVRNMSIMFIPPGVGIIAYAGLLKGNIVPVSLALVGSFLLTLSLTGKL
FT                   VELVRGGGNA"
FT   gene            352977..353366
FT                   /locus_tag="PYCH_04260"
FT   CDS             352977..353366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04260"
FT                   /product="predicted thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04260"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24116"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHB9"
FT                   /protein_id="AEH24116.1"
FT                   /translation="MEQRTHLLTSREFVGEPLELKPGYARVRLKTREDMKVDEKGLVHG
FT                   GFTFGLADYAAMLAVNEPTVVLGKAEVRFTRPVKVGDELVAEAKVVEDLGRKKIVWVEV
FT                   FRREGEKVLEGTFHCYVLEKHVLEM"
FT   gene            complement(353374..353763)
FT                   /locus_tag="PYCH_04270"
FT   CDS             complement(353374..353763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04270"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24117"
FT                   /db_xref="InterPro:IPR027391"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHC0"
FT                   /protein_id="AEH24117.1"
FT                   /translation="MDVKKLLIEGYGYAPDLIYEVRNDRVYAYKGCKFGEKGHQGVYFG
FT                   KIEKDGIRLTIEGAFLVGPKATKNVIELDDKRALAWLKGEDVPVNVKGRAWVILKWKDY
FT                   WLGGGRLVDGVVKNYVPKERRLVDK"
FT   gene            complement(353774..354283)
FT                   /locus_tag="PYCH_04280"
FT   CDS             complement(353774..354283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04280"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24118"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHC1"
FT                   /protein_id="AEH24118.1"
FT                   /translation="MVMGGTVSKVVRFDDEEEFLEEMKATMEVLDELSMKYGGARVIEG
FT                   LILWDSIAVRDDEDVKVFRIGQFQFVRGALKLDIEPLMKLERFMDEMESKRDELSVEDI
FT                   RYFVDIMNEALGEERVYYDAYDLGLDRNEAYMIINLRALQYLDHVVDVEDREAFEWALN
FT                   TLMKYL"
FT   gene            354345..355145
FT                   /locus_tag="PYCH_04290"
FT   CDS             354345..355145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04290"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04290"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24119"
FT                   /db_xref="GOA:F8AHC2"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHC2"
FT                   /protein_id="AEH24119.1"
FT                   /translation="MKVALRIAYDGTQFHGFQRQPSLRTVEGELLRVLEEVGLEPVDFK
FT                   GASRTDKGVSAFGNVVAFTVPDDAAHLVKPRVLNARLEDVWVLGVAKVPKDFHPRFWAK
FT                   SKVYRYYLVGWGLNVGAMRECAALFVGEHDFSAFARLDGRDPVRRILRASVEERGPIVV
FT                   VEIEGESFLWEMVRRIVTAVRLCGEGKLELGDVEAMLRGEFEESRKLPPAPPEGLVLWA
FT                   VKYEGVEFEVDAYTVELVRKELFERFSAAAVRAAIFEDFLRQLY"
FT   gene            355176..355643
FT                   /locus_tag="PYCH_04300"
FT   CDS             355176..355643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04300"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24120"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHC3"
FT                   /protein_id="AEH24120.1"
FT                   /translation="MKVEGLVASLRNAETIKELFTILRKKGAPVIELDGERFLIVVEGD
FT                   FEGKPFWTEINGVKANMALGDAMLNSASVPFKCKRPYTGGNLILVRTSEIEASEFLIAY
FT                   RDGGVLYFHVKDGEVKEISSQEYEALKEKMPEFKVRSFSDEQMEGMGAFFG"
FT   gene            355710..355913
FT                   /locus_tag="PYCH_04310"
FT   CDS             355710..355913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04310"
FT                   /product="Sulfur carrier protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04310"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24121"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHC4"
FT                   /protein_id="AEH24121.1"
FT                   /translation="MIRVKVIGRGIEREIEWREGMLVRDVLKAVGFNTESAIAKVNGKV
FT                   ALEDAPVRDGDFVEIIPVVSGG"
FT   gene            356015..356236
FT                   /locus_tag="PYCH_04320"
FT   CDS             356015..356236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04320"
FT                   /product="Predicted RNA-binding protein, containing TRAM
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04320"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24122"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHC5"
FT                   /protein_id="AEH24122.1"
FT                   /translation="MYGGRFGDRERFEAPVKVGERYRVRIESIGKGGDGIARIKGFVVF
FT                   VPNTKVGEEVEIVINSVKRRFAFAEVIG"
FT   gene            356237..356899
FT                   /locus_tag="PYCH_04330"
FT   CDS             356237..356899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04330"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04330"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24123"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHC6"
FT                   /protein_id="AEH24123.1"
FT                   /translation="MRFWMGRMALNRLLPLVLILFVGSSLGEPHSVKIYFEAHDVSPLY
FT                   KAEVERILNELDGLDVLVFVIPNHGGVADLRRHRDFATKLGKYRVVLHGYEHRPGECDL
FT                   EAVEKGLKVLRAVNLTSDYFAPYDYDYTSSCLEALGAFNLTPLTERYMGGEFCPYREYT
FT                   WYTPSFLKPVLVALFRSDLQAFPCLRVGVHPRAVDSSWEAFEEIVEVAKRLNNRTGN"
FT   gene            356904..357944
FT                   /locus_tag="PYCH_04340"
FT   CDS             356904..357944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04340"
FT                   /product="diphthine synthase, DPH2 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04340"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24124"
FT                   /db_xref="InterPro:IPR016435"
FT                   /db_xref="InterPro:IPR022428"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHC7"
FT                   /protein_id="AEH24124.1"
FT                   /translation="MLHEVPFEEVLSDLRRLGARRVLIQSPEGLRREAEELAEFLEREG
FT                   IEAILHGEVNYGACDPADAEAKRLGCDALIHLGHSYMRLSLEVPTIFIPAFARVDVVLA
FT                   LERNLREIKKLGRRIILVTTAQHIHQLRRARAFLEKAGFKVVIGRGDSRVSWPGQVLGC
FT                   NFSAARLDGDGILFIGAGTFHPLGVALATGKRVLAVNPYSGDALWMDEMAERFIRKRWA
FT                   QIAKAMDARRFGVVVSTKKGQLRLAEASRIVRLLREHGREAMLIAMDEISYSKLEGFSF
FT                   DAYVVVACPRVPIDDVENWRKPVLTPPEVEILLGLRTDYKFDEIRGRERDKDEPLGPSV
FT                   HGPGAR"
FT   gene            357901..358305
FT                   /locus_tag="PYCH_04350"
FT   CDS             357901..358305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04350"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24125"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHC8"
FT                   /protein_id="AEH24125.1"
FT                   /translation="MNPSVQASTGPVPADLFLLALAFLLYYTFLKTSVEVFTYRRPSLR
FT                   FLIPATILGTFITLYLDIFLGLIFLLIALLLWRLGFREAFVTALTAEFGFLVSFIVVVF
FT                   FLTLFGTIAGIEGLELNVDWDELLHIFRGP"
FT   gene            complement(358292..359047)
FT                   /locus_tag="PYCH_04360"
FT   CDS             complement(358292..359047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04360"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24126"
FT                   /db_xref="GOA:F8AHC9"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHC9"
FT                   /protein_id="AEH24126.1"
FT                   /translation="MVKRDEVVTFLDEYLNIAIYPDKSRNGLQVEGKEEIDTIAFAVDA
FT                   CLDTIMKARTFKADMLIVHHGLVWGGIDYVRGLIARRLKALLKADINLYVAHVPLDAHS
FT                   EVGNNAQLLKLLGLEPKEAFGEYKGIKIGFIGEFKDPKPLPLIAQILAEKLPVDYVRSY
FT                   EFGLQEIKRVGAISGAGGFALEEAAEKVDLFITGEFTHADYRTAEDLRLSVIAAGHYAT
FT                   ETLGVKALMPILRERFGVRTIFIDSPTGL"
FT   gene            359161..359553
FT                   /locus_tag="PYCH_04370"
FT   CDS             359161..359553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04370"
FT                   /product="30S ribosomal protein S8e"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04370"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24127"
FT                   /db_xref="GOA:F8AHD0"
FT                   /db_xref="InterPro:IPR001047"
FT                   /db_xref="InterPro:IPR018283"
FT                   /db_xref="InterPro:IPR020919"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHD0"
FT                   /protein_id="AEH24127.1"
FT                   /translation="MAIWQGRSLKKPSGGRIILARKKRKRELGREPANTRVAEKDQRKI
FT                   IRTYGGNRKVRLTAAAYANVFDENGRGRKVKILRVIENPANRQFARRNIITKGAIIETE
FT                   IGKARVTSRPGQDGVVNAVLIKEEKA"
FT   gene            359641..360558
FT                   /locus_tag="PYCH_04380"
FT   CDS             359641..360558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04380"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24128"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHD1"
FT                   /protein_id="AEH24128.1"
FT                   /translation="MESEYSRAEKLFATLFVVFLLLASINFLRELDGIPARPSYSYYEA
FT                   KYGVDELRDNQSRLMVLERELLRTYQKFKDNLTEAERVYLFKREEYRLAIESGNATEVL
FT                   KREYLQAKENYERAYAKYLAAKSAYEEVSQQLAELNARINELSARAWEEYNREYQLYRL
FT                   KVLALKLLFALPIFIASFLLFRKRRNIYTTSLIAYSSLLLVYLILSVIWSTVQVIGLSL
FT                   FGAGASAVALYYLRKEYFRPERVYRRRIWQNRCYRCGFPVKDDYLYCPNCGTRLKEKCE
FT                   NCGAMKPLYLDFCPYCGVDAEKEP"
FT   gene            complement(360578..361645)
FT                   /locus_tag="PYCH_04390"
FT   CDS             complement(360578..361645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04390"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24129"
FT                   /db_xref="GOA:F8AHD2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007549"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHD2"
FT                   /protein_id="AEH24129.1"
FT                   /translation="MYELTEDLKLRRITKYELDGVEEREDLLVIPPSSKAGPCGNACVF
FT                   CYLLQNPPAMIYRVARHDTLNDPHLEARIRYAREHYDLWIRVTDTAGNVRFDERRIESL
FT                   YSAGLDEIQISVHTTKKDVRIKLMRNRHAGKLIDLLSTATKHFRVIADIILTPGYNVDD
FT                   IGEIIEDLDAMGVHEVRLFPVGVTKFNRDVRPLMRDELLYVKETALQKDKELDIEVVLP
FT                   PIFLALLGEFTTGLEPFDVEPEFPTYVLTGELAYPEMKRLFPKLSVIPVKNEFFGGNIG
FT                   TAGLLTGADVLRTVRELPDVDLGLLLLPELMFYGEMTLDGWRRDQLFTKILTEKGYIVE
FT                   TALEPQDIPKILEKL"
FT   gene            complement(361673..362536)
FT                   /locus_tag="PYCH_04400"
FT   CDS             complement(361673..362536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04400"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24130"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHD3"
FT                   /protein_id="AEH24130.1"
FT                   /translation="MGALKAFGDAVNFTLRNPRLALIPLLIALILAPMSAYIQRDIEPF
FT                   SPMERGKEIEGIIIEEHGATGEMGLENLWPLLFLLLLSLLLNSAAQYSVIYGALRAGEG
FT                   KDVPLSELFVKGLEHIVQVFGINVLTTIIVAAAAIAAGLPFLMLVIGGAFVNSNSLMLA
FT                   GVILLLIVEVIILPFLVGASSMTVPAYVVKGSFGSFIDGFAVAWKNKLSSMGFGALLLI
FT                   FIMAIVIAPAAIVAIILLASQGLTARIVAALIQAPFQAVAQTFASVAGLFLYLELKEEL
FT                   ERADNL"
FT   gene            complement(362571..362957)
FT                   /locus_tag="PYCH_04410"
FT   CDS             complement(362571..362957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04410"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24131"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHD4"
FT                   /protein_id="AEH24131.1"
FT                   /translation="MMGVVLAGLGILAIIVFLVALFIAGLFMYLGAKLAGIEKASIGKG
FT                   MLAVLAGSILGVIVGFIFGMIPILGMILGPLMAFIAYVWVVKAIFSTGWLKAFIATILA
FT                   IVIEIVTFFLLGALLGAGLWALAF"
FT   gene            363053..363129
FT                   /locus_tag="PYCH_t30"
FT   tRNA            363053..363129
FT                   /locus_tag="PYCH_t30"
FT                   /product="tRNA-Ala"
FT   gene            complement(363155..364567)
FT                   /locus_tag="PYCH_04420"
FT   CDS             complement(363155..364567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04420"
FT                   /product="Multi antimicrobial extrusion protein MatE
FT                   (matE)"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04420"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24132"
FT                   /db_xref="GOA:F8AHD5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHD5"
FT                   /protein_id="AEH24132.1"
FT                   /translation="MKSDKIRRMREEIVSGPIERTLLKLAYPLIASNLVQVLYNMADTF
FT                   WLGKLGREALAAPGTTWPVIGTLMHFGTGFAMAGFAFVGQYVGAEKYERANRAAGALYS
FT                   LMLIFSMMTAIISLLVLPYALSFMRVTPNVLPYAKTYATIIFIGVPFSFTFMAFNALMR
FT                   ATGDTKTPVKISMFTVFLNIILDPIFIFSLGMGVAGAALATVFSNAVGAVIGAYLMMTG
FT                   RVGLRITRENMRPDWSFYGRIFRVGLPSSIGDSANSFGFVVLTRIIYGFGDVTYAAYVI
FT                   TTRLVNFITSIARGISMAMGAMVAQNVGAERYERAKKIAERTMLINFGIASFAVLTIGF
FT                   FRVPIFKVFLDDPAVIAESEIVLKYFLISVPFFNGIFVVVRRVFSSAGHTKKSMLLGIL
FT                   RLWGLRIPLSYAFGYIPAVTILGFTMPLGELFGMTSRGVFFGMGMSNFLAALVGLAWFL
FT                   RGSWMKRIIEED"
FT   gene            complement(364564..365931)
FT                   /locus_tag="PYCH_04430"
FT   CDS             complement(364564..365931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04430"
FT                   /product="Multi antimicrobial extrusion protein MatE
FT                   (matE)"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04430"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24133"
FT                   /db_xref="GOA:F8AHD6"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHD6"
FT                   /protein_id="AEH24133.1"
FT                   /translation="MRQDRIDAMRYEIVEGHIERTLIRLAWPLIINNMVQVLYNLTDTF
FT                   WLGKLGKEQLSAPGTAWPLVWFIMSLGMGFATAGFAFVSQYIGAQEYEKANKAAGALYS
FT                   LMLIFSIAVAVIGVLITPFAMKFMNVTSEVYPYAVNYTRVIFLGIPFSFTLFAFNFLLR
FT                   AVGDTKTPVKINIFTVFLNIILDPIFIFGWFGFPKLGVVGAAVATMLSNTVGSLIGGYL
FT                   LFTGKVGIHITSETLMPDIELYFKMFRVGLPASVGGSTDAFGFVVLTRIIYTYGTVAFA
FT                   TYSITNRLTNFMFAFANGISQAMGTMIGQNVGAERYERAKKIAERAMLINLIILGLGTA
FT                   IIVIFRAQIFSFFIKDEAILAESVKVVRYFSASLPFFGIFSAVTNVFQSSGHTKKSMIL
FT                   GMLRLWGLRIPLSYSLGKVMGDSTGVWIGMGLSNVISALIGFAWFLRGSWMRRIVE"
FT   gene            366029..367486
FT                   /locus_tag="PYCH_04440"
FT   CDS             366029..367486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04440"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24134"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHD7"
FT                   /protein_id="AEH24134.1"
FT                   /translation="MLKTKRESFGIGNDKGYKSWGEVEFAGSKYFEVVSMAEKKRKRVV
FT                   ILGAAGRDFHNFNVFFRNNPDYEVVAFTATQIPDIEGRVYPAELAGELYPNGIPILPED
FT                   DLEKIIKEKDVDIVVFAYSDVSHEHVMHLASRAHSAGADFWLLGPKSTMLKSKKPVVAV
FT                   TAVRTGCGKSQTSRKVAQLLQEMGFKVVAVRHPMPYGDLRKQVVQRFATFEDLDKHECT
FT                   IEEREEYEPYLERGMVVYAGVDYEKILREAEKEADIILWDGGNNDFPFFEPDLWIVVTD
FT                   PHRPGHELKYHPGETNFRSADVIIINKVDTANRDDIQKVRENIEKINPNAIVIEAASPI
FT                   FVDNPELIKGKRVLVVEDGPTLTHGGMSYGAGYIAAKKFGAKEIIDPRPYAVGSIIETY
FT                   KKYPHLSNILPAMGYGKKQIKELEETINRADADVVIMGTPVDLRRFMNLNKPAVRVKYE
FT                   LEEIGQPKLKDILEEWVKNCEKLKKKE"
FT   gene            367573..368175
FT                   /locus_tag="PYCH_04450"
FT   CDS             367573..368175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04450"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24135"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHD8"
FT                   /protein_id="AEH24135.1"
FT                   /translation="MRLLIIAPCLLSPFYVYRGPKEKELRTATEIRRLLAEFGDDWHVL
FT                   AYPCPEFELLGWPRPPMSREVLEALGIREKVEVIADFIGRVLTEEKPETVVFVGVKGSP
FT                   TCGVFTSTSSDPEEYPIEEVRHFFYLSKGERLVTYGDIIERAGLKLVNGEGGLFAELRH
FT                   RFGNMEAVWLEFDKDNIGGSILRLQKVLKGLEERPKS"
FT   gene            368244..369539
FT                   /locus_tag="PYCH_04460"
FT   CDS             368244..369539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04460"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24136"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHD9"
FT                   /protein_id="AEH24136.1"
FT                   /translation="MVVEEVLASVSSIPDPYLRIVTYGRIGVSLAKSKDPRYEKAFRLA
FT                   LSELARIDDPYILLRSLLALAYSTSLAGFKSAKKAFREVMESSKVLPKPLRDSLRIEAV
FT                   KYLLALGEVEEALFYTLEIEDKKARNETLLAVLKRALRELSGDKMNRLYRRRKIQLILE
FT                   HVTDEPYRSMAIVETIKAFLSVGEYEKAIHLVETIGNRHWLKQALREILVHLRRSRVGK
FT                   EYAEKLIILSLNIAKRLGEDIRDDMAFIFAAYGYPEYSIQLLRGSPKWEERLKEILEML
FT                   FKRDMTLLIDYVSALPEDMLPALKHLMNIILDEPLGEYKPVVDALVQKEPPQDILTKAT
FT                   AYYLKVGALPDAVKVISKITDERLRSLALGWLAHYLIKVGRISEAVDVVLQIRDRNLAA
FT                   RLASEILVRVVEEREKDGIAEPTKEWRKEREA"
FT   gene            369490..369771
FT                   /locus_tag="PYCH_04470"
FT   CDS             369490..369771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04470"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24137"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHE0"
FT                   /protein_id="AEH24137.1"
FT                   /translation="MELLSRLRSGGKRERLEFAVGLLEHLLMDGDAPLEDSLDELYRLL
FT                   KEMLLADCNSNILEAFEEIVLARYALSKKPPVERHLQKAHEVLREYLG"
FT   gene            369777..370178
FT                   /locus_tag="PYCH_04480"
FT   CDS             369777..370178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04480"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24138"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHE1"
FT                   /protein_id="AEH24138.1"
FT                   /translation="MVEKISFRTSREVEIIDITGKVADIVKRSGVGSGIALVFTKHTTT
FT                   AVIINENEPGLLGDLEELLSRLVPRGAGYRHDRIDDNAHSHLRGILLGPSVAVPVEEGR
FT                   LLLGTWQRILFVELDGPRNREVYVKVCRC"
FT   gene            complement(370175..370444)
FT                   /locus_tag="PYCH_04490"
FT   CDS             complement(370175..370444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04490"
FT                   /product="molybdopterin converting factor, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04490"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24139"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010038"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHE2"
FT                   /protein_id="AEH24139.1"
FT                   /translation="MKVRVRYFARFRDLAGVGEEDVELPEGATVRDLIELIKDRHPRFK
FT                   DEVFGEGHDEDADVNISVNGRYVDWDQELHDGDVVGIFPPVSGG"
FT   gene            370509..371864
FT                   /locus_tag="PYCH_04500"
FT   CDS             370509..371864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04500"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04500"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24140"
FT                   /db_xref="GOA:F8AHE3"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR019293"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHE3"
FT                   /protein_id="AEH24140.1"
FT                   /translation="MRDLRPYVKTALTIAGSDSGGGAGVEADLKTFSAFGVHGLVAVTA
FT                   VTAQNTNSIIAVHEVPPEVVVKQIEAVAEDIGVDAAKTGMLSNAEIVRAVARTLKRYDF
FT                   PLVVDPVMVSKTGVTLLTEGAIGVLVDELFPRATLVTPNRFEAEKLSGMTIRTLEDARR
FT                   AARAIAEETGAEGVIIKGGHIEGGDAVDVLYYQGHFREYRAPRVEGCTHGTGCSFSAAI
FT                   TANLAKGLSLEEAISLAKEFITLGIVTGHRIGHGHCPVNPIAWLEIPAEKWRVYEALKK
FT                   AVREFERMNPVALIPEVGANFVYALPKPYARDKKDVAGVKGRIVRYGRSVKAVGPVEFG
FT                   ASDHLARAVLRFMDFHPEVRSALNLRYSEGLVEKAEKVGLVVSFYDRREEPPEVKAREG
FT                   ATIPWGIETAIRRAGRRPDLIYHLGDWGKEPMAIIFGETPQDVLRKLSLLLK"
FT   gene            371910..372200
FT                   /locus_tag="PYCH_04510"
FT   CDS             371910..372200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04510"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24141"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHE4"
FT                   /protein_id="AEH24141.1"
FT                   /translation="MTRRERIIELLLERDYSVSELARILEIKGKGARKAIIEELKAISR
FT                   IAKRERMTLLVRPAQCRKCGFLFKPEINVPSRCPRCKSEWIEEPRFKLERR"
FT   gene            complement(372181..372558)
FT                   /locus_tag="PYCH_04520"
FT   CDS             complement(372181..372558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04520"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24142"
FT                   /db_xref="GOA:F8AHE5"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR021568"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHE5"
FT                   /protein_id="AEH24142.1"
FT                   /translation="MELDRGLAKLGDAIVNFLFSLALTEFLGRPTGDRVPNASLAIALD
FT                   LAGLSKDLKRMDKHGKGDYAEALIAKAWLNGLLNVEEAVRIIRENLTEDVTDFSKKKEA
FT                   IGRALAPLLKLIAERITFAQA"
FT   gene            complement(372563..373699)
FT                   /locus_tag="PYCH_04530"
FT   CDS             complement(372563..373699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04530"
FT                   /product="alchol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04530"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24143"
FT                   /db_xref="GOA:F8AHE6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHE6"
FT                   /protein_id="AEH24143.1"
FT                   /translation="MRGFFFLNTKVVLGRESLSYLEKALRGKERVLFLSSRSMRTHGFL
FT                   KEAMDYAEEAGALVEAITSVPAEPTIDAVEELLPKVREFSPDALVAIGGGSVIDVAKAV
FT                   KVFYDVPDVEFDKVAFFSRFQRPEPLPKLRTPLIAVPSTSGAGSEVSAATVIKKDGIKY
FT                   TIVSPEITPDVAILDPRLPEKMPPEVAKNSGLDVLVHAIEAYVSKAATPFSDAMAIKAA
FT                   LTVFESLERSVKRDTEAREAMHYAATMAGIAFLNGRLGLVHAMSHKAAWMGPHGLLNAI
FT                   LLPYVMEFNMARARELYERLARELGLRDAGELLERVRELNEALSVPMLSELAEEDVFME
FT                   RLDEMSRKAYEDPLVSFNPVEPKVDEIREIYLRAFRGE"
FT   gene            complement(373701..374378)
FT                   /locus_tag="PYCH_04540"
FT   CDS             complement(373701..374378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04540"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24144"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR029125"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHE7"
FT                   /protein_id="AEH24144.1"
FT                   /translation="MVGVRFKELDEKLKKVYAKVRGLDDYYWSIQDGEVRGIHKRSGMR
FT                   VRIRIAEGREHADKMSREKEVGVIDLIVIPGKGTFYLNNGTFIMSLKFLRPTLQDVSDH
FT                   IVWSGFKVVEKDGALVQEDFYEYLGGRLIEHLKRNMIGGRDYVFWQFYRCPYCNKYVDI
FT                   ESLPRHMKAHGEDVKEWSEEKYEVLEINFADGKVYNKFGKEVPMEEFSEEAVDFIKESF
FT                   EEE"
FT   gene            374579..375613
FT                   /locus_tag="PYCH_04550"
FT   CDS             374579..375613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04550"
FT                   /product="ABC transporter tungsten-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04550"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24145"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHE8"
FT                   /protein_id="AEH24145.1"
FT                   /translation="MNKGANTLVLLVLLLAGLSYGCIGSTNGTQTATEKPKVLTISTTT
FT                   SLYDTGILENVIAPIFKEKYNIELRFIPKGTGGAILDAKSGASDAILVHALPKEQAFME
FT                   EGYGVNRKVFAYNFFVIVGPKDDPAGIRGLSVSEALKKIVEYGRAHPDKIVWVSRDDGS
FT                   GTNTKEIALWKNAGFDFNELKNESWFGTTGSGMGNTLLYTSERKAYTISDIGTYLKYQK
FT                   EGKINLDVLVDKGEELINVYAIIIINPKKIPGKDFEGAMLLAQWLTSDEGQKAIAEYGK
FT                   DEFGRPLFYPAVPVLKNQQGDVFKWIIKYGFMKDGDKYTECPEKFRYQPKYDFFEFPAS
FT                   VVEG"
FT   gene            375653..376360
FT                   /locus_tag="PYCH_04560"
FT   CDS             375653..376360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04560"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04560"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24146"
FT                   /db_xref="GOA:F8AHE9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHE9"
FT                   /protein_id="AEH24146.1"
FT                   /translation="MAWDYIIQGFSEAVKLIDDPYVIEIAIRSIKVSGIATLMAVAWSL
FT                   PISVLLGLKDFPGKWLVKTLINGLMGVPTVIWGLVLYLMFVPLGPLGSLGLLYTEMGIS
FT                   VGQALLITPIIMSIVVNSLESIEGEIRELALTLGADEIRASFQVVRESIGGIVLAIIAA
FT                   FNRAISELGIALMIGGNIYVRGGVYNTRVLTTAIQMYTVRAEISIAIALGIILMGIVLA
FT                   VNLLSNLVRKWLE"
FT   gene            376357..377079
FT                   /locus_tag="PYCH_04570"
FT   CDS             376357..377079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04570"
FT                   /product="ABC transporter, ATP-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04570"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24147"
FT                   /db_xref="GOA:F8AHF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHF0"
FT                   /protein_id="AEH24147.1"
FT                   /translation="MSLVRISNISKSYEGKKVLDGINLEVKKGEIFCVMGHSGAGKTTL
FT                   LRILALLERPDSGEYVFDGKPVNWSRPGELRKSITMVFQTPVMFNTTVFKNIAYGLKLR
FT                   GYSKAEIEKKVHEVLSLVRLKGYEKRKAKTLSGGEKQRVAIARAIVLEPKLLLMDEPTA
FT                   NLDPTNSAIIEDIVREITKENGTTIVFSTHNMFQAKRLADRVAHMYAGRIVEVGKTKEV
FT                   FERPKSELTKRFINGELF"
FT   gene            377132..377293
FT                   /locus_tag="PYCH_04580"
FT   CDS             377132..377293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04580"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24148"
FT                   /db_xref="GOA:F8AHF1"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHF1"
FT                   /protein_id="AEH24148.1"
FT                   /translation="MKITESFAVGPFRKGEHEFTSVDIAKTVGSAIYDRLSRYEKPRSE
FT                   FRSSWHDF"
FT   gene            377786..378568
FT                   /locus_tag="PYCH_04590"
FT   CDS             377786..378568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04590"
FT                   /product="Predicted AP endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04590"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24149"
FT                   /db_xref="GOA:F8AHF2"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHF2"
FT                   /protein_id="AEH24149.1"
FT                   /translation="MKVGVNSYIIREISGHGFSVDELPVDVVELGFDDTPVLSEEGIDW
FT                   EVLHGILSLDINFTIHAPCSDGKNVSIDLGVNSRRNIRIMENVFKIAQLLDARYVVVHG
FT                   GDIRESYHKAFINTRKQLMEIATIAEDYGIKLVVENLTDNRIGAFPHELLPFLEENVSV
FT                   CFDIGHAFLTSMKYGININEYFLLPGIEHVHLHDNNGVRDEHKAMGEGCIKFDTLLFRV
FT                   LSHKPKNVIWEIRDYWIKENILKSILSVKKAKPMKVGI"
FT   gene            378690..379235
FT                   /locus_tag="PYCH_04600"
FT   CDS             378690..379235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04600"
FT                   /product="pyrazinamidase/nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04600"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24150"
FT                   /db_xref="GOA:F8AHF3"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHF3"
FT                   /protein_id="AEH24150.1"
FT                   /translation="MPEEALIVVDMQRDFMPGGALPVPDGDRIIPRVNEYIRRFREKGA
FT                   LIVATRDWHPDNHISFRELGGPWPRHCVQNTPGAEFVVELPADAVIISKATEPDKEAYS
FT                   GFEGTNLAGILKEKGVRRVYICGVATEYCVKATALDAVKHGFEVYLLKDAVKGIKPGDE
FT                   EMAIREMEEAGVKILPSL"
FT   gene            complement(379213..380193)
FT                   /locus_tag="PYCH_04610"
FT   CDS             complement(379213..380193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04610"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24151"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHF4"
FT                   /protein_id="AEH24151.1"
FT                   /translation="MKCETVVWIAIGIVILYMAFRIIGTFFSPLFFAFVTAYALYPVHT
FT                   RLSEKIGSKTSATLLLLILLSCGIGTLLLLVYTLTPLISEAYEYLRDAERLVSGLKLPL
FT                   GLSDAISSITTQMMGGLQDFLLSFTFSIPKYLLQLVVYLSFVYFFLVRGRELVDLLRFQ
FT                   NERLNRIIERGNLTLQALIRAWLLLNIAKGILMTLGFLIFRVSDLPTALLAGLLTVFFS
FT                   FVPLFEGWMIWVVGAFYLFRAGRVLTALAFAIYGFIFVSPLPDFTIRPRIVAREAKFNE
FT                   IIVLIGMIGGTWGLGLKGLIIGPIVLNVAIEILREWKSLKGKEVS"
FT   gene            complement(380183..380515)
FT                   /locus_tag="PYCH_04620"
FT   CDS             complement(380183..380515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04620"
FT                   /product="histidine triad protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04620"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24152"
FT                   /db_xref="GOA:F8AHF5"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHF5"
FT                   /protein_id="AEH24152.1"
FT                   /translation="MTHHDDLTEEEKVALIRGIELAMKALSLVLSPNGFNIGINIGETA
FT                   GQTVEHIHVHVIPRYRGDCRHPRGGVRKAVLDIEDENLAGDKERWLRNRLGEKEIRALR
FT                   RALNEM"
FT   gene            380735..380812
FT                   /locus_tag="PYCH_t35"
FT   tRNA            380735..380812
FT                   /locus_tag="PYCH_t35"
FT                   /product="tRNA-Tyr"
FT   gene            complement(380831..382288)
FT                   /locus_tag="PYCH_04630"
FT   CDS             complement(380831..382288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04630"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24153"
FT                   /db_xref="InterPro:IPR018746"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHF6"
FT                   /protein_id="AEH24153.1"
FT                   /translation="MTGINGKRLLCYIILVAILITFPYFFTRKTPPGYIIGGDTLVHAA
FT                   IARGISLGRNPFLDQTYNVYPNWYPFFYHFLVAGISWVFGFSIEKSMIMLQAILAISMV
FT                   PVMFHIAKELWGDNAGIAAASLSLMLLTAHIYPNPKELAPLLGVLSLLYFIRRQWIVSG
FT                   ILMGLAMWTHYALVLPLLGLPIVVGILKGEKRALLTFLIALAIFSPFIINALIHAEAPP
FT                   HIEDIYRFWETDTLERKLISLLPPLYLIPFLGLAMINWSKRRETAVTTLLLFIGLIWVA
FT                   RLSPELLKPFGIKLWSSRFSGLLPYIYTLLAAYGLSAVGASSRKMATMFLIILFLCPVA
FT                   GALNFWNSIREDPFVKVSGVDFSRYFPGEHFLEVREWILNNTCRDDTIATSEEAGMMLN
FT                   ALTGRPIIATMYGHGNTFLDNEQRRKDLKKLFTGDCNEKKLVIEKYRVKYIIIEPFVYE
FT                   RWGQVDMSCVASPVYRIGNVTIMEVKK"
FT   gene            382444..382878
FT                   /locus_tag="PYCH_04640"
FT   CDS             382444..382878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04640"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04640"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24154"
FT                   /db_xref="GOA:F8AHF7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHF7"
FT                   /protein_id="AEH24154.1"
FT                   /translation="MESRIPKFGSTRHAKHFIAYHFIWIPKYRRDILIGKVAERLKQML
FT                   REFAEEIGCEVISLEVMPDHVHVFLRAKPNLSPAQIINHLKGKSARKLLQEFPELRAKT
FT                   TKGRLWSRSYFVASVGYITDEIVKHYIETQWERELKRKEQ"
FT   gene            383185..383862
FT                   /locus_tag="PYCH_04650"
FT   CDS             383185..383862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04650"
FT                   /product="transposase, session 1"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04650"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24155"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHF8"
FT                   /protein_id="AEH24155.1"
FT                   /translation="MEKEIILRNDQYRIEGNKLILKGLGKFKKLEVQFKGRIHWKGKQG
FT                   RLEIIYDDVKRKWYAHISFNVKEKLSKNGWIKVPREPLGDLTAGIDLGVNNLMAVYVEN
FT                   GESFLVNGRPLKSIAFYWQKKIAEYQSKINKSGCKKSRKLRRMHERAKLQAKHYINTAV
FT                   RQTVERLYHLGVSRIVVGYPKEIARNSRRGRKQNFLLSHVWRFNTVIKRLSEVQVSHRG
FT                   ACF"
FT   gene            383825..384052
FT                   /locus_tag="PYCH_04660"
FT   CDS             383825..384052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04660"
FT                   /product="transposase, session 2"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04660"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24156"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHF9"
FT                   /protein_id="AEH24156.1"
FT                   /translation="MKFKCPTEGLVFNADLVGAFNILKKVVRTITPSPEGLKAFRVRGN
FT                   GGKTAPEGFREPSKGFLMKTPQTSPPMARG"
FT   gene            complement(384090..385097)
FT                   /locus_tag="PYCH_04670"
FT   CDS             complement(384090..385097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04670"
FT                   /product="histone deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04670"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24157"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHG0"
FT                   /protein_id="AEH24157.1"
FT                   /translation="MIPTTIFYSPKFLDHRPRGYHPENPGRLALVLEALRERGLWANVK
FT                   EPNPISEEELLSIHAAEYVEAIRTASKSFTYIDPDTYVSPGTWEAALLAMGAAREAALL
FT                   GTKERGLHLVLSRPPGHHAGRSGRALGAPTLGFCIFNNAAAAARVVKDEKGKALVIDFD
FT                   AHHGNGTQEIFWTDSNVVHVDIHERDIYPWTGYEADIGGKGAEGSKVNIPMPHYAGDDN
FT                   YILAWNEVVLPIVEALKPKVIIVSAGFDGFKGENLTTLMLTERFFHHAGATLSNFSVVM
FT                   VLEGGYGVGLKKGLPAFIEGYERGEPIEEPRDISYETLRIIRGVKEVQKEWWQF"
FT   gene            385181..385268
FT                   /locus_tag="PYCH_t40"
FT   tRNA            385181..385268
FT                   /locus_tag="PYCH_t40"
FT                   /product="tRNA-Leu"
FT   gene            385309..385725
FT                   /locus_tag="PYCH_04680"
FT   CDS             385309..385725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04680"
FT                   /product="Transcription nickel responsive regulator (nikR)"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04680"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24158"
FT                   /db_xref="GOA:F8AHG1"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHG1"
FT                   /protein_id="AEH24158.1"
FT                   /translation="MKIVRFGVSIPEELLQKFDKIINEKGYANRSEAIRDLIRDFIVRY
FT                   EWEKGDMEVAGTITIVYNHDEADVVKELLDLQHEYLDEIVSSLHVHMDEHNCLEVVVVK
FT                   GRASKIKEIADRLISLKGVKHGKLVMTTTGRELL"
FT   gene            385823..387001
FT                   /locus_tag="PYCH_04690"
FT   CDS             385823..387001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04690"
FT                   /product="dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04690"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24159"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR014651"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHG2"
FT                   /protein_id="AEH24159.1"
FT                   /translation="MVGIQVQEVTTDKYAKIDINAPLSEAIGVIEKEDPDLILVFDGNV
FT                   YKGVLTQDLIIRSHLKWDPTKAKVRDVYKPAPVVKPTDDLSHAAKLMLETDLRSLPVGE
FT                   DKANIMGIVSDFALLDRVVAEEFGKRKVEEFMTKDVITLSPDDTVAKALAVMRDHSISR
FT                   IPIVDEEGRLEGLVTLHDLILRFIKPRFRAQAGELVGEKIPPFSMKLREAMIRGVITIM
FT                   PDATIREAVATMIDNDINGLVVVNEDNKVVGIITGKDLLLPISKMVEKEARFYLQLGGD
FT                   AAALSEFTRERIINDIKRFVDGYSDLLGNEGIIYLYIRRFNEKFRGVHLYQARMRVVTD
FT                   KGVFVARGETWGAIQAVHDAIRAIERQLLQKAELERDIRYAKRFIEKLELWR"
FT   gene            complement(386973..388046)
FT                   /locus_tag="PYCH_04700"
FT   CDS             complement(386973..388046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04700"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24160"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIS0"
FT                   /protein_id="AEH24160.1"
FT                   /translation="MAERFKVGRESLFLMIEKLAKVREAIERGKLEEAIKISKNINDPY
FT                   WKSYAMKWLSQAMASKNPAEARRLASSIPIPSLRNEALLYLAYELSKRGKFKDAVDSAR
FT                   LIVDVYMKKKALRSISDALAEALKKMNIIEISLGELGLEEADVELLKPLPEGIKYEDGR
FT                   FLVDATILPVSEEKGSAVVEMRDEKANLKEPELEPLEMELLELTEENFENLPEPFRSAL
FT                   IESIGLHRLEEGDVEAAEELVEKITIGGGTLARLLFFLGREEHLEKVRRPVDRILLAYR
FT                   VLLLKPTDDAIPLIYTLFSDLRNRNPWKFARLMKFLAFELLEEGRKRRNKALLIKSKEL
FT                   FRKGKEEELSATAQASL"
FT   gene            388072..390084
FT                   /locus_tag="PYCH_04710"
FT   CDS             388072..390084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04710"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24161"
FT                   /db_xref="InterPro:IPR007408"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHG3"
FT                   /protein_id="AEH24161.1"
FT                   /translation="MSHRKRSMRVMRILVLGLDIISEDPKRFAVVSWFNGKLEKKGEFT
FT                   LYRLIRFIRAKRPDIVAMDSVTELGNDLRKFLRALPEGTKLVQVTGRPGEQRSLWSLAR
FT                   EHGIRIGDKFDPYEEAKVCALLAAKGVGYEVLAFEDEVIITVTRGRSQGKGGWSQDRYR
FT                   RRVYSLVQAKVREIEETLRRADIPFDLETEERDRGVARGEFKVYASREELAGLVRPMRG
FT                   GDVEVRIRPVERKVLEFVPLRVERAIEERRSIIIGLDPGITVGIAAVDLDGNVVAVYSE
FT                   KNMALSEIVRFISELGHPIIIATDVNPPPGLVEKMARSFKAQLFVPRESLKVEEKNELL
FT                   RSLGITVEDDHQRDALAAAYKAYLRYKPKFEHIEARLKELGLWKKRNEIKALVLSGYNL
FT                   GEAIMKVKMAERPKEDVKEKHEPEVDVTPYLERIRELERTIEILERENAELRSLVEKQR
FT                   KRIERLEEMLREFDEKVRAKIIREKEIQARDRRIAQLEEKLREAREMVEKLSRDLALTK
FT                   RMRLMELRGKVIPVKVIENLTWKEIEELEGNVGIKKGDVLYVLNPAGAGRSIGEHLAAK
FT                   RIKALITVKELPVPVYEALRERKIPVLLEGEIEVKRVDEFAVVERNALEEAVRRKLEEW
FT                   AEEEKERELESVLRVIEEYKVERIKELIRRVEEGR"
FT   gene            390081..393551
FT                   /locus_tag="PYCH_04720"
FT   CDS             390081..393551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04720"
FT                   /product="DNA topoisomerase I"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04720"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24162"
FT                   /db_xref="GOA:F8AHG4"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR005739"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR028992"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHG4"
FT                   /protein_id="AEH24162.1"
FT                   /translation="MILIIAEKPNVARKIASALAEGRPVKKSIYGVPYYELTRDGKRLI
FT                   VAPAVGHLYGLAPKRDFFGYPIFDIEWVPVYVAEKGKEYAKDYIKALSVLAKRAKEFVV
FT                   ATDYDTEGEVIGYTALKYACGVDPRKAKRMKFSALTKRDLLKAWYNLEPTINFGMAGAG
FT                   IARHVLDWYWGVNLSRALTHAIKRASGKWVVLSTGRVQGPTLKFLVDREREIQNFVPKP
FT                   YWIIKLILEKNGRKLTATYEKDKVWDEEEAKRIVQEARKGYAIVENIDVRRLQRNPPVP
FT                   FDLGTLQREAYSAFGYSPKKTLDIAQSLYEKGYCLHPDSLIPTPDGIKKIAELPKEGEV
FT                   LALDFNLKLSRARYRLLERDADELMYKVTLGDRTELYLTADHPVLVCRDDKLIFVPAEE
FT                   LKESDQVVLVIAREGFKGRENPPTLLDFLLENARTMKDYILYDPEFGKDLRRRLKERGL
FT                   KVEVMAEFNIRESTYYNYLRGKMPVPIAKFLLDKGVISREELRSVFRGFAYSTSLSPIS
FT                   FEFSEEFWYLYGFVVGSSYTVKNGALVISAKEREEDIVRAIREVANSLGVPFRYDAKYK
FT                   LIIIRSKSLTRLFELLGCSYGNKTRTFRIQGIVVSRPGWIAAFLAGYCDADAHIRVKPT
FT                   GSRKSLSPQIVLTSKNKEVIYTIKLMWQLLGVRTYLLEKKDKNGVVYELKVYPKDVPRF
FT                   YEVLRSFLIVKRKDLERVIEIVAGKRAINIEETAIPLTDEDLRRIATGDVYLLKVNGIE
FT                   KFRYRGKVYDLVVEDYHNFIANGVVVHNCSYPRTSSQKLPKNLNFGAILQGLSKLPEYR
FT                   PFAHMLLGKEVLKPVEGKKEDPAHPAIYPTGEVPKPGELTKDEQNLYDLIVRRFLALFM
FT                   EPAVRESVKVTIKAGSHRFILSGARTVKEGWLRVYGKYVKFDEVLLPGFRRGEPVRVLQ
FT                   VKREKKKTKPPARYSPAAVIKKMEDLGLGTKATRAQILETLYQRGYIEGKKSIKVTPLG
FT                   MKVVETLEKHVPEIVSVELTREFEEKMELIMNGKLTKEAVIEEAKERLLKILEEFKRKE
FT                   LEIGRELAKIVIGEDLVEDKREDIVVVGKCPKCGGDLVVKYNRKTGKRFVGCSNWPKCD
FT                   VTYPILQRGEIIPTNKTCCDGTPIVIIREEDGREYEICLDIRCRKGKGR"
FT   gene            393556..394341
FT                   /locus_tag="PYCH_04730"
FT   CDS             393556..394341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04730"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04730"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24163"
FT                   /db_xref="GOA:F8AHG5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHG5"
FT                   /protein_id="AEH24163.1"
FT                   /translation="MSLEELYRYLRWRMDPEDERAVERFRRIVKFFESLPDLPGGGRVL
FT                   DICAGTGIAGAAVAKATGAKLLTVLDARREDLEKVSAWVDIAEIGPDVRKVIGDARNVA
FT                   ELVGKHDIAVLWGLTMPHFDPFDAVKLFAGVASILSDNGVFLIEETDRVYGILYRIGYK
FT                   DMLIEAKGGDYTLISLHEGYNIMRGMFRRTYYKLPGFDKVAEQEFRLWDIASQLAIGSV
FT                   FFREWRLIGREEHGVVGVSDVLYFRGPRKDVAKAVLGDK"
FT   gene            complement(394350..394427)
FT                   /locus_tag="PYCH_t45"
FT   tRNA            complement(394350..394427)
FT                   /locus_tag="PYCH_t45"
FT                   /product="tRNA-Arg"
FT   gene            394501..395310
FT                   /locus_tag="PYCH_04740"
FT   CDS             394501..395310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04740"
FT                   /product="5'-methylthioadenosine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04740"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24164"
FT                   /db_xref="GOA:F8AHG6"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR001369"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHG6"
FT                   /protein_id="AEH24164.1"
FT                   /translation="MGGLMVRVAIIGGSGVYGFPVEEPKDVTVETPYGPVKLRVGLLDG
FT                   EEVAFLARHGEGHSVPPHKINYRANIWALHELGVERIIATSAVGSMNPEMKPGDFVILD
FT                   QLMDFTVSRPRTFYDGEESPHEWKFVAHVDFTEPYCPEIREALIRAARELGLSYHPRGT
FT                   YVCTEGPRFETRAEIRAYRILGGDVVGMTQCPEAVLARELEMCYASVAIVTNFAAGMSG
FT                   RKLTHTEVVELMGKKGEEIVRLITRAISYIPKERGCPCKDALKGATG"
FT   gene            395390..396703
FT                   /locus_tag="PYCH_04750"
FT   CDS             395390..396703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04750"
FT                   /product="xanthine/uracilpermease"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04750"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24165"
FT                   /db_xref="GOA:F8AIS1"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIS1"
FT                   /protein_id="AEH24165.1"
FT                   /translation="MGWFEKYFEFEKYGTDMKTEILAGVTTFMTMAYILFVNPEILSTA
FT                   MGPEAREALVAVTALAAGFSTIMMGIYAKKPFALAPGMGLNAYFAFTVAPKFGWQVALA
FT                   AVFVEGIIFIILSLTKVRSAIIHAIPLSQKYAIGAGIGLFLTLIGLSNVGVITSGPTIL
FT                   ALNAGNLATKPVLLFFFGLFFAAVLIALRIKGALLISILVTSILGWLTGAAPWPEKLFS
FT                   WPDISYTFLKLDLQGLLNVGAFGAIFAFFMVDFFDTLGTVTGLSAKAGFLTKEGKIPDA
FT                   DKVLLTDAVGTTMGALLGTSTVTTYIESAAGIEEGGRTGMTALVTGFLFLALGLFIGPL
FT                   AGSIPGFATAPALVIVGYYMLSAIKEVDFTDPTEAIPAFLVLITIPFTYSIADGIGMGF
FT                   ISYTIIKVFSGRWKEVHPLMYILAIIFVLYFAYLGGLF"
FT   gene            397206..398690
FT                   /locus_tag="PYCH_04760"
FT   CDS             397206..398690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04760"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24166"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHG7"
FT                   /protein_id="AEH24166.1"
FT                   /translation="MDEVLDLLRAVKVFPRLNPRRRVQKFFEELRGDYVQIYGFLLLRR
FT                   PPCPGQEDIEYLISPLSPGELERSDFRGYAVVRIGSKTIIKGLLKSGHYVIVRGRVEPY
FT                   PCGNMRVIVAEEIAPADYAHYWALEEYALSKGEIEDLISRTFYATRQVEEALTYSLFGG
FT                   PEILGNPLGWREGFTFSVLKDDERVVKSIHEFTSRFLALLPRELRLEKAGKWKIEDEGL
FT                   GLDFTLFDPNTSLKYYSPTPNLLRRAIPVPKWAMNIFARKAAIFLISKLARPSPRDYLA
FT                   SLSETPFILNEPVAFEMHELEELWPNLVATIFMGRVKIGTLNPLREEVEEFRKAFERWL
FT                   WRNREEYGEILDALLVKNSLLDVGRRYVLSLHVLGSMSRIEGRLRGAFVRRVLAIEQEI
FT                   LDTWINEVPREELISLLRDHRRYVGEDRRASIALRVFLDLEATSVDGTVTREEFVEALL
FT                   ERGLSKEDAEILIERLKADGYIYEPILGRLRMVRPE"
FT   gene            398687..399055
FT                   /locus_tag="PYCH_04770"
FT   CDS             398687..399055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04770"
FT                   /product="ribonuclease P protein component 4"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04770"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24167"
FT                   /db_xref="GOA:F8AHG8"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="InterPro:IPR016432"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHG8"
FT                   /protein_id="AEH24167.1"
FT                   /translation="MRRDWEKREKKRIALERIETLFTMAERVFPYDRELARRYVEIALA
FT                   VQQKAKVRMPRKWKRRYCKRCHAFLVPGINARVRLRERRMPHVVITCLECGHMMRYPYL
FT                   REQKARRRQRQEEGRRKT"
FT   gene            399095..399340
FT                   /locus_tag="PYCH_04780"
FT   CDS             399095..399340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04780"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24168"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHG9"
FT                   /protein_id="AEH24168.1"
FT                   /translation="MVVRLVYPEALVVIEDGFVRMFKGKLVEAPLEEVLSYAMGEEAII
FT                   PEELKEVARDVLVAIEAMNIGRKRFMTVPNWKKVAA"
FT   gene            complement(399345..399590)
FT                   /locus_tag="PYCH_04790"
FT   CDS             complement(399345..399590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04790"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24169"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHH0"
FT                   /protein_id="AEH24169.1"
FT                   /translation="MNGLVYVLILILFVLNVILAMLYLSAKRNPYYVVYDEETKTALKR
FT                   RVMHLKEDLESELTEFDVAEWERQLEKSLEEEIKGL"
FT   gene            complement(399590..400369)
FT                   /locus_tag="PYCH_04800"
FT   CDS             complement(399590..400369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04800"
FT                   /product="cell division inhibitor minD"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04800"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24170"
FT                   /db_xref="GOA:F8AHH1"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010224"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHH1"
FT                   /protein_id="AEH24170.1"
FT                   /translation="MEGRSIVFASGKGGTGKTTTVANIGVALAQFGKDVILIDADITMA
FT                   NLSLILGMEDIPITLHDVLAGEADLKDAIYEGPAGVKVIPGGLSLEKVKKAKPERLREL
FT                   IREIGQMADFILIDAPAGLELTSVTALLIGKELIVVTNPEISAITDSLKTKLVAEKLGT
FT                   LPLGAILNRVTSEKTELTKEEIEAILEVPVMGMVPEDPEVKRASAYGVPLVIKNPTSPA
FT                   AIAYRQIAAKLAGVKWTPPEPESPVKRIFRALFGGRR"
FT   gene            400483..400896
FT                   /locus_tag="PYCH_04810"
FT   CDS             400483..400896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04810"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24171"
FT                   /db_xref="InterPro:IPR018662"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHH2"
FT                   /protein_id="AEH24171.1"
FT                   /translation="MALAMERKEDIKKKNPIDELPWQEYELEEFKEKFPALAKELDGEE
FT                   GLPIEGIRLDEYQFLKEEEEGIDFSGYNPTIIDFLRRCETDEEALEIINWMEKRGEITS
FT                   EIAKELRVTLVHKGVRAFGPKKEWGWYERHGKH"
FT   gene            401017..401961
FT                   /locus_tag="PYCH_04820"
FT   CDS             401017..401961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04820"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04820"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24172"
FT                   /db_xref="GOA:F8AHH3"
FT                   /db_xref="InterPro:IPR011600"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHH3"
FT                   /protein_id="AEH24172.1"
FT                   /translation="MPMKKLSAIFIVLVVLLSLPIASPVPQRHGIDYSKPLYAEDVKIG
FT                   HKITVDYIPKAGGFRGGRGGGTSTTTAATGILGEPVEGEKYAIVIGIADYPGTSSDLQY
FT                   TDDDALLVYNTLINVYGFKPENIILLLNMDASFYNIYNAVMELKSKVQPGDEVVFYFSG
FT                   HGSTGRAEDGDNEIIDEAIVTHDGNPDGSFLLIWDGQLRAWFEDFPTDRIIFIFDSCYS
FT                   GGMTDLAADGRIVIMASGEREFSLESAEWGHGQFTYYFFLEGINEGYADLYDHDGDPAT
FT                   PDVTVEEAFDYAFANCERQTPVIADGFTNDLLP"
FT   gene            complement(402022..403533)
FT                   /locus_tag="PYCH_04830"
FT   CDS             complement(402022..403533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04830"
FT                   /product="AMP phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04830"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24173"
FT                   /db_xref="GOA:F8AIS2"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013466"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017713"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIS2"
FT                   /protein_id="AEH24173.1"
FT                   /translation="MRARTRLLDVNTGNFTVFINPEDAKEGRLHPEDLVKIETGKRTVY
FT                   GTVAIGDFVGRGEIGISQDILEVQPFSEGEAVVVVPAGTPESVRYIRKKMRGEKLRKVE
FT                   IEAIVKDIVDRKLRDVEISAFVTALEINGLDMDEIAALTVAMAETGHMLDIDRKPIMDV
FT                   HSIGGVPGNKTNVLVVPIVAAAGLTIPKTSSRAITSAAGTADVVEVLTNVTLSLDEIKR
FT                   IVEKIGACLVWGGALNLAPADDITIKVERRLSIDPRGLMLASIMSKKYAIGSQYILIDI
FT                   PTGRGVKVESMEEARSLARDFIELGKRLGQYVEVAITYGGQPIGHTVGPALEAKEALEA
FT                   LMTGKGPGSLIEKALGLAGILLEMGGVAPAGMGKKIAREILESGKAYQKMREIIAEQGG
FT                   DPDIKPDDVPIGDKTYTFTAPTSGYVTGIDNRAVTAIAREAGAPEDKGAGITFHVKVGE
FT                   KVKEGDPLFTIHAESETRLDRAIVLARRLDPIKIEGMVLQRIGNI"
FT   gene            complement(403578..404198)
FT                   /locus_tag="PYCH_04840"
FT   CDS             complement(403578..404198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04840"
FT                   /product="dolichol-phosphate mannose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04840"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24174"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHH4"
FT                   /protein_id="AEH24174.1"
FT                   /translation="MVPAYNEAKRISGVLSRIPDFVDEVIVVDDGSKDETADIAERHGA
FT                   NVVRLPKNRGKGAAMREGVKKATGDVIVFMDADGQHDPAEIERLILPIAENRADFVIGR
FT                   RVIKEGRRSLIRKLSNFVTTTLLRLKLGVDIRDTQSGFRAIRRDFLPEIESERYEVETE
FT                   ILIKAVKMGARVAEVPVSTTYEVETGHFRFEDIVRFLKTLLRY"
FT   gene            404272..404499
FT                   /locus_tag="PYCH_04850"
FT   CDS             404272..404499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04850"
FT                   /product="putative molybdopterin converting factor, subunit
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04850"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24175"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHH5"
FT                   /protein_id="AEH24175.1"
FT                   /translation="MRIRLMGAFAHLAGAGELEVRVKGRKKVGEILREVIPRFDEFRDK
FT                   IIIVNGMVASEEAEVGDEDEVRVMPVLSGG"
FT   gene            404549..405082
FT                   /locus_tag="PYCH_04860"
FT   CDS             404549..405082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04860"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24176"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIS3"
FT                   /protein_id="AEH24176.1"
FT                   /translation="MVGEIERALQAFHSMKVRQITPPITSMPIVEEESAIVDVLKILRT
FT                   RHHVWVVRSRESMELTGVIRYLDVVDILLPPTRQRARLGSISSMLKSIMAGAEKARDIM
FT                   ERNVLTVEEEATVLEALEKMKRYRVAILAITDERGKLKGEISLRLLINEFIRLMRVGGA
FT                   QWTQRGSSSRLESP"
FT   gene            405040..406338
FT                   /locus_tag="PYCH_04870"
FT   CDS             405040..406338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04870"
FT                   /product="Na+/H+ antiporter, napA type (napA)"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04870"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24177"
FT                   /db_xref="GOA:F8AHH6"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030152"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHH6"
FT                   /protein_id="AEH24177.1"
FT                   /translation="MDATWLLFALGVSLMLAKIGDAIVERFELPGVLGELLMGMLLGNL
FT                   VYFGIVRPNYLPITMDASDIASFLAKLGIIFLLFLGALDTDIEQLKRTGLTAVVSTLFG
FT                   VFVPLVLGWFVLMEMGYPSREAFAGGVLLTATSIGITVRVMMDLGVLRSEVGAASLSAS
FT                   VIDDFLGIALIIFAVGTGSLLGLTLKIILFFIITGIIGWFTIDRYVGLAERLHVEKGVL
FT                   GMVVGMMFLFAALAEGWFAAAIEGAFMMGLILSKLPEGRRLMEDVKAIGYGLLIPFFFV
FT                   HTGAMLNLRVFEHKEALTLAAVMTVIAVVGKVVGRGFGAWITAWGRGKKFLFTRENFWM
FT                   SLQAGIASIPRTEVALVNLMVAIHGGAIPPEDASKFIAATLIFITVSVLITPPLLKWAF
FT                   REDIERRKREIIEGRKGRIEEKKSQVADIKGSR"
FT   gene            406635..407897
FT                   /locus_tag="PYCH_04880"
FT   CDS             406635..407897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04880"
FT                   /product="glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04880"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24178"
FT                   /db_xref="GOA:F8AHH7"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHH7"
FT                   /protein_id="AEH24178.1"
FT                   /translation="MVEQDPYEIAVKQLERAAQYMDISEEALEFLKRPMRIVEVTIPVE
FT                   MDDGSVKVFTGFRVQHNWARGPTKGGIRWHPEETLSTVKALAAWMTWKTAVMDLPYGGG
FT                   KGGIICNPKELSDREKERLARGYIRAIYDVISPYTDIPAPDVYTNPQIMAWMMDEYEAI
FT                   SRRRDPSFGIITGKPPSVGGIVARIDATARGGAYTVREAAKALGWDGLKGKTIAIQGYG
FT                   NAGYYMAKIMSEEFGMKVVAVSDSRGGIYNPDGLNADEVLKWKKEHGSVKDFPGATNIT
FT                   NEEILELEVDVLAPAAIEEVITKKNADNIKAKIIAELANGPTTPEADEILFEKGILIIP
FT                   DFLCNAGGVTVSYFEWVQNITGYYWTIEETRKRLDEKMTKAFWDVYNTAKEKNINMRDA
FT                   AYVVAVQRVYRAMLDRGWVKK"
FT   gene            408024..408449
FT                   /locus_tag="PYCH_04890"
FT   CDS             408024..408449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04890"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04890"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24179"
FT                   /db_xref="GOA:F8AIS4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIS4"
FT                   /protein_id="AEH24179.1"
FT                   /translation="MIDERDKIILDILVKDARTPFTEIAKVLGISETAVRKRVKALEEK
FT                   GIIEGYTVRLNPKKLGYSLVTITGVDTRPEKIFDVAEKLKEFDFVRELYLSSGDHMIMA
FT                   VIWARDGEDLADIISNKIGRIDGVTKVCPAIILERLK"
FT   gene            408569..409093
FT                   /locus_tag="PYCH_04900"
FT   CDS             408569..409093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04900"
FT                   /product="ferripyochelin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04900"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24180"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHH8"
FT                   /protein_id="AEH24180.1"
FT                   /translation="MSVYELDGKRPKIHPSAFIDESAVIIGDVVLEEKTSVWPSAVLRG
FT                   DIERIYVGRYSNIQDNVSIHTSHGKPTEIGEYVTIGHNAVIHGARVGNYVIIGMGAVIL
FT                   DGAKIGDHVIIGAGALVPPGKEIPDYSLVIGVPGKVVRQLSEEEIEWTKKNAEVYVELA
FT                   EKHLKGRKRVE"
FT   gene            409097..409891
FT                   /locus_tag="PYCH_04910"
FT   CDS             409097..409891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04910"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04910"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24181"
FT                   /db_xref="GOA:F8AHH9"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHH9"
FT                   /protein_id="AEH24181.1"
FT                   /translation="MIYRLVSYLPKILFKPAYDLYERYLFEKVKAGNLPKHIAIIMDGN
FT                   RRWARKLEKPPWYGHLFGSKKLEEIVQWCHELGIRMLTVYAFSTENFKRSKDEVDRLME
FT                   LFERKFRELVKDRRVHEYGIRVNVIGRKDLLPKNVREAAEEAERATRKYNNYVLNIALA
FT                   YGGRSEIVDAVKDIVRDALVGKLRPEEIDEELLKRYLYVPNMPDPDIVIRTGGEVRISN
FT                   FLLYQIAYSELFFVDVYFPEFRKIDFLRIIREYQKRERRFGR"
FT   gene            complement(409892..410437)
FT                   /locus_tag="PYCH_04920"
FT   CDS             complement(409892..410437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04920"
FT                   /product="dCMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04920"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24182"
FT                   /db_xref="GOA:F8AIS5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIS5"
FT                   /protein_id="AEH24182.1"
FT                   /translation="MDVEVFLDKEKAERIKRIRPTKDEYFMLIAKLVSLRATCPRLRVG
FT                   AVAVKDGYILATGYNGAPRSMDHCIDAGCLLVDGHCHRAVHAEQNVIAMAARKGISLEG
FT                   ATLYVTHFPCDTCLKLLINAGIKEIVYEEMYPNKVTEILLKEAQEKGLIKIRQFKLSKE
FT                   RVRQFLEALFPEFCGCEK"
FT   gene            complement(410450..411247)
FT                   /locus_tag="PYCH_04930"
FT   CDS             complement(410450..411247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04930"
FT                   /product="peptidase, M48 family"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04930"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24183"
FT                   /db_xref="GOA:F8AHI0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHI0"
FT                   /protein_id="AEH24183.1"
FT                   /translation="MLRLIVVAQLLITLLSLGRLGLSMVLFSGAVLSAMYLLVSRKMPS
FT                   GRYSKIQWADMPWLYDGIARMAAKLRINMPTIYIEDTYVPNAYSFGTSIVLSAGLFEVL
FT                   SDVEILAVAAHEMGHIKNGDTILFPLVSYGRYLMLLVSVATAVLSHSTIVRYISLLLFV
FT                   TYEVERRRFLRRREFKADDVAVRVLDTPYALKNALEELKYYEDVRERLARNTVLPSIEP
FT                   SLERWEKTKSSWTYLMSTHPSYDERILRIMSIVESSKLLEALK"
FT   gene            complement(411263..411628)
FT                   /locus_tag="PYCH_04940"
FT   CDS             complement(411263..411628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04940"
FT                   /product="transcriptional regulator, BlaI/MecI/CopY family"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04940"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24184"
FT                   /db_xref="GOA:F8AIS6"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIS6"
FT                   /protein_id="AEH24184.1"
FT                   /translation="MEPSEFKLNQEGLRAVLPPLEAEIMEYMWQVKAATAGEVYEYLKK
FT                   THPDIRRSTVSILMNRLCEKGLLSRRMERGRGGIRYVYSVTTSREEFERRIVERILEAL
FT                   INNFREATYAYLSKIKK"
FT   gene            complement(411668..412024)
FT                   /locus_tag="PYCH_04950"
FT   CDS             complement(411668..412024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04950"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24185"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHI1"
FT                   /protein_id="AEH24185.1"
FT                   /translation="MYMVQHIALLVIGLLMVHVLKKYREKEFEWGDFIFWEALLAVLLM
FT                   VSLRPVEISQEIKEILGLGRGLDALFVVAIGGVYLLVFRLYLMIDKVEREITELTREVG
FT                   IRLRELEDRIERKA"
FT   gene            complement(412030..412893)
FT                   /locus_tag="PYCH_04960"
FT   CDS             complement(412030..412893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04960"
FT                   /product="dolichol-phosphate mannose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04960"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24186"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIS7"
FT                   /protein_id="AEH24186.1"
FT                   /translation="MRIERVFVEGHEDRNVQRVLRELGVETTGDEGAPKLGTYYLEVGE
FT                   VKFEAKNLEGLKSVFENLLGTYVVVPAYNEEKTVGKVLDELLEYFPPERIIVVNDGSRD
FT                   RTEEIARERGVRVITHLVNRGLGGALGTGIEYALRKGARAIVTFDADGQHKVEDALRVM
FT                   KPVIEGRADLAIGSRLKGDVSQMPLIKRIGNTALDLITTIFSGRYVSDSQSGLRCLSRD
FT                   CASRIRITCDRYAVSSEIIIEASKKGCRIVEVPIKAIYTKYSMRKGTNVVEGIKIAFNL
FT                   LIDKLR"
FT   gene            412968..414212
FT                   /locus_tag="PYCH_04970"
FT   CDS             412968..414212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04970"
FT                   /product="peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04970"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24187"
FT                   /db_xref="GOA:F8AHQ4"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR020918"
FT                   /db_xref="InterPro:IPR024049"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHQ4"
FT                   /protein_id="AEH24187.1"
FT                   /translation="MSHRDAQLYELRKKIEELKKIRGRGTELVSLYIPAGYDLSKVMQQ
FT                   LREEYGTAQNIKSKTTRKNVLGALERAMQHLKLYKQTPETGLALFVGNVSEMEGVTDIK
FT                   LWAIIPPEPLNVRLYRCDQTFVTEPLEEMIRTKDAYGLITVEKNEATIGLLRGKRIEVL
FT                   DELTSNVPGKTRAGGQSARRYERIREQETHEFMKRIGEHANRAFLPLLEKGELKGIIIG
FT                   GPGPTKEEFVEGDYLHHELKKKIIGVVDISYHGEYGLRELVEKASDILRDHEAIKEKKL
FT                   IQTFLTHVVKDTGLATYGEREVRKALEIGAVDKLLISEGYAKVRVRAKCNACGWEELKT
FT                   MSEEEFETYKKRLTRCPKCGSQNISFEKWDVAEELIKMAEEAGSDVEIISLDTEEGQQF
FT                   YRAFGGLGAILRFKI"
FT   gene            complement(414202..414756)
FT                   /locus_tag="PYCH_04980"
FT   CDS             complement(414202..414756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04980"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24188"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHQ5"
FT                   /protein_id="AEH24188.1"
FT                   /translation="MLVILHCEGTNVGECLKKLEESAMEKLPHRGKIKGSKIRIGMGAF
FT                   MSVSVILTIDPAEPYKPGVITAYAVAGSKETALEELQAKLNERIRPDMVLEDFDVEVYT
FT                   TPVTRRTYAVGVVTYNRPAKGEFEDMKLVDRRKLLAKLLELLNYNPKALNISELARMFG
FT                   VSRDSIYNDIQQILGERRAKS"
FT   gene            414867..415046
FT                   /locus_tag="PYCH_04990"
FT   CDS             414867..415046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_04990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_04990"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24189"
FT                   /db_xref="InterPro:IPR007166"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHQ6"
FT                   /protein_id="AEH24189.1"
FT                   /translation="MRRAQGAIEYLFMIAAALIIILVVVRYLSRSGIEQGTRIEQTAGA
FT                   INETLNELNRSTAG"
FT   gene            415120..415314
FT                   /locus_tag="PYCH_05000"
FT   CDS             415120..415314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05000"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24190"
FT                   /db_xref="InterPro:IPR007166"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHQ7"
FT                   /protein_id="AEH24190.1"
FT                   /translation="MKRAQGAIEYLIIVVAGLILILITARYMIDERSAADMAYQKINGT
FT                   KSSIERTFSEVYNTTINST"
FT   gene            complement(415315..415602)
FT                   /locus_tag="PYCH_05010"
FT   CDS             complement(415315..415602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05010"
FT                   /product="nucleotide pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05010"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24191"
FT                   /db_xref="GOA:F8AHQ8"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHQ8"
FT                   /protein_id="AEH24191.1"
FT                   /translation="MHIREFQEMIKDIYFHKDRKRGVERTFFWLVEEVGELAEAIRKGD
FT                   KEAMDEEFADVLAWLASLANLLGIDLEKAAEKKYPGVCPYCGKKACECEE"
FT   gene            complement(415607..416434)
FT                   /locus_tag="PYCH_05020"
FT   CDS             complement(415607..416434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05020"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05020"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24192"
FT                   /db_xref="GOA:F8AHQ9"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHQ9"
FT                   /protein_id="AEH24192.1"
FT                   /translation="MVEVDLKKTTHEMVRNGTWKFEGGIFWQALEGGVVGFDGETFLFP
FT                   EEWGRRERKIAKEKMKFILGLDTDLDSFYAEISDSKFAFLIEEFYGLTVPAAPTPYQAL
FT                   VEVVAQQQVSFEFAQRTIRNLVEIAGERVGDLYVFPTAERIAALSEKDLRRAKLGYRAG
FT                   YIKSLTALHLRGELDLELWNREDEEAIKYLMRFRGIGRWSAELFLLYGLRKNVYPAGDL
FT                   GLRRGVAKIFGLRLKEVREKDVRELIDPYGKWKSLLAFYVLCYDRKTEMERGR"
FT   gene            416553..417086
FT                   /locus_tag="PYCH_05030"
FT   CDS             416553..417086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05030"
FT                   /product="transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05030"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24193"
FT                   /db_xref="GOA:F8AHR0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR004451"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHR0"
FT                   /protein_id="AEH24193.1"
FT                   /translation="MVMAKAKPRYCELCGREIRGEGHVVRLEGAELLVCDDCYRKYGRK
FT                   QPGTFSIMPKGREPIRRMTVSRPRPQVKRERPLITEDIVEDYAERVMEAIRRSGLSYEE
FT                   LSHRVGLSVNVLRRIAHGEYMPTIEEARKLEKYFKIKLVEKVEADYEQRPLIPRDYEPT
FT                   LGDIARIRIRKRKK"
FT   gene            complement(417067..417474)
FT                   /locus_tag="PYCH_05040"
FT   CDS             complement(417067..417474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05040"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24194"
FT                   /db_xref="InterPro:IPR007154"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHR1"
FT                   /protein_id="AEH24194.1"
FT                   /translation="MLNTIVLIRTDSFDKALTALADLVRYGGMTIRGEPRIIPPALSDW
FT                   AFEQIVGEKPRKKVRAHVVAQIDLPASKAIGRIRDIHPPAHIVVIPVGTNVHRELLRMW
FT                   GSFKKLKGFYPPKERKYPNLEGEFEPTSSSS"
FT   gene            417590..418066
FT                   /locus_tag="PYCH_05050"
FT   CDS             417590..418066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05050"
FT                   /product="pyruvoyl-dependent arginine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05050"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24195"
FT                   /db_xref="GOA:F8AHR2"
FT                   /db_xref="InterPro:IPR002724"
FT                   /db_xref="InterPro:IPR016104"
FT                   /db_xref="InterPro:IPR016105"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHR2"
FT                   /protein_id="AEH24195.1"
FT                   /translation="MSWTTPKKAIMLAATAEGGTKLNAFDNALLKMGIGNVNLVKLSSV
FT                   IPAHIEWLDELPKNIPIGMLLPTVYAHIESDEPGSTISAALGVGISEGNEGGLIYEYAG
FT                   YCTKKEAEEMVRKMVEEGFRVRGWKLKEFRVVSAEITVKDRPAAAIAAVIMFPY"
FT   gene            complement(418060..418845)
FT                   /locus_tag="PYCH_05060"
FT   CDS             complement(418060..418845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05060"
FT                   /product="Hypothetical ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05060"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24196"
FT                   /db_xref="GOA:F8AHR3"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR012122"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHR3"
FT                   /protein_id="AEH24196.1"
FT                   /translation="MLENVIEDVRIFAEEVGLYEKRILVLFSGGKDSSLTLYLLKKAGL
FT                   DVAALTFFHRWSWPEVRSWAMKFTKEIGVEHYLVDITEGLLREAIGRKGPICIHCKKVM
FT                   LWNAKWFALNNGFSVLAKGDNANDKIIGALLDQCPGDIRLCELPRIGIPFFRPLIKYRA
FT                   EEVEALAEEAGIRPYRMYEHGRRRQWREGCPLQYIDREERITPELMDLAYKVNYVISRL
FT                   ARRKKVRMSVRVPSFEVMCWNCDEETLREAEKIVKRFSQ"
FT   gene            complement(419237..419434)
FT                   /locus_tag="PYCH_05070"
FT   CDS             complement(419237..419434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05070"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24197"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHR4"
FT                   /protein_id="AEH24197.1"
FT                   /translation="MGSDVDLLIKVREAPKTPRERAELEIRIEELADLPDNHPFEFHIV
FT                   DEKGFQRYIRILGVKPVRVE"
FT   gene            complement(419440..419589)
FT                   /locus_tag="PYCH_05080"
FT   CDS             complement(419440..419589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05080"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24198"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHR5"
FT                   /protein_id="AEH24198.1"
FT                   /translation="MHYEEVKMLLERSSDFLEFANRAFKDGKYSLATFLAEQAVQPRKG
FT                   CRVR"
FT   gene            419637..420101
FT                   /locus_tag="PYCH_05090"
FT   CDS             419637..420101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05090"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24199"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHR6"
FT                   /protein_id="AEH24199.1"
FT                   /translation="MRKFIADMMLGRLARWLRLYGYDTLYGVEDDDDILRIARAEQRII
FT                   LTRDSGLAERASRLGIPVILIRANSLEEQVAQLREEGVEFEELFPAGARCPKCNGPIKP
FT                   TRKEEVRGKVPPSVYEAYDEFYVCESCGQIYWPGRQWREIVKMDKMLRGG"
FT   gene            420102..420800
FT                   /locus_tag="PYCH_05100"
FT   CDS             420102..420800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05100"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24200"
FT                   /db_xref="GOA:F8AHR7"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR027510"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHR7"
FT                   /protein_id="AEH24200.1"
FT                   /translation="MEWEEWKPFYERIVREMGYSVERDREAAELLRAVLLENDTYLLKE
FT                   ELEVVVGKKVYVFGAGPSLEKVLEEHDFSDGTLIAADGATTALLEREIIPDIVVTDLDG
FT                   RLLDLRKANEKGAFMVIHAHGDNMDKIGAYGALFDNVLGTCQTEPLDIIYNFGGFTDGD
FT                   RAAFLAEALGAEKIILVGFDFGSFVGKWSKPWLKEHAPLWESKAKKFAFAKELLRWLEE
FT                   NGSAKLVWFQ"
FT   gene            420852..422594
FT                   /locus_tag="PYCH_05110"
FT   CDS             420852..422594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05110"
FT                   /product="carbon starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05110"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24201"
FT                   /db_xref="GOA:F8AHR8"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHR8"
FT                   /protein_id="AEH24201.1"
FT                   /translation="MNSAVLILIAAVIYVFFYMTYGKALQNKVVRADPNRPTPAHRLYD
FT                   GVDYVPAHPLVLYGHHFASIAGAGPIVGPALAIAWGWLPAILWIWFGNVFIGAVHDYLA
FT                   LMASVRYDGKSIQWIAGKIMSKRTGVAFEIYIWFTLLLVVAAFVAVTAKLLTTTPQAAT
FT                   ATILFLLIALLLGWLLYRVKINFYLGTAIGLILLALAVWIGLKHPLIFVSGQTDVTNVA
FT                   AYTTAYHYWNIILMIYIIVASSLPVWMLLQPRDYLNAYILWFGLLIGGIAFIGIAKTFE
FT                   APAYTGFVANVVAKQPSPFWPTIPLVIACGALSGFHSLVGSGTSSKQLDNELHGLLVGY
FT                   GGMFTEGFLSTIVITAIGVYGVKLTGVSVAEWGSQYIFKGGLGTFIGGYANGLHDFYGL
FT                   DMDLGKTFATLWISAFTLTSLDTATRLGRFAWQELFGMIADTGKGIMRVITNKWVASAI
FT                   IALLGTALAWNSGYKVLWPAFAAMNQLLASIALMTSALWVAKVQKAGKWSYAVLIPALF
FT                   LWVTVTAAIIWYIFEVPLPNLLTTIGTKGALLVGLVLNVLLAYDFYLAWKRPAEEYVKE
FT                   ATPA"
FT   gene            422625..422897
FT                   /locus_tag="PYCH_05120"
FT   CDS             422625..422897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05120"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24202"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHR9"
FT                   /protein_id="AEH24202.1"
FT                   /translation="MFLESLREFLRGFFQSFKDQSTEYIEFELRELENVFALLLMGSFI
FT                   GIPSPPTTLTLRLLPHMAREFIVMQRRAENLDDVFAELAGLFEVT"
FT   gene            422899..423879
FT                   /locus_tag="PYCH_05130"
FT   CDS             422899..423879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05130"
FT                   /product="anion transporting atpase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05130"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24203"
FT                   /db_xref="GOA:F8AHS0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHS0"
FT                   /protein_id="AEH24203.1"
FT                   /translation="MRECFLPKKGYRAVFVIGKGGVGKTTMSAAISLALAQKGYRTLVV
FT                   SLDPAHNLGDVLGVRLEDRPREIAENLYASEVDMEGMIKAYLKHIEETLKHTYRYLTVI
FT                   NLEKYFEVLRYSPGIEEYATLEVIRRVLSRGDEWDVIIFDTPPTGLTLRVLALPRIART
FT                   WADKLIELRLKILDRRKAIEKIHGERKFKLPSDPHEDAVLRELMAYREEVSDIEAVLTD
FT                   PEKTSVVAVMNPEMLPLYETERAFAMLRRFGIPFTLIVMNKILRLENPPDELRVKMEAQ
FT                   EKVLGLVEEKFPGVEVIRIPMMAEEPRGLEKLIELGKVIVEGGPW"
FT   gene            423873..424520
FT                   /locus_tag="PYCH_05140"
FT   CDS             423873..424520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05140"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24204"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHS1"
FT                   /protein_id="AEH24204.1"
FT                   /translation="MVSSDVILIVMVLAGVATLQFYKGRRINLLLMQHYLKSIEDIVRP
FT                   EDKNYIWLGGYVGFKAEYKVRRDNVEKFEYTLTLLPRQSLLYFPVSKLISRHDKLYIVV
FT                   RPSFEITREIHLIQKGYYRIKPKIENEPLLVRDVIDVGGVQFEVLFEKRADIERLVEFV
FT                   KGFSNVRNVKHVSLVPSTNVIYVFLKPEPETIKKDVKNVLSFVKMFPREMRR"
FT   gene            complement(424517..425527)
FT                   /locus_tag="PYCH_05150"
FT   CDS             complement(424517..425527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05150"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05150"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24205"
FT                   /db_xref="GOA:F8AHS2"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHS2"
FT                   /protein_id="AEH24205.1"
FT                   /translation="MKIRLEHGAGGEVMEELLRDVILKNLTLKSAGGVGLDALDDGATI
FT                   PFGDKHIVFTIDGHTVKPIFFPGGDIGRLAVSGTVNDLAVMGAKPIALANSMIIGEGFD
FT                   GDDLVRILRSMDETAKEVPVPIVTGDTKVVEEGIGMFIITAGIGIAERPISDAGAQIGD
FT                   VILVSGTIGDHGIALMSHREGISFETELKSDVAPVWEVVEAVAKAIGWENIHAMKDPTR
FT                   GGLSNALNEMARKANVGILIREADVPVRPEVRAASEMLGISPFDVANEGKVVMSVAREF
FT                   AEEALEAMRKTEKGRNAAIIGEVIGEYRGKVLMETGIGGKRFLEPPVGDPIPRVC"
FT   gene            425615..426583
FT                   /locus_tag="PYCH_05160"
FT   CDS             425615..426583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05160"
FT                   /product="signal recognition particle receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05160"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24206"
FT                   /db_xref="GOA:F8AHS3"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHS3"
FT                   /protein_id="AEH24206.1"
FT                   /translation="MFGKLREKLKAFVKRVEENVEREEEEAKKKGLLDRLIQVEIKEKD
FT                   VDEALDELELELLEADVALEVVDALREKIKERLVGKKVRIGTDKAKVIEEAVKEAVLEI
FT                   LRPEREVDLLEEIKKSEKPYVILFVGFNGSGKTTTIAKLAHWLKKNGLSVVIAASDTFR
FT                   AGAIEQLEEHARRVGVRVIKHDYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRN
FT                   LMDEMRKIARVTRPNLVIFVGDALAGNAIVEQARQFNEAVRIGGVILTKLDADARGGAA
FT                   LSISHVINAPILFVGVGQGYDDLRPFDEKWFIERIFGEAEA"
FT   gene            426580..426858
FT                   /locus_tag="PYCH_05170"
FT   CDS             426580..426858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05170"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24207"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHS4"
FT                   /protein_id="AEH24207.1"
FT                   /translation="MIKETGYGVLLSLYVRPNAKKNAVEGIDEWRERIKVSVTAPPVGG
FT                   KANRELVKFLSKLLGAEVEIVRGETSREKDVLVKGKTVEEVKKKLGL"
FT   gene            complement(426855..427538)
FT                   /locus_tag="PYCH_05180"
FT   CDS             complement(426855..427538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05180"
FT                   /product="metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05180"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24208"
FT                   /db_xref="GOA:F8AHS5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022877"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHS5"
FT                   /protein_id="AEH24208.1"
FT                   /translation="MVAMVKVKFLGHAAFYIEGSKKILIDPFLSGNPVAAAKPEELEAD
FT                   LILVTHAHGDHVGDAAEIARRTGAKIVAMYDIANYLVENNKGITTVGMNYGPTEIDGVK
FT                   IVQVPAWHSSSDGKYSIGNACGYIIELDGVKIYHAGDTFVFKDMELFAELYGPIDLALL
FT                   PIGGHFTMGVEEAAKAVELLKPKKVIPMHYNTWPPISADPEEFKRLVGDKAEVIILKPG
FT                   EMIEL"
FT   gene            427630..428793
FT                   /locus_tag="PYCH_05190"
FT   CDS             427630..428793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05190"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05190"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24209"
FT                   /db_xref="GOA:F8AHS6"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHS6"
FT                   /protein_id="AEH24209.1"
FT                   /translation="MPTNVTAEYLEAEEEYRNAKTIPEKIRALEKMYATVPKHKGTEKL
FT                   RLMIKRKLAELRKELEKQRQQRKGGGYSLAVKKEGAAQIVLVGFPNVGKSELLRALTGV
FT                   DVESADYPFTTTEPIPAMMNYKDVQIQLVEVPGLIEGAALGKGMGPQLLAVVRNADAIA
FT                   IVINLSEDPAKQMEILLREFERAGIKVNKRRPRVEIRKTPSGGIVINGAENIKGDLDEV
FT                   MRMLREERIHSAEITVKEPVTLEEFADALDDSLVWKKAIIIANKGDAPGSKENYERLVK
FT                   AYGDRFKIVPVSAKKGINLEAVKEALYEVADIIRVFTKSPGEEPAYPPIALKKGSTVLD
FT                   VAERIHKDFAKNFRYARVWGKSVKFPGQRVGPDHVLEDGDIVEIHAR"
FT   gene            complement(428825..431614)
FT                   /locus_tag="PYCH_05200"
FT   CDS             complement(428825..431614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05200"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24210"
FT                   /db_xref="GOA:F8AHS7"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR027552"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHS7"
FT                   /protein_id="AEH24210.1"
FT                   /translation="MKRSVALFALLMILTSPAGALKVISLSEADWILLGNAVLSGDRII
FT                   LTHAMPDQVSAAWFNRMIDVSRDFSVEFDVHFGSYVSGGEGMAFVLQSEGLAALGSGGD
FT                   GVGYVGIWPSVAVKFDTNPGEQVYVMVNGRQISRTLFDLQKLGLMEDGGLHRVKIIWDA
FT                   DEKLLRVWVDGIKVIEYRVDIEEVLESRYAYVGWTGATGQGVNLQFVKIVELDLPTVEK
FT                   AETVGQWNTVGTAYHYPVKMGFVLTPNEAFKAGAIWNKDSLDLRQPFSMIFRVYLGDHN
FT                   GGDGLVFVLQSQSKNALGMPGRGLGYLGIAPSVAIKIDTDVGLDRHDKEDYIVLMINGR
FT                   ELDEYRTHLGEVEDERTHIFEVRWEPTSKTLSVYLDGELRIKAQVDLINVLDSPYVYFG
FT                   WTAGTGLRTNLHYVVPLQLIYSSGGPVDEHGAYALWKTVGEAHVNENIRGVQLVEWPGD
FT                   GLGAAWYGRLVNLSRDFKMTFYFGFDSGRAKAVYFLLQGVGPDVTSPEISPSYGVKIWV
FT                   DDGEGYLGVVENGNVVEKFNVGKLYGDELHKLRVEWLADSRDLMVYLDEKRIFLKHVDL
FT                   IDNLGEKAYFGFIGIGGSFFKQGKLEFMAIKPTPNVGTIFEEAIRAVERALNVRVRAEY
FT                   RIASEWRVEGEEVFVNAKDLEEEWCGVDGGKAYVEIVRSVVRIALSERMHTPSDDLLDA
FT                   LAYRVMKEAGKVGSVNFSKLAECYISQMPMTPMWYRYYEGHLPSPRRPEGWRIEGGDVS
FT                   GSFVVLKGGRAEYLETLRGFRLTLRTKLQEGESLRIRIGDVSVILGVPDGVIVEVNGSK
FT                   AFIVPYPMDGDHVISIELSGSTIFISVDGIMLGDVSGITGDIRLSIEGRGAFGIVQFFA
FT                   EAVITDTAPRIESHETETTSIETETAENAKTTGEGGAGICGPALLSTLALLPLLFRRR"
FT   gene            complement(431668..432786)
FT                   /locus_tag="PYCH_05210"
FT   CDS             complement(431668..432786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05210"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24211"
FT                   /db_xref="InterPro:IPR025511"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHS8"
FT                   /protein_id="AEH24211.1"
FT                   /translation="MKKVGIIMGAMLLMALLNMGEVSAQAANIVILVSDNEADLTLAEK
FT                   VAELLNATIVVTSWGVYNEEVTAEIASLGPSLVLIIGGPRAVVSLYEEDLTDLGINVTR
FT                   IGGEDRVGTCRLVLEMLAKDYPELLKNVGGAIAYGWDIAALMQIKARKGLLPVLVSENE
FT                   TVDEQILQKFKNVTIMETPYSLRVMERVRAHIGEIAKEERLNITAEVAWEAIEIAENRT
FT                   ALAEELLQNVTIPAASKLLETAQKLLTEAKNAYEDGNYEKAYGLAIAAKAHAEAVIRMA
FT                   GEDAEMSIRKSLSLKLELKVRMIERVALRLQAIGYNVSQELQLLQQAKEALKRGDTSKA
FT                   LKILEEVEQMIREKVRTVPPRHHKMPIRPGRP"
FT   gene            complement(432942..434078)
FT                   /locus_tag="PYCH_05220"
FT   CDS             complement(432942..434078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05220"
FT                   /product="ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05220"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24212"
FT                   /db_xref="GOA:F8AHS9"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR011386"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHS9"
FT                   /protein_id="AEH24212.1"
FT                   /translation="MRVGLIINPIAGMGGRVALKGTDGVVEEAIKRGAKPIAGDIVRLF
FT                   LSELSHYDEAKDVEFITGPGPLGEDVLKEFPFRYEVIKHREISYRDVRGVRIPDTTAED
FT                   TKELARRMLGKVRLIVFAGGDGTARDVFEVIGRAVPMLGIPTGVKMFSGIFALSPEDAA
FT                   RLLVAFLKGEAPLELRPIIDLDEEAYRRDEVRTREFGRALTPVIESLIQGSKEPTPVDE
FT                   AEEVEALADSVAEEILEEDGIYFLGAGSTIKRIKDKLGIDGTLLGVDVVEVEGGNARLL
FT                   VKDATERDLLRFLPTRPKIVVTVIGGLSFLFGRGNQQFSPAVLREIPKENIIVVASESK
FT                   IRNGIVRAYTGDPEVDGKLKGYIRVRVSPWKERVVKIV"
FT   gene            complement(434083..435525)
FT                   /locus_tag="PYCH_05230"
FT   CDS             complement(434083..435525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05230"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24213"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHT0"
FT                   /protein_id="AEH24213.1"
FT                   /translation="MCEYTYSNGKKCRRKPLKGSKYCSLHIPFEEGELLYGEKIKEIKR
FT                   RAFEKALERGVRNFEGVQLYEVMIAGKDIEGPLIFRNSTIGRIVIANSKLKGLTLINTN
FT                   VESVVVIESSINFFYVNGSTLYGLSLCSVEFSSSILIRNSSIKYVMLNSVEYREAQITA
FT                   EEEYGERGRMAGRVELSNLRGVRRIAINSRYPLIKRLAEELGIEFNRKRKPVRIHMLYI
FT                   GGIKFDESPRFKRQVRLYINALIGGLTIENTSIPGHAEVVNSRIRYPEFVHVTVHNNFV
FT                   LKNSRFYSDETWNLTFLPNLLAELEVLGFIVIENCLFNNPYLAEVFYRIARTTWERSGD
FT                   KEKADEYYYLEMIARREKLLHHYLRGPKTPRRIFRLFEVFFEWLFADLTCKYGTDWRRP
FT                   VFLWVSLVLGVFPLFYYLTRSVEVTNSFFDYVYFSIVTATTLGYGDLHPVGVGKMIASV
FT                   EAIFGMFMWAVFLTVFARKYMR"
FT   gene            complement(435525..436310)
FT                   /locus_tag="PYCH_05240"
FT   CDS             complement(435525..436310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05240"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24214"
FT                   /db_xref="GOA:F8AHT1"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHT1"
FT                   /protein_id="AEH24214.1"
FT                   /translation="MALGIIPLVSFLLVVLISVIIVRIGAVALEMTGLSRDVAAFQAQS
FT                   AFSGVGFTTSESEYVVAHPVRRRIIRTLMFLGSAGITSAIATLVLSFMETSPQQAGVRL
FT                   LLLVVGLIAMYIFFRSKLVERAMRRVIRKVLGRLAPSLRIYDYSQLLGITRGYSISQIR
FT                   VKKNSWLANKTLRELELDKEGVLVLGIYRKVNGKEVYIGAPHGNTKIMPGDLVILYGPE
FT                   DTLLNLSRRVKGARGKAEHEEAVEKARLRSMQEEMEGRI"
FT   gene            436426..437397
FT                   /locus_tag="PYCH_05250"
FT   CDS             436426..437397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05250"
FT                   /product="n-type ATP pyrophosphatase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05250"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24215"
FT                   /db_xref="GOA:F8AHT2"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHT2"
FT                   /protein_id="AEH24215.1"
FT                   /translation="MRCSKCGREAVYFARYEGRYYCHRHFNEMVERKVKATIRKYQMIR
FT                   RGEKIGVAVSGGKDSVVLMHLLAKLRRKFPFELVAITIDEGIRGYRDRSVEIAKRNAEL
FT                   LGIEHHIYSFRDYIGLTLDETVEIMGPREERVGACSYCGVWRRWLLNCAARELGVDKLA
FT                   VGLNLDDEVQMFLMNLMRGDVARLGRTGPYYEEIHEGLVPRIKPLREVPEKEIVLYAVL
FT                   NDIEVDLSECPYAVEAFRAEIRDWLNEMEEKHPGTKYQLLRSYDRLFPLIAKTYAREIG
FT                   LNRCKLCGQPTAGKICKACQFRLQVVERARKKGIAFTLQGEP"
FT   gene            complement(437420..437671)
FT                   /locus_tag="PYCH_05260"
FT   CDS             complement(437420..437671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05260"
FT                   /product="50S ribosomal protein L14e"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05260"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24216"
FT                   /db_xref="GOA:F8AHT3"
FT                   /db_xref="InterPro:IPR002784"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR023651"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHT3"
FT                   /protein_id="AEH24216.1"
FT                   /translation="MPAIEVGRIGVIIAGRRAGQKVVVVDIIDKNFVLVTGAGLNKVKR
FT                   RRMNIKHIEPLPEKINIPRGASDEEVRQALEQAGISLA"
FT   gene            complement(437672..438250)
FT                   /locus_tag="PYCH_05270"
FT   CDS             complement(437672..438250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05270"
FT                   /product="cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05270"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24217"
FT                   /db_xref="GOA:F8AHT4"
FT                   /db_xref="InterPro:IPR011892"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHT4"
FT                   /protein_id="AEH24217.1"
FT                   /translation="MPKGCLVVTVSGLAGSGTTTLCRKLAEYYGFKHVYAGLIFRQMAK
FT                   EHGMTLEEFQKYAELHPEIDREVDRRQIEAAKECNVVIEGRLAGWMVKNADLKIWLDAP
FT                   IRVRAERVARREGISVEEAFMKIAEREMQNRKRYLNLYGIDINDLSIYDLIIDTSKWSP
FT                   DGVFAIVKAAIDHLDPVGDAGSKKEKEVG"
FT   gene            complement(438262..438531)
FT                   /locus_tag="PYCH_05280"
FT   CDS             complement(438262..438531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05280"
FT                   /product="50S ribosomal protein L34e"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05280"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24218"
FT                   /db_xref="GOA:F8AHT5"
FT                   /db_xref="InterPro:IPR008195"
FT                   /db_xref="InterPro:IPR018065"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHT5"
FT                   /protein_id="AEH24218.1"
FT                   /translation="MKPMYRSRSWRRKYVRTPGGRVVIHFERRKPKIAHCAICGRPLNG
FT                   IPRGRPVELRKLPKTKKRPERPYPHLCPKCMRRAMKEQIRAQLS"
FT   gene            438642..438881
FT                   /locus_tag="PYCH_05290"
FT   CDS             438642..438881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05290"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24219"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHT6"
FT                   /protein_id="AEH24219.1"
FT                   /translation="MILEGEPEVVPGGEEEVEASEETVEQFFAHSKGNTVYISFATTDA
FT                   KITIGISHDKATLEEMVRAVKELILEFKERRGRV"
FT   gene            438878..439900
FT                   /locus_tag="PYCH_05300"
FT   CDS             438878..439900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05300"
FT                   /product="pyruvate formate lyase activating protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05300"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24220"
FT                   /db_xref="GOA:F8AHT7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHT7"
FT                   /protein_id="AEH24220.1"
FT                   /translation="MRELEKAKKALPKYFAILEGEDVPNFFLVRKVGVDFSPDAPLDDL
FT                   WTKHGEGLDRLRENDLREGPKNLLDLKVAIAERILESCHLCEIKCGVNRKRDIGYCRVR
FT                   ESLVASDFLHLGEEPELVPSYTIFFSGCNFRCVFCQNWDISQFRVGVPYDPHIMARKIE
FT                   LAFAEGAKNVNFVGGEPTPNLPFILETLRHVRVPIPVIWNSNMYMSEAAMKLLDGIVDI
FT                   YLGDFKWGNDECALKYSKAPRYWAVVTRNFLLAKGHFRAEFLIRHLVMPGHLECCTRPI
FT                   LEWVAENLGRDVRVNVMFQYRPEYKADEYPEINRLLWGEEMERAEMIVKELGLRNALVG
FT                   "
FT   gene            439901..440242
FT                   /locus_tag="PYCH_05310"
FT   CDS             439901..440242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05310"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24221"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR022906"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHT8"
FT                   /protein_id="AEH24221.1"
FT                   /translation="MLRNDTKGKVWTGEVCIADTFLKRFLGLMFRRVTYALILVLPTET
FT                   RTNASIHGFFMREPIDVIFLDSERRVVDMTLLKPWHVYLPKRPARYVVEGPVGLISALN
FT                   AEEGDVITW"
FT   gene            complement(440229..440816)
FT                   /locus_tag="PYCH_05320"
FT   CDS             complement(440229..440816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05320"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24222"
FT                   /db_xref="GOA:F8AHT9"
FT                   /db_xref="InterPro:IPR003827"
FT                   /db_xref="InterPro:IPR022908"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHT9"
FT                   /protein_id="AEH24222.1"
FT                   /translation="MLPFTKSFEAEKRKALEKLRAAMERGDVDEDIIPLLGKFNALPSY
FT                   FTTSSCSGRISVMEMPNFGDKVNAVWLGKWHREVSLEEVLGAVRKHRKGQLWFLVRSPI
FT                   LHVGARTLEDALKLLNLAIGAGFKYSCIKSVSERKLIVEIRSTERMDVPLGLNGTLWVD
FT                   ENYLARIVEIANAQLRRFKGKLKRLEEAVTRL"
FT   gene            complement(440818..442788)
FT                   /locus_tag="PYCH_05330"
FT   CDS             complement(440818..442788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05330"
FT                   /product="DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05330"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24223"
FT                   /db_xref="GOA:F8AHU0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004483"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHU0"
FT                   /protein_id="AEH24223.1"
FT                   /translation="MVSIKGFVNKLKELVEIEREAEIEAMRLEMRRLSGREREKLGRAI
FT                   LGLNGKVVGEELGYFLVRYGREREIKTEISVGDLVVISKRDPLKSDLVGTVVEKGKRFI
FT                   TVALETVPEWALKGIRLDLYANDITFRRWLENLDNLREGGRKALEFYLGLREPEKSEPV
FT                   EFEPIDKRLNASQKKAVSLALGSSDFFLIHGPFGTGKTRTLAELIRQEVKRGNKVLATA
FT                   ESNVAVDNLVERLAELNVVRIGHPSRVSKHLHETTLAYQMTRHELYGELRELLVTAQGL
FT                   AEKRDTYTKPLPKFRRGLSDNEILRLAERGIGARGVPARLIREMAEWIKLNRQVQKAFD
FT                   EARKLEERIAREIIREADVVLTTNSSAALEILDVADFDVAVIDEATQATIPSILIPINR
FT                   VERFILAGDHRQLPPTILSLEAQALSKTLFEGLIERYPEKSAMLNIQYRMNERLMAFPS
FT                   REFYEGKIIADESVKNITLADLGVKEPGFSEPWAEILRPENVLVFIDTAHRHDKWERQR
FT                   RGSESRENPLEAKIVATIVGKLIEMGVKPEWIGVITPYDDQRDLISLNVPEDVEVKTVD
FT                   GYQGREKEVIILSLVRSNERGEIGFLRDLRRLNVSLTRAKRKLIIVGDSATLSSHPTYK
FT                   RLVEFVKEKGKLVDARELRGV"
FT   gene            442855..443613
FT                   /locus_tag="PYCH_05340"
FT   CDS             442855..443613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05340"
FT                   /product="metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05340"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24224"
FT                   /db_xref="GOA:F8AHU1"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHU1"
FT                   /protein_id="AEH24224.1"
FT                   /translation="MVFEYHWTVPELNLKKHRKIDAHAHIQELGDPFNVGITERDMLRL
FT                   MEEYSIELAVISDVDNEKIMRIVRGNPDRFIGIYWANPRAESPKEAEDNIINSGFRGIK
FT                   LHPLLHMFRPSSVRVRKIVEIAGKLGIPVFIHTGHAPTSLPSQVARLVKDFPDVKFVFV
FT                   HMGHGNAYYIQEAIDIGKELDNVYLETSGMPMSSKIAEAYLEVPDRVMFGTDVPCHHPA
FT                   VEIVKVLSSGLNEKALRKVFYENAKELLEL"
FT   gene            complement(443620..443697)
FT                   /locus_tag="PYCH_t55"
FT   tRNA            complement(443620..443697)
FT                   /locus_tag="PYCH_t55"
FT                   /product="tRNA-Ile"
FT   gene            complement(443705..443782)
FT                   /locus_tag="PYCH_t60"
FT   tRNA            complement(443705..443782)
FT                   /locus_tag="PYCH_t60"
FT                   /product="tRNA-Glu"
FT   gene            complement(443825..444322)
FT                   /locus_tag="PYCH_05350"
FT   CDS             complement(443825..444322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05350"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24225"
FT                   /db_xref="InterPro:IPR019217"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHU2"
FT                   /protein_id="AEH24225.1"
FT                   /translation="MRRLPQLFVEASYEECFDEEGKAKVDCIVIQGNVEVRMRKGEKLP
FT                   AFIDPKEAKFLAKEVYDRFHFYVDQYEHRMRVDAIIVLPDRRTEIRLQKGDELLLLPVE
FT                   GYVVTLIADVGNRVRTGDAFAAVTTRKGEVHYMKPPKPGVVVYIDEFTNRPNYVYYILP
FT                   EE"
FT   gene            444472..446331
FT                   /locus_tag="PYCH_05360"
FT   CDS             444472..446331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05360"
FT                   /product="formaldehyde:ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05360"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24226"
FT                   /db_xref="GOA:F8AHU3"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHU3"
FT                   /protein_id="AEH24226.1"
FT                   /translation="MKGWWGRILRIDLTTGKVRVQEYSPNIAQQFIGGRGLAIKILWDE
FT                   VKGVDPLSPENKLIFAAGPFNGLPTPSGGKMVVAAKSPLTGGYGDGNLGTMATVHLRKA
FT                   GYDALVVEGKAKKPVYIYIEDDNVSILSAEGLWGRGTFETERKLREIHGKNVGILSIGP
FT                   AGENLVRYAVVMSQEGRAAGRPGMGAVMGSKNLKAVVIRGTKDIPVADKEELKRLSQEA
FT                   YQAILNSPGYPFWKRQGTMAAVEWTNENYALPTRNFQDGQFEFARSIDGYTLEGMKVKQ
FT                   RGCPYCNMPCGNVVLDVEGLESELDYENVALLGSNLGIGKLNEVAALNRIADDMGMDTI
FT                   SLGVSIGFVMEAVERGLLKEGPTFGDFKGAKQLALDIAYRRGELGNFAAEGVMRMAQKL
FT                   GDDSFAMHVKGLEVSGYNSYIYPAMALAYGTSSIGAHHKEAWVIAWEIGTAPIEGEQAK
FT                   KVEYKITYSPEKPAKVIELQRLRGGLFEMLTACRLPWVEVGLSLDYYPRLLEAITGVKY
FT                   TWDDLYKAADRVYALIRAYWVREFNGKWDRTMDYPPKRWFIDGLKSGPYKGQHLDREKY
FT                   DALLSEYYRLRGWDERGIPKKETLKELGLEFVIPELEKVTELH"
FT   gene            complement(446399..447478)
FT                   /locus_tag="PYCH_05370"
FT   CDS             complement(446399..447478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05370"
FT                   /product="x-pro dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05370"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24227"
FT                   /db_xref="GOA:F8AHU4"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR028980"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHU4"
FT                   /protein_id="AEH24227.1"
FT                   /translation="MRGDPEVFRKRVERFQELLRENGIDGAVIRTLSSFIYFTGTKWLR
FT                   PSLLIPAEGEPVVYVVKGEEELFREKSWIENVVEFQRVEDLMAGIVTWIHGNGMTRVGL
FT                   EFGIERDAYLIFLKIFERLNPTVEIVDILDLTMRLRVIKDEWELENIRRAGKIAIKGMK
FT                   VAEEVIRPGISELEIAAEVTRELMLNGSENPKVYVSVTPRAHAEPFRDLKVPENGVVTV
FT                   VIGADWNHYYANMARTFIVGEPGRRVRRAIEVKEEAYRIALEETRVGIPLSAVEKKIVA
FT                   LVRKRGFGDFYLAGYTHGVGLLIEEPPIATIVVPQRAQKVQENMVLAIIHPPLMLPEGA
FT                   IKREDTYVVKKDKLEPVTA"
FT   gene            complement(447482..447793)
FT                   /locus_tag="PYCH_05380"
FT   CDS             complement(447482..447793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05380"
FT                   /product="Hypothetical carbohydrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05380"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24228"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIS8"
FT                   /protein_id="AEH24228.1"
FT                   /translation="MKVVRVEEAERVENPHGVDVRKLIDEKSAQIFYITLKPGESLKRH
FT                   TTPVDAFIYVLKGRGIVEVGDERAEVKKGTAIYLPKGVPHAVSNGGSLDMAFLVIKVV"
FT   gene            complement(447795..449135)
FT                   /locus_tag="PYCH_05390"
FT   CDS             complement(447795..449135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05390"
FT                   /product="sensory box protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05390"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24229"
FT                   /db_xref="GOA:F8AHU5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR007380"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHU5"
FT                   /protein_id="AEH24229.1"
FT                   /translation="MTELLNNREYKKEQLKKLLLRIHEGEDVNKLKEEFRQVLSGISPL
FT                   EIPIIEQELVKEGISAKDIAKMCDLHVELFREAVAGTEEVEEKDLPDGHPLKTLYLENK
FT                   EIMKDAEMLNLYARTLATTKDERMKAEILGVLEEIVGNLRKVGFTHYNREEMLTFPYIE
FT                   RRGLTAIATVLWTKHDEIRFMVKRLAELLRKKDEMPWEEFVERFKEKASEVSFALSDMV
FT                   FRENNILYPTLKALLSEGEWKAIRMQEDEIGYYKVNPPAWDPGEDVKPLHPWEINPELS
FT                   VEELLNLPKEVQQALKGRPLEFDKSQLKREGDIDLGTGFLSIEELKAIFEALPVDVTFI
FT                   DKDDRVRFFSPGERIFTRTLSVLGRPVQLCHPPKSVPIVNKILKAFKEGRKSEATFWLR
FT                   IGERYVYIKYVPLFDKEGNYLGTLEITMDIEPYRKIKGEKRLLDWRD"
FT   gene            449326..449613
FT                   /locus_tag="PYCH_05400"
FT   CDS             449326..449613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05400"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24230"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIS9"
FT                   /protein_id="AEH24230.1"
FT                   /translation="MGETLEVIEDKPFVDMLGRLEEAGYRVELKEVGGAFVLRIMKTED
FT                   SMELRMEIRECDDKLDEITEETNVAKLLKAYPESLKILVKYGFSPLRIPR"
FT   gene            449610..449729
FT                   /locus_tag="PYCH_05410"
FT   CDS             449610..449729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05410"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24231"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHU6"
FT                   /protein_id="AEH24231.1"
FT                   /translation="MRKTLARTITLKQAKELIGMGDEKFREMMEELKELERGR"
FT   gene            complement(449914..450078)
FT                   /pseudo
FT                   /locus_tag="PYCH_05420"
FT                   /note="hypothetical protein / fragment"
FT   gene            complement(450069..451169)
FT                   /pseudo
FT                   /locus_tag="PYCH_05430"
FT                   /note="hypothetical protein / fragment"
FT   gene            complement(451159..451674)
FT                   /locus_tag="PYCH_05440"
FT   CDS             complement(451159..451674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05440"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24232"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHU7"
FT                   /protein_id="AEH24232.1"
FT                   /translation="MVYAVVSHGREIFSGLIEPVAFAGDLINLLKFSRGNFEGMSIQGM
FT                   SVAYVDWFNESLSLLRAIDQRSTEGSFILLTFRSEYPKPVLVFKKGEEVLLVSSYTKIV
FT                   VKIGMDELFEAVKRAVVEIIKHISQWDGTLLGGWTGREAASMLAGELKDVREADVPGVS
FT                   GGGSLNAG"
FT   gene            complement(451656..451880)
FT                   /locus_tag="PYCH_05450"
FT   CDS             complement(451656..451880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05450"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24233"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHU8"
FT                   /protein_id="AEH24233.1"
FT                   /translation="MHEEDLPKTKITLATSEFVSSALDFVRSFLKEFPDEELMRELEIV
FT                   EEMARRKGMLPPGGKLNAGKRSFQWFTLL"
FT   gene            complement(452227..452766)
FT                   /locus_tag="PYCH_05460"
FT   CDS             complement(452227..452766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05460"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24234"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHU9"
FT                   /protein_id="AEH24234.1"
FT                   /translation="MEWLRFKLKPPSTEVLEMFGEPEDVMDEYEVQVYGSTYILEAFVN
FT                   LEGYVKELKLLKAFVADGKLPAEEWRVKRNVDGEIKRLSSKRAEKPEDRGLLRELAGLK
FT                   KLSAGAAPPFVRFTLSTYDPFEVLYAAKLEKDFLLAFVLYSGMAVKVPKNVLLRAIDEA
FT                   IKDTEKELERIKLPKR"
FT   gene            complement(452777..453691)
FT                   /locus_tag="PYCH_05470"
FT   CDS             complement(452777..453691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05470"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24235"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHV0"
FT                   /protein_id="AEH24235.1"
FT                   /translation="MECSLTWDELIPADGPLWKALIVPPGHYRIMLGPVNVFSRVHSLK
FT                   LILAIDGLAKSTIYLLSSDFEGMELEDEPDYTTLISSCRAFNGFFLLTLGLPEDFGVLM
FT                   KREGDKVTLCYPDDFNLLLPTYSIRKVELPARELGLCMKSAALNALGRLDDRIPEGLRD
FT                   EYLEWKRRIMEYISASKYWGLYRIVTAFPPSSGRYSQEVISIFAFSFFPQDGDRGFPML
FT                   VLGDRPVFISETPVTLDEFMSSLKALQSMDAFPKKLWDLKIRVEGEWVCLTLRSGREVQ
FT                   VTRKKTRRDNPDFHPEPKSGSQQ"
FT   gene            complement(453738..453866)
FT                   /locus_tag="PYCH_05480"
FT   CDS             complement(453738..453866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05480"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24236"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHV1"
FT                   /protein_id="AEH24236.1"
FT                   /translation="MEGYAQSCPHKNINGKWYTVVIERVRYWWEVVTAFPRDAPPL"
FT   gene            complement(454100..454483)
FT                   /locus_tag="PYCH_05490"
FT   CDS             complement(454100..454483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05490"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24237"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHV2"
FT                   /protein_id="AEH24237.1"
FT                   /translation="MGWRRLLALALVVLFLGMTLSSASATASFVNATVNSTVTVPPEFS
FT                   PERKPGGEVQPQFGGATVVVQPFLEVFVPGVGWIVAVGSIIAAIAKYVYSKPVREFTEA
FT                   FVSEIPDRISYNGWELAKGVRMK"
FT   gene            complement(454708..456063)
FT                   /locus_tag="PYCH_05500"
FT   CDS             complement(454708..456063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05500"
FT                   /product="hydroxylamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05500"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24238"
FT                   /db_xref="GOA:F8AHV3"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHV3"
FT                   /protein_id="AEH24238.1"
FT                   /translation="MEGVEMLCNQCSMSLKGGCTVRGVCGKDPDLNSLQEALLYGIKGT
FT                   AAYYYHALEVGYDDPRIGHFLAEALYSTLTNVNFDKNRFLELILETGRIHLEAMKLLDK
FT                   AYVETFGRPEPVEVPTGTAEGHGILVTGHSYKALYELLRQIEEMGLDEEIKVYTHAEMF
FT                   PAHAYPELRKFKALYGNWGGSWLYQRREFAEFPGVILGTSNCVQQPTKAYADRIFTVGI
FT                   AGLEGVPHIRDYDFEPLIKRALETPKMERREGGKLLTGFHHTNVLAMKDKLIELIQEGK
FT                   IRHIFVVGGCDTPSPKMSYYERLTALIPRDALILSAACGKFRYNARDYGTIEGIPRFLD
FT                   FGQCNNVYSIIEIALTLAKELGTDVNSLPVSIVLSWMEQKAIAILYSLLYLGIKGIYIG
FT                   PKSPEFLTPNVFEILKRQFDLRLIGDPEKDLRDMLSKGISVEESSPLAEELG"
FT   gene            456361..456759
FT                   /locus_tag="PYCH_05510"
FT   CDS             456361..456759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05510"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24239"
FT                   /db_xref="GOA:F8AHV4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHV4"
FT                   /protein_id="AEH24239.1"
FT                   /translation="MRTNAFEIVARYVYPSLRRRLVEILREKGLKQTEIAGLLHITQSA
FT                   VSRYLKMDRGALIDVTKFPDIDEKLKVLADEIISRRPSEYEIHLGLVQVSLEMLGRGYV
FT                   CSFHSKIDPELDPMKCRICLELFENLAF"
FT   gene            complement(456784..457557)
FT                   /locus_tag="PYCH_05520"
FT   CDS             complement(456784..457557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05520"
FT                   /product="metallo-beta-lactamase domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05520"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24240"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIT0"
FT                   /protein_id="AEH24240.1"
FT                   /translation="MIRNMNSYPLYDDGEHKVYWLGIEEAEDEKGILTNQYLVIDGNEA
FT                   ALIEPGGFFVFSRVLKNVSSLIPPAQIKYLLYSHQDPDVVAGLNLWFEYAPLAKIVISE
FT                   LWVRFIPHLAVLNGGRVIGIPDKGMDIKLGSSVIRAIPSHYLHSPGNFSFYDEKSGVLF
FT                   SSDIGAAAFPQGEWYLFVEDFKSHTKLMEGFHRRYMGSTKALRAWVRSVRKLNPKAIAP
FT                   QHGAIFRDKNVGKFLDWLESLEVGIEVFEKEFYDE"
FT   gene            complement(457559..458350)
FT                   /locus_tag="PYCH_05530"
FT   CDS             complement(457559..458350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05530"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24241"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHV5"
FT                   /protein_id="AEH24241.1"
FT                   /translation="MKRKTKEVTIDVPLDSVRKVLSDPAQFIMNWPYVVRVSTKNGITA
FT                   EISLPRFLFKFNDIYRFAFHEDRTTFIYDGSGKKSDIIVTVTLKKWQRNVSGEIEVAYH
FT                   GRGEFFLGKTLELLAEGIAKSLKELAKSYSPPEYVTSSDVILQVDFADPMSVANFLAKA
FT                   KMIHSGLHMIENRKFFDVLMELKKTVSARIIYISGITPDGNKAFKVLIKDSQILALEHR
FT                   DGVTAETIKVDDEETARKVFEILSRIEGTYMINIWVPVGGE"
FT   gene            complement(458347..458571)
FT                   /locus_tag="PYCH_05540"
FT   CDS             complement(458347..458571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05540"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24242"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIT1"
FT                   /protein_id="AEH24242.1"
FT                   /translation="MAMNDERGKPHLVGRIKLRHRTVVDLNLWPVLYEKEQKFTFKDGD
FT                   EVFFIIPFDVSEGVEGVYLRLIEVLGEMK"
FT   gene            458874..459755
FT                   /locus_tag="PYCH_05550"
FT   CDS             458874..459755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05550"
FT                   /product="permease auxin efflux carrier family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05550"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24243"
FT                   /db_xref="GOA:F8AHV6"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHV6"
FT                   /protein_id="AEH24243.1"
FT                   /translation="MDILEMLGLILLGYGLRRIVREEKFFDALRFVTNQILLAFFVFGN
FT                   VASKDLEYLLSIKLVFLYVFLVIGMSLGLSYLYGRLFLKDKEWAGALMALSAYPNTAAL
FT                   GFPVVSLFLDDITPAILYSTTNSLIVLPIVTFIAAHYSTGGASLKRSFFRALRFPPTLA
FT                   NLLAIFLVLGGVRLPAAVLDTIKAVGWWSIPLILVYFGSRISLRALHVRRLLEVAAFRI
FT                   AIPFTFVFLTLRNADPKVFYSVLVEASMPPAIAANAILAQYRLKAEEAISVTFVLTLAV
FT                   LGLFLIFRLLIG"
FT   gene            complement(459845..463324)
FT                   /locus_tag="PYCH_05560"
FT   CDS             complement(459845..463324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05560"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24244"
FT                   /db_xref="GOA:F8AHV7"
FT                   /db_xref="InterPro:IPR010502"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHV7"
FT                   /protein_id="AEH24244.1"
FT                   /translation="MKKGAGLLVVLLLFLSLVPMTDVVSAMYGTKIIDGDLSDWTPSDI
FT                   VAVGVDNGQAGANLDRLYVAWDDQYLYIAIKTNNTESWGIVYGIGIDVDPGTGSGYTFY
FT                   DQDGNPSTTEDMWWRNIAFGSGYAIDYEIYFWYDAENDRIGGGSFGTWTGSGWETTDVN
FT                   NVLQYAQTSGSGLQVLEMAIPWSALGGKPNKIAIISWISGGNGGDSAVDTLPIDPAIDY
FT                   NNIGSEWTDGDTLTNLAELYVGTKTIDGDLSDWTPNERISSADSGLAGAEIKALYVSWD
FT                   SEYLYIAIETGNTQSWDVAYGVGIDVDPGTGSGYTGGDNPSDAWGRKIGFGNGYAVDYE
FT                   IYFWWGWNTGMGADNFIRWTGNGWDYKSLAEIGATFAYTGDTSTGLQTLEIAIPWSALG
FT                   GKQSSFAIITWVAGGDGSSAVDSAPVDTGIDYTNINGEWTDSDIFTNLATFEWFLMPDL
FT                   TVTVSGPAAVGVGKEAEFTVRVKNEGSLPVTGASVKLYINEELHAEWRVDLGPGEETSL
FT                   TTIWTPEVEGTYTLRAIVDEDNLIAEANENNNEFVMTVNVVWVGTVNVDGDPGDWPTIT
FT                   VEPNSYTLKDGVFFWNDSVGDQRHSKDLYLPGETSSHADLVGVGVTKDDRYVYFLFRFA
FT                   DMSNIKIGDNGATFIAVPIDYKEGGADWFAGEMDTKTVILWDIQMVVNLGGTEYSGQVQ
FT                   AIAPAGESKTSLLYFVDAKGDIIPVEDALIGVDLTKNTVEVRIPLSIFEGAKEFSFQVA
FT                   TAFSYGPAVWNFGDPFANDEKTDIVDTISTEDTVQELADNVPHFYVKIKMNSIVEYAEV
FT                   VDYRVIEELMRQKQEEMRRIQYMNAFVNVAKFYGIRSFQRDYARYRELVEMLSSKPLPD
FT                   EVRGKLREYEFEVQELLNLYNYGKERIEKNYLAFGAALKIYRAYIRLRSIVRDLEEIMN
FT                   MIESGELEWQKEMERLRQNLTKEIDGDISDWKVKPVVEDTTGFGQDGANLKALYVDYDE
FT                   NFLYIALTTENKASWRVAYGISLDFKEGGYTAGQDAWSRSISFDRGIDAQLYFFWNGEF
FT                   FGDPGTSTITSAQLALWNGTAWVYNDLDSVAFYAYTGGSENGLQVIEIAIPWKVLGGKP
FT                   TEIYIVAYVTGQGAGDSAVDALPDQSALHDNEPGNEWTDEDFFTEFARVVIR"
FT   gene            complement(463455..465176)
FT                   /locus_tag="PYCH_05570"
FT   CDS             complement(463455..465176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05570"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05570"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24245"
FT                   /db_xref="GOA:F8AHV8"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004526"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR022888"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHV8"
FT                   /protein_id="AEH24245.1"
FT                   /translation="MDIERLILKHALINAYQHGGRANPKAVIGKVLGENPELRPKAKEI
FT                   IPLVNRIVEQVNALSLEEQEAKLREIYPEFFKAKKDKREEKKGLPPLPKAEKGKVVTRF
FT                   APNPDGAFHLGNARAAILSHEYARMYDGKFILRFDDTDPKVKRPEPIFYEMIIEDLEWL
FT                   GINPDEIHYASDRLEIYYRYAEELIKMGKAYVCTCPPEEFRRLRDAGKPCPHRDEPVEV
FT                   QLERWYKMLNGEYKEGEAVVRIKTDLNHPNPAVRDWPALRIIDNPNHPRTGNEYRVWPL
FT                   YNFASAIDDHELGITHIFRGQEHAENETRQRYIYEYFGWEYPVTVHHGRLSIEGVILSK
FT                   SKTRKGIEEGKYLGWDDPRLGTIRALRRRGIRPEAIRELIIGVGLKKSDATVSWDNLAA
FT                   INRKLVDPVANRYFFVADPIPMYIEGYDEEFIAEIPLHPDHPERGKRRLVFRPGKPVYV
FT                   SRDDLNLIKPGNFVRLKDLFNVEILEASEEGIEAKFHSVDYEVAREKGWRMIHWVTDGK
FT                   PCKVFVPQGDELLVRRGLLEADAAVNVDEVVQFERFGFVRIDDVTPKEVVAIFAHK"
FT   gene            465289..465648
FT                   /locus_tag="PYCH_05580"
FT   CDS             465289..465648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05580"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24246"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHV9"
FT                   /protein_id="AEH24246.1"
FT                   /translation="MVHEYIKGKIKEFSKEEKEKRYKYLGKEVIDVGDPGLDSIPEFYG
FT                   IANAIWRDWKNGEINTKTAIGRLALLKLLTYKSKNRKIKDIPEEELEEVRKFIDYIIQV
FT                   IENESRRKSESGENK"
FT   gene            465803..469006
FT                   /locus_tag="PYCH_05590"
FT   CDS             465803..469006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05590"
FT                   /product="Isoleucyl-tRNA synthetase (ileS)"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05590"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24247"
FT                   /db_xref="GOA:F8AHW0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHW0"
FT                   /protein_id="AEH24247.1"
FT                   /translation="MIREPEFREYDANRLEEKIERFWKENDIYGKVKASRANGPKYYFL
FT                   DGPPYVSGAIHLGTAWNKIIKDMIIRFRTMQGYNVRRQPGFDMHGLPIEVKVEQALGLK
FT                   TKKEIEEKIGVENFIRKCREFALNNLRIMTEQFKMLGIWMDWDNPYMTIKNEYIESAWF
FT                   TLKRAWEKGLLEKDKRVLHWCPRCETALAEHEVRGEYKMRKDPSIYVKFPVEGKENEYI
FT                   LIWTTTPWTLPANLAVAVHPEYDYAKVRVKTESGEEYWIIAKALVEKVLGEVGVEGEVV
FT                   EEFKGEELEGLRYVHVLLDEYPRQKEFREKYEWAHRVILGEHVTLEEGTGVVHTAPGHG
FT                   EEDFEVSQRYGLPVYSPVDDQGRYVEGKWKGIYVKDADPQIIEHLKAKGYLVKAGTIEH
FT                   KYPHCWRCKTPLIFRATDQWFLKVSKVKEKIIKENDEKVTWYPDWVKVRYDNGVLNSGD
FT                   WVISRQRYWGIPLPIWQSDDGEIYVVGSFRELVELAVAIEVNGERIELPESYEEKLKVI
FT                   EEKLGPEDLHRPYVDAFIIKVNGKEMRRVKDVVDVWFDSGIASWASLGYPRNKELFEKL
FT                   WPADFIVEGEDQVTKWFYSQQAASVIAFDTVPYRKVAMHGYVLDEKGDKMSKSLGNIIR
FT                   PEDVVQKEGRDSFRFYMLWATNPWENLRFSWKGLAQVKRMLNILWNVYVLSATYMSLDN
FT                   FDPTKLKPEELPFREEDRWILSRVNGLISKVENGIETFYLTRATRAIYDFVVEDLSRWY
FT                   VRLIRKRLWVEGDDPDKLAAYYTLWKVFDVLLRLMAPFTPYIAEEIYQNLLRPFIGVES
FT                   VHMLDWPKADEKAIDEELEREMEYVRRIVEAGSSARQRAKIKLRYPVRRIIIETEDETV
FT                   KKAVERLNRILKDQLNAKEVVVGRVERELVIKPNFAKVGPEFKGDARLVIAWINEHGRE
FT                   LYERGEMDVKIGGKTFHLTREHLSIEEKLPDFFVAEDFEGGRVFVDKTLTRELLAEGLA
FT                   REFVRRIQEMRKRLDLDVNDRIVVTIETSEENRELLSENLNYVKKETRAVEVIFGEAKG
FT                   YVVEWPEVQAKIGIERVEG"
FT   gene            complement(469214..470005)
FT                   /locus_tag="PYCH_05600"
FT   CDS             complement(469214..470005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05600"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24248"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHW1"
FT                   /protein_id="AEH24248.1"
FT                   /translation="MRRRKIILKIFVFPVVLFAVLFGFAWVKLGVITLEWVLSTVLLFV
FT                   LMVASMVFFLARILEKHGYRKRDIKRIDEILEEHWDEPWDSGYLKYDVQECIAHHLILW
FT                   GIFSTSLLGFHDVFLAIMAFVGLAFLMVVMYPVFATMVVWIIVLPLYFLRSKRTDDGFE
FT                   FVGKTSLASTLAIPVIWAVSSYVLTQNYPEDVLRMFNAVVRNAEGFLILSVLNTLFGFL
FT                   GVYLPRRGGRRILTIVLLSLAVAMLFVVWSILQPLNSAGGI"
FT   gene            complement(470050..471126)
FT                   /locus_tag="PYCH_05620"
FT   CDS             complement(470050..471126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05620"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24250"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHW2"
FT                   /protein_id="AEH24250.1"
FT                   /translation="MNWRKATFGVFLIFIVLSLQLIAAPQAMAMSTSNASVTFRRAVVA
FT                   WYDENGKLQMNVTWVNATLNFTNLTHSPCVCQNGSSCGAFNTSAHVNVSIITLYNMTRD
FT                   HEQLLFVKVTAYNATVNYTIYNLVYRAERSQYNFTLITKILTDPETGEYRAFVTGMNIA
FT                   PHDKDKALPVGDTVLVLGNLTLSDYYWTLNKILMKLRRSDETSWIWGRSAYELRHLSHL
FT                   VRLKLPEYNGKTNLGYAIVIDDYSGCSHLCDLACTSAFTIVCLGAMASGGWVLSAICLI
FT                   GGGVCTLGCSTLCGSMDIKSLASSAGCSYGCSEILVKKVFCGRYICKIPFPGCESGCAA
FT                   VFTPLFCPQFCALLASRI"
FT   gene            471026..471139
FT                   /locus_tag="PYCH_05610"
FT   CDS             471026..471139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05610"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24249"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHW3"
FT                   /protein_id="AEH24249.1"
FT                   /translation="MLVLIAMACGAAINCRLNTMKIRNTPNVAFLQFMATT"
FT   gene            complement(471328..471669)
FT                   /locus_tag="PYCH_05630"
FT   CDS             complement(471328..471669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05630"
FT                   /product="Kef-type K+ transport system membrane component,
FT                   session1"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05630"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24251"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHW4"
FT                   /protein_id="AEH24251.1"
FT                   /translation="MIDSLVISGLIGILFAVVSEKDYKVTQKLLETGLLERKYAEGGAW
FT                   RLFYSIFYEFGVVVALMIFTGKYSDFFIRESLLTMFRLFYIFTTVFLPFGTFLGWLRLK
FT                   VHGIELDDQ"
FT   gene            complement(471662..472036)
FT                   /locus_tag="PYCH_05640"
FT   CDS             complement(471662..472036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05640"
FT                   /product="Kef-type K+ transport system membrane component,
FT                   session2"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05640"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24252"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHW5"
FT                   /protein_id="AEH24252.1"
FT                   /translation="MFAKPGTSFIPLVKMLGVLFIIGAFALFLVVTLQERDKKTPEKVF
FT                   YSWRDFLKELSAFLLVFTIAYSSGVSLEKSLSMALYVPVIAGWYCSMMAHRYVISDRIL
FT                   KIRAVVNFVAITFGALPLRD"
FT   gene            complement(472157..472528)
FT                   /locus_tag="PYCH_05650"
FT   CDS             complement(472157..472528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05650"
FT                   /product="nucleic acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05650"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24253"
FT                   /db_xref="GOA:F8AHW6"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHW6"
FT                   /protein_id="AEH24253.1"
FT                   /translation="MAELLDTSVVIELFKGNQKVLVQLSEDAEYALPSIVLFELLCGNL
FT                   KPRQRLALEKMPVLDFDRTSAEIAGEIFRDLMSKGLRPPTKDLLIASTAIAHNATLYTC
FT                   DADFERFKEYGLRVKVLER"
FT   gene            complement(472498..472728)
FT                   /locus_tag="PYCH_05660"
FT   CDS             complement(472498..472728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05660"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24254"
FT                   /db_xref="InterPro:IPR003847"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHW7"
FT                   /protein_id="AEH24254.1"
FT                   /translation="MGKTITIADDVYYELVRMKGNKSFSELLRELIGKKKKGNLGVLMI
FT                   AFGTMTEEEAKEFEKEMKEVEEWLNSWTPAW"
FT   gene            complement(472907..473206)
FT                   /locus_tag="PYCH_05670"
FT   CDS             complement(472907..473206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05670"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24255"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHW8"
FT                   /protein_id="AEH24255.1"
FT                   /translation="MRGVLNGVAIFARIFAFFVLLVSMVIWILGLPFALYELFKGKEPD
FT                   RDFLIELTVRQNLFYTAVLVAVRLIALHSSYPAGDDPIGSSWPSGGKRNWWSHC"
FT   gene            complement(473371..473514)
FT                   /locus_tag="PYCH_05680"
FT   CDS             complement(473371..473514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05680"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24256"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIT2"
FT                   /protein_id="AEH24256.1"
FT                   /translation="MNLNTSSRKRKSRVGLIKLLRQSGAFFYFNPLAEYVPEVSLRVAG
FT                   EP"
FT   gene            473513..474703
FT                   /locus_tag="PYCH_05690"
FT   CDS             473513..474703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05690"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24257"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHW9"
FT                   /protein_id="AEH24257.1"
FT                   /translation="MDLDSVGLLAVLRLSCFGGCNLNSLWSSDLILIAVVLLILIIENF
FT                   LRLGFVILMNNIGGELMGWKRFVALALVVLFLGMTVSGASATASFVNATVNSTATLPGD
FT                   LSPGKPGDEVQPENVGAEIVVEKFFGTFVPGIGWVVFISGVVLAISKYLYSKPVSEFTE
FT                   AFYKELPDRISYNGQELAKGIENKNRWGTKVEIGYGYVKKKWFGLKKETVIVKSVITIT
FT                   RDEVKAVEDLFSPKEYGKLLARAYLKGWDANDAKNVVEEFYDAYKDVFVKNRVTFRGAP
FT                   CGNFPPGKVVLTKKRVAHIVGRHVFGIYEYAGQSDPTIFPKYLTIREIVILIKKAIETG
FT                   SVTCDPKDPNTVIIRKTFPELRTNPHTSKTLRVILRYNRSKGWYEIITAYLEWLRR"
FT   gene            474709..475737
FT                   /locus_tag="PYCH_05700"
FT   CDS             474709..475737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05700"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24258"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHX0"
FT                   /protein_id="AEH24258.1"
FT                   /translation="MSFSFVFFGFEEALRGEVPEDTLTIAIKHGDEIIPLGDCFTKDAV
FT                   GDVIEAIAFAINSCEGVKELYLRSGRCGVLLFPGRYCRDNSITLRLGTYEPMSHIRFKI
FT                   RGDLLQLKIHRENRKDLETVEVPREEFVSSSLAFVRSFLAKFPDEGLMRKVEIVEEMAR
FT                   RKGLLPAEGKFEIKVEWLGEVKCGKEKFPLVYAVVSHGREIFSGLVEPVAFAGDLINLL
FT                   KFSRGMEIRCEIDMTPHTDVLEKALSLVESDNPGNYLLLWFGGEWPGTVFVFNVDDELV
FT                   FVNTKTGSVIRVKKEEAEAVAVNVVREIIRELRKWNEEFIGPIRKKDAVSMLIGELEGA
FT                   LQ"
FT   gene            476311..476643
FT                   /locus_tag="PYCH_05710"
FT   CDS             476311..476643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05710"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24259"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIT3"
FT                   /protein_id="AEH24259.1"
FT                   /translation="MNRKYKNFRAHFRERYNCGGYFPGGEVIIDKEGAKHIIVRHILTN
FT                   VYKFKDKFKYISAQDIIREIKETIRNPDYMDCGKKPNRIVLVRYSPKLGTKMAIVLEKW
FT                   GKGGIG"
FT   gene            476684..477475
FT                   /locus_tag="PYCH_05720"
FT   CDS             476684..477475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05720"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24260"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHX1"
FT                   /protein_id="AEH24260.1"
FT                   /translation="MAHLSFYFTAEEEGFPVLITADEPIFLTDEPVPVQEFMEVLKMLA
FT                   ELKAPGNFFRLKIVGNGGHVTIKLPDDRDFQVPIREFTKNIQRTIENISSIMQKKPVKV
FT                   EHLRFRLLRPGEFWNESDESYLNEYDVEIYGDIYILNATINLKNYIDDLKKLKEFIEKE
FT                   KLPKEEWRVVWDTAQLKPGLEKALSILVRLASPTRPPFVRFTLGTYDPLEIIYVSSIGG
FT                   MVVLFFVAWAKITVKVSKGVLLKALDEAIINAERELERLKA"
FT   gene            477516..477782
FT                   /locus_tag="PYCH_05730"
FT   CDS             477516..477782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05730"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24261"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHX2"
FT                   /protein_id="AEH24261.1"
FT                   /translation="MKPVITITRDEENEFRNFIGGPGVKTPAGDGRMVSEDILKPVESL
FT                   PSWVGIRPKVKLYVDMDFGAFDPTLHAVLLRSGNFLIWIFDMS"
FT   gene            477908..478168
FT                   /locus_tag="PYCH_05740"
FT   CDS             477908..478168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05740"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24262"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHX3"
FT                   /protein_id="AEH24262.1"
FT                   /translation="MSFSFVFFGFEEALRGEVPEDTLTIAIKHGEKTTLLGDCFTKDPV
FT                   GDVIEAIAFAINSCEGINFLRKIEPTVGLFDYFWETFQVIL"
FT   gene            478227..478343
FT                   /locus_tag="PYCH_05750"
FT   CDS             478227..478343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05750"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24263"
FT                   /db_xref="UniProtKB/TrEMBL:F8AHX4"
FT                   /protein_id="AEH24263.1"
FT                   /translation="MRRRKAMKRFTALRFFLVWEERVHRANQEPGTRSHGMR"
FT   gene            complement(478564..479382)
FT                   /locus_tag="PYCH_05760"
FT   CDS             complement(478564..479382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05760"
FT                   /product="dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05760"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24264"
FT                   /db_xref="GOA:F8AI37"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI37"
FT                   /protein_id="AEH24264.1"
FT                   /translation="MKFAGVKLDEPRIMGVINVSPESFYKGSVRNNEKALVETAVKMVD
FT                   EGASFIDIGAKSTAPYLETQIPLEEEIRRAKWAIKIVKDVVDVPVSIDTTNAKVAEEAL
FT                   KAGADIINDVTGFKGDPDMAKVASEYSAPVVLCAHGQVRDLLDPVKTVIEFLQESLAIA
FT                   EEHGIKDIAIDPAIGFLRPAYPPWYEWDSKVIANLNLLKLFGRPILIGVSRKSFIGAIT
FT                   RRKDPSERLAGSLSATAIAVLKGANIVRTHDVRETLDAVKVADFVRRFIP"
FT   gene            479394..480407
FT                   /locus_tag="PYCH_05770"
FT   CDS             479394..480407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05770"
FT                   /product="ghmp kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05770"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24265"
FT                   /db_xref="GOA:F8AI38"
FT                   /db_xref="InterPro:IPR004422"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI38"
FT                   /protein_id="AEH24265.1"
FT                   /translation="MEKFEEEIKNFEVVVVIIRTPRRLHLGLIDPTGSLGRRFGSLGVA
FT                   LEGGYELKVLSAERLEIMAEAEDRKTIEKAVERMNSAFGTGTSYKFEVIKSIPRHVGLG
FT                   STTQLSLAVGTAIARLNKISVPIEKLAKVLGRGKNSGVGIYAFSVGGFVVDGGVKDGIP
FT                   PLILREDFPEDWAFLLVIPDVKPGLDEEEEKPIMEKTFGRVDVAMEISYRVILGLLPAL
FT                   KERNIRVFGKHLSAIQRLVGRHFSEFQGGEFRDDVRLILEWLEEKTYGAGQSSWGPTVY
FT                   GLILKSEFQELFDEITDYLREHGIRARVELGLPRNSGAEIVRENAFLERLIKSVAE"
FT   gene            complement(480414..481499)
FT                   /locus_tag="PYCH_05780"
FT   CDS             complement(480414..481499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05780"
FT                   /product="Fe-S protein, radical SAM family"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05780"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24266"
FT                   /db_xref="GOA:F8AI39"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI39"
FT                   /protein_id="AEH24266.1"
FT                   /translation="MPRETTYYSYVVGELPEGCQLCVRGEKLVLFVTGVCPRNCFYCPL
FT                   SPWRRGDVVYANERPVRSVDDIIAEALIQEAGGAGVTGGDPLARLNRTVEYIRALKERF
FT                   GEEFHLHLYTTGALATKKALEKLYDAGLDEIRFHPDIFTPNSKLFEREIENIKNAFDFS
FT                   WDVGGEVPAVPGQGERIKWFAEFLDRLGAKFLNVNELEFSETNMRNLLDRGYKPINDES
FT                   SAIKGSLELGLEILRWGEENTSLSYHLCTAKLKDAVQLRNRLRRMAKNVAKPYMEITED
FT                   GTLRFGIAEYGNLDELYALLVKDAEVPAEWLYINREKGRIEMPVEVAIELAEAIEGDVR
FT                   FFIVEEYPTWDRLEVERIPLP"
FT   gene            481559..481852
FT                   /locus_tag="PYCH_05790"
FT   CDS             481559..481852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05790"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24267"
FT                   /db_xref="InterPro:IPR014418"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI40"
FT                   /protein_id="AEH24267.1"
FT                   /translation="MVENVRGELIRVLSAVEEKANELKMDGFEPDVVLFGREAYNFLSS
FT                   LVKSELGGEELPTELSGLKIVILDELRGYAVVIDSKALGFALGAARRIRIVG"
FT   gene            complement(481855..481942)
FT                   /locus_tag="PYCH_t65"
FT   tRNA            complement(481855..481942)
FT                   /locus_tag="PYCH_t65"
FT                   /product="tRNA-Leu"
FT   gene            complement(481976..482140)
FT                   /locus_tag="PYCH_05800"
FT   CDS             complement(481976..482140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05800"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24268"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI41"
FT                   /protein_id="AEH24268.1"
FT                   /translation="MENLLPKVWVSLKITFIGRVVRVMVGEVVGPMQPEASRSRRRAII
FT                   SLPLMGTTH"
FT   gene            481992..482744
FT                   /locus_tag="PYCH_05810"
FT   CDS             481992..482744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05810"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24269"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI42"
FT                   /protein_id="AEH24269.1"
FT                   /translation="MRGRLMIALLLLLLASGCIGPTTSPTITRTTRPMKVIFNETHTFG
FT                   SRFSIRVNLTEEAVVSVKLEMPEGAVLKYLGVIRAEDARTWILNDEGVQYVARKNSVTA
FT                   GTYNFTLGSGKYYIVFGPPEAPLEDVVLGEGTVELLPSNRTVITFNASQYILLKNLQLK
FT                   LIIQGNVSFQLLDSYQHGKWERGQHFVPVTEKKNAESGIYRISRDLPGTVYYLIINNDS
FT                   SEEKAVVEYELRASAVRPFKGRIVVSLG"
FT   gene            complement(482776..483723)
FT                   /locus_tag="PYCH_05820"
FT   CDS             complement(482776..483723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05820"
FT                   /product="ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05820"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24270"
FT                   /db_xref="GOA:F8AI43"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI43"
FT                   /protein_id="AEH24270.1"
FT                   /translation="MVVSLAGRDLLCLQDYTAEEIWTILETAKMMKIWQKIGKPHRLLE
FT                   GKTLAMIFQKPSTRTRVSFEVAMAHLGGHALYLNAQDLQLRRGETIADTARVLSRYVDA
FT                   IMARVYDHKDVEDLAKYASVPVINGLSDFSHPCQALADYMTIWEKKGHIAGLKVVYVGD
FT                   GNNVAHSLMIAGTKLGAHVVVATPEGFEPDEKVIKWAEANAAESGGSFELLHDPIKAVK
FT                   DADVIYTDVWASMGQEAEAEERRRIFRPFQVNKDLVKHAKPDFLFMHCLPAHRGEEVTD
FT                   DVIDGPNSVVWDEAENRLHAQKAVLALLMGGIKG"
FT   gene            complement(483838..485040)
FT                   /locus_tag="PYCH_05830"
FT   CDS             complement(483838..485040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05830"
FT                   /product="methylmalonyl-CoA decarboxylase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05830"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24271"
FT                   /db_xref="GOA:F8AI44"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI44"
FT                   /protein_id="AEH24271.1"
FT                   /translation="MGIEQAIIDFFEHMGLVNLTIGNIIMILVGLTLVYLAIRYKMEPL
FT                   LLLPIGISAVLVNLPLSHLANWPLAPQLPPEVQDNIFATLSYLNQQYGPPGIFDLIYYL
FT                   LIRTEVVPLLIFFGLGAMTDFGPMIADPKTALLGAAAQIGVFVAMLAALVLGFDLTEAA
FT                   SIGIIGGADGPTTIYLTTKLAPHILSATAVAAYSYMSLVPLIQPPVIKALTTPEERRIR
FT                   MEQLRPVSKREKIIFPIASMIIIGLLVPSAAPLIGMLMIGNLFRESGVVERLSKAAQEE
FT                   LMNIVTIFLGLGIGSTMRAESFLTAKTLIILGLGIVAFASATAGGVLFGKLMMKLSGGR
FT                   INPMIGAAGVSAVPMSARVVQRLASEEDPGNFILMHAMGPNVAGVIGTAVVAGVFLSAL
FT                   G"
FT   gene            complement(485046..485474)
FT                   /locus_tag="PYCH_05840"
FT   CDS             complement(485046..485474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05840"
FT                   /product="glutaconyl-CoA decarboxylase subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05840"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24272"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI45"
FT                   /protein_id="AEH24272.1"
FT                   /translation="MKVRIVINGEEFEVEVEELMPGKFRVTLEGETYEVEARGIQRAAP
FT                   VVTPTPAPAPTPAPAPAPVPAQPQPVSDNIVTAPMPGKVLRILVSEGQEVKIGQGLLIL
FT                   EAMKMENEIPAPRDGVVKKILVKEGDTVDTGQALIELG"
FT   gene            complement(485477..485830)
FT                   /locus_tag="PYCH_05850"
FT   CDS             complement(485477..485830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05850"
FT                   /product="Methylmalonyl-CoA decarboxylase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05850"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24273"
FT                   /db_xref="GOA:F8AI46"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="InterPro:IPR014497"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI46"
FT                   /protein_id="AEH24273.1"
FT                   /translation="MVIGGLMEGLSITVLGVTVVFGVLGILAVTMYAIGWLERRLVEKE
FT                   DGGEEPVQESPPKKGLDEKKIAVITAAIMAYLDQKRPKELPIKRKPSEAWWLSGVTSHV
FT                   GEVENFNYKLGKW"
FT   gene            complement(485840..487402)
FT                   /locus_tag="PYCH_05860"
FT   CDS             complement(485840..487402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05860"
FT                   /product="methylmalonyl-coadecarboxylase, subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05860"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24274"
FT                   /db_xref="GOA:F8AI47"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR005783"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI47"
FT                   /protein_id="AEH24274.1"
FT                   /translation="MEEKVKELYERKKKIMEMGGEEAIKKQHEKGKLTARERIELLLDP
FT                   GSFVEIGMFVKHRATEFGMDKRELPADGVITGYGTIDGRLVFVYSQDFTVMGGSLGEMH
FT                   AMKIKRIMELALEAGAPVIGLNDSGGARIQEGVDSLKGYGEIFKMNTILSGVVPQITAI
FT                   MGPCAGGAVYSPAIGDFILMVDNPSTFMFITGPQVVKAVTGVDVTPVQLGGAMVHAQRS
FT                   GQAHLVGKNDEEVLALIRRLLSYLPSNNMEKPPRVKTSDSPFRRTENLYNIVPDDPNKG
FT                   YDVRQVIYEIVDRDEDGNPDFLELQPYFAPNAVIGFGRMNGQTVGIVANNPIHLAGVLD
FT                   IDSSDKIARFVRFCDAFNIPIVTLVDVPGYLPGVDQESRGIIRHGAKVLYAYAEATVPM
FT                   VTVILRKAYGGAYLAMGSKHLGADFVFAWPTAEIAVMGPEGAANIIFRKEIAKAENPEE
FT                   FRKQKIKEYREKFANPYVAAARGYIDDVIDPAETRAKIILALEALEGKRVKLPPKKHGN
FT                   IPL"
FT   gene            complement(487558..487980)
FT                   /locus_tag="PYCH_05870"
FT   CDS             complement(487558..487980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05870"
FT                   /product="translation initiation factor IF-2 subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05870"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24275"
FT                   /db_xref="GOA:F8AI48"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR004458"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI48"
FT                   /protein_id="AEH24275.1"
FT                   /translation="MEIDYYDYEKLLEKAYEELPENVKHHKSRFEVPGALVTIEGNKTI
FT                   IENFKDIAEALNRDPQHVLKFLLREIATAGTLEGRRVILQGRFTPYLIANKLKKYIKEY
FT                   VICQVCGSPDTKILKRDRFYFLKCEACGAETPIQHL"
FT   gene            complement(488031..491855)
FT                   /locus_tag="PYCH_05880"
FT   CDS             complement(488031..491855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05880"
FT                   /product="MCM2/3/5 family DNA replication licensing factor"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05880"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24276"
FT                   /db_xref="GOA:F8AI49"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR028992"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI49"
FT                   /protein_id="AEH24276.1"
FT                   /translation="MDRDEMINRFVSFLREYADESGEPVYKERINDILTVTPKRSISID
FT                   WTHLNSFDPELAEELLNNPEESIAAAEDAIQIVLKEDFFKEEPPKVHARFFNLPETLLV
FT                   KEIGAEHINRFIQVEGIITRVSEIKPFVRTAVFVCRDCYNEMIRVQRPYGGMTKVTRCE
FT                   QCGSKNIELDVNKSSFINFQTFRLQDRPESLKGGQMPRFIDAVLLDDLVDTALPGDRVL
FT                   VTGILRVVQEKGDKTPIFRKIIEVNHIEPLSKEMEELEITPEEEQKIRELAKRKDIVDA
FT                   IVDSIAPAIYGYREVKKGIALALFGGVPRTLPDGTRLRGDIHVLLVGDPGVAKCVDYHT
FT                   KVLLADGSLKEIGEIVEKAIEKAKVEGTLETVDDGFYAPIDLELYALDAKTLKVRKVKA
FT                   NIAWKRTAPKKMFRIKTANGREIRVTPTHPFFTFEDGHFRTKKAEELRVGDFIAVPRRE
FT                   NEPRIVPETEDESLRKLLEESDIFWDRVVEIEEYKPEHGWVYDLQVPEHHNFIANDIFV
FT                   HNSQLLRYVANLAPRAIYTSGKSSSAAGLTAAAVRDEFTGGWVLEAGALVLADGGFAMI
FT                   DEIDKMSDRDRSVIHEALEQQSYHRNFELLLADGRKVKIGEFVDEIIERNRDRVIIGKD
FT                   TEILPVEDVYILAYDPKRGQIVRVRADRVSRHKPPEKFIQIKLENGREILVTPEHPVLV
FT                   WENGVKEVPAEDLRPGDFAIGVREYPPLGEEEGDIEAVLRNLFKEGSNRFKKGARIPPE
FT                   VFRFRRELLEELVRRIWTIRGRGLNGKPVIRFPSRELAEDFQDLLLFLGVCSTLREGVG
FT                   SFSLIVQERECIKRLEEITGKRFGEGREEKVPGDFGRAILEAADLLGLRIPAGSRSRLR
FT                   RKVVSRNIVLKYSQQVQETIERLKRAIENDDMERVVEILPKWRLYYEHGISPFSLRRRL
FT                   SDEKIRKIVKEEATKRLEKAEKLIEFVERNLERIRFVRIVAVNEVPNKDSEWVYDVTVE
FT                   PHHLFVSHGLVLHNTISISKAGITATLNARATVIAAANPKHGRFNRMKPISEQLDLPPT
FT                   LLSRFDLIFVLIDEPDEEIDSAIATHILRVRRGESEVVTPKIPHDLLRKYIAYARKNVH
FT                   PVISEEAIEEIRKYYVKMRRSAKRLTEKDEEGIRPIPITPRQLEALIRLSEAHAKMRLS
FT                   PIVTREDAREAIKLIEFTLGQIARDEEGQIDVTILEVGQSAKKLSKVEKILAIIEKLEK
FT                   VNEKGAYIEDILEEASRAGIERKEARDIIEKLLRGGQIYMPETGYYKTL"
FT   gene            complement(491862..492359)
FT                   /locus_tag="PYCH_05890"
FT   CDS             complement(491862..492359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05890"
FT                   /product="Gins 23 protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05890"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24277"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI50"
FT                   /protein_id="AEH24277.1"
FT                   /translation="MMLTGKALIPVKVIRSFGSWKEGDMILLEDWKARELWESGVVEVL
FT                   DEVEKVIGEIDKVISEERKSEPLTPIPEGLYERAEFYIYYLERYIRERAGESVEVINTK
FT                   MAKLTNLKKKYNHLKELRFKKILEAVRLRPGSMEILTRLSPEERRIYLQMSRIRNEWLG
FT                   ER"
FT   gene            complement(492424..492936)
FT                   /locus_tag="PYCH_05900"
FT   CDS             complement(492424..492936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05900"
FT                   /product="Metallophosphoesterase, calcineurin superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05900"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24278"
FT                   /db_xref="GOA:F8AI51"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI51"
FT                   /protein_id="AEH24278.1"
FT                   /translation="MKVGIMSDTHDNLGAIRRAVDFFNREGVDLVLHAGDYVAPFVARE
FT                   LSRLKAPLKGVFGNNDGEREGLKRTLGIKDEILVLDIGGMKTVVIHGTDERLIEALAKS
FT                   QLYDIVIRGHTHRQGIEEVGRTIIVNPGEVCGYLTGIKSVAILDIREREVRIVNLETGD
FT                   IIGLMSL"
FT   gene            complement(492933..493967)
FT                   /locus_tag="PYCH_05910"
FT   CDS             complement(492933..493967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05910"
FT                   /product="RNA 3'-terminal-phosphate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05910"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24279"
FT                   /db_xref="GOA:F8AI52"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013791"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR017770"
FT                   /db_xref="InterPro:IPR020719"
FT                   /db_xref="InterPro:IPR023797"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI52"
FT                   /protein_id="AEH24279.1"
FT                   /translation="MITIDGSYGEGGGQILRTAVALSAITGTPVRIINIRANRLNPGLR
FT                   PQHLHAILALKELSGARVKGASVGSRELEFHPGKLKGGKVRVPIKTAGSITLVLQALLP
FT                   AAAFAEREVEFEITGGTDVPWSPPVDYLKNVTLFALDRMGLRAKLEIRRRGHYPKGGGL
FT                   VVGQVEPWMEKKPLRVEKLGKVIGFEGISHATNLPAHVAERQARAARERLREFYDAPVE
FT                   IATEVSRSLGPGSGIVVWAETDCLRLGGDALGERGKPAEKVGREAAEELLSQLEKGACV
FT                   DKFLGDQLIPFLAFTGGEIEVAEVTRHLVTNVWVVEKFFGKVFEVEGEIGKPGKVKVVR
FT                   RVEI"
FT   gene            complement(493967..495121)
FT                   /locus_tag="PYCH_05920"
FT   CDS             complement(493967..495121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05920"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24280"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI53"
FT                   /protein_id="AEH24280.1"
FT                   /translation="MENITTPKERRDSLVLAGMTRDGKIEFVKVYALTKELALTVLDDF
FT                   FSENELHPSDFVLIHEGYEDVSGKEVISTRTEEELSAMLARLGLKLVSNGLLYLDDVDR
FT                   LYQITAVSRRFLERMRKLREGTEVEEVVTLNFDHIELPEKYARRLQLLALREDAMVLNA
FT                   VELDLPSLLRKVVEGRVLIPRFVEKDEVIIRVFDEEIHEVLGSHFDKVVVKPPIVHWDA
FT                   HVDDVDDFSFKKIEEKIYSAPLFLKASGGFLILTEPPRELVRMLLKIKRRGEIKVRLNN
FT                   VLMRIPLDFTLVIDTKEPGRYSGLKFPVRINLPPLDEETFSKLLSERLGITVSGDAMKV
FT                   FPEEFRTFLGVEIIENLWKKLVGRGRKADLELLKEVANIVTGGV"
FT   gene            495220..496281
FT                   /locus_tag="PYCH_05930"
FT   CDS             495220..496281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05930"
FT                   /product="endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05930"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24281"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI54"
FT                   /protein_id="AEH24281.1"
FT                   /translation="MEAVIMVDYELLKKVVEAPGVSGYEFLGIRDVVIEAFEPYVDEIR
FT                   VDKLGNVIAHKKGSGPKVMLAAHMDQIGLMVTHIEKNGFLRVAPIGGIDPRTLIAQRFK
FT                   VWVDKDKFIYGVGGSVPPHIQKPEDRKKAPDWDQIFIDIGAESKEEAEEMGVRIGTIIT
FT                   WDGRLERLGKHRFVSIAFDDRIAVYTLIKTAQELGETDADIYFVATVQEEVGLRGAKVS
FT                   AFGIEPDYGFAIDVTIAADVPGTPEHKQVTQLGKGTAIKIMDRSVICHPTIVKWMEELA
FT                   KKYEIPYQWDILLGGGTDAGAIHLTKAGIPTGAISVPARYIHSNAEVVDERDVDASVKL
FT                   MVKVLEHIHELQL"
FT   gene            496322..496409
FT                   /locus_tag="PYCH_t70"
FT   tRNA            496322..496409
FT                   /locus_tag="PYCH_t70"
FT                   /product="tRNA-Leu"
FT   gene            496426..496758
FT                   /locus_tag="PYCH_05940"
FT   CDS             496426..496758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05940"
FT                   /product="nascent polypeptide-associated complex protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05940"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24282"
FT                   /db_xref="GOA:F8AI55"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR005231"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI55"
FT                   /protein_id="AEH24282.1"
FT                   /translation="MLPMNPKQLRKLMKQINMEELEGVSEVIIRMGDREIIIKNPTVTV
FT                   IKAMGEKSYQILGGVEEVRELLKIPEEDIRLVMEQAGVDYETAKRALEETKGDIAEAII
FT                   RLTEGQ"
FT   gene            complement(496742..498103)
FT                   /locus_tag="PYCH_05950"
FT   CDS             complement(496742..498103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05950"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24283"
FT                   /db_xref="GOA:F8AI56"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI56"
FT                   /protein_id="AEH24283.1"
FT                   /translation="MKYAEILEEYIKGWRLRKAVELVESNREALLDLEKLLHHKDPLLK
FT                   KGALYIIKKLASRGKLSLEDVKFFLPSLIDLLDDKEESVVLQTVETINAIITFVELDEK
FT                   TSEELSSLLMKTVENKPVPINEYAAEGLAAIGAKILTVARKIFSWIRAIIRGSSEDKKV
FT                   AVLRVLREMVARTKNPQIMEEAFNLALDLLNNEDPIVRRAALRIVEVAVDRNELLSRAS
FT                   LERASKELSSSSLGKKAMEAKERIDEYLRGETKPASVEELPEYSVGMIKKMFEREQHPA
FT                   VLELARRDYGVLKLVIKIFLSEDLLTKLDALWVLSNAAGYIKRDDAEKLIPQLRELLLH
FT                   DNPWIKSTSAKLFGELAVNYSSLMDEAIRTILEYLESKDPKKVGAALELAEAILSRVEN
FT                   LGLIEEIVRRLVEMDRLTPEALEFIKKHEREIEDLEPELKKRLTMKLASFIAPP"
FT   gene            complement(498081..499571)
FT                   /locus_tag="PYCH_05960"
FT   CDS             complement(498081..499571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05960"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24284"
FT                   /db_xref="GOA:F8AI57"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI57"
FT                   /protein_id="AEH24284.1"
FT                   /translation="MLAAEGEFFLVNFNQLRNDIKNWRLREAVETLERISNPEKLLKKL
FT                   LHDKDTAVKGNTIYLIEKLVKENKIKQETVEALLDDLMALTEDDNEKLTLDTVRLFNVI
FT                   LEKFELEEKDYDRIMEVLMNVVSSGRGIASEYAAEGLGILGAALTRVAKKIIKLLVSLI
FT                   KGSKDREVQSAAMTALTEIASRTKDKEVLNEAVSEIASLLDSEDVYLKERAISSLERIV
FT                   TVQRSRISSGILNTLKEKVRSIAGGNTPGSKVNALMKVISKEEAEDTLPDEFGIEDIEN
FT                   LFDKDKHEIVAEMAKKSDVILDRIIELLSSEDYIRRTDALWVISRVIGFLGPTRAYSIL
FT                   PILGDFLRSNNPWIRTTAAKTLAEIYSLYPGTKEYIISLLDLMLKSSDRKTIEAALELI
FT                   KEITSRSSTKELFRAAMILTIKRLNDPNIRLPILKFYALSAEELLSLDREILEALLHKL
FT                   SEVYGKAGNEEKELIIYILDLINTLLEEDDKGEVRRDS"
FT   gene            complement(499616..500170)
FT                   /locus_tag="PYCH_05970"
FT   CDS             complement(499616..500170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05970"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05970"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24285"
FT                   /db_xref="GOA:F8AI58"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI58"
FT                   /protein_id="AEH24285.1"
FT                   /translation="MSRERLIDLIFEEGCIQFGHFILTSGKESNYYIDVKKLITNPEAL
FT                   GLIAELIIQKAKELGLDFNKVAGPELGAVPIATAVALKSGKPLLIVRKKKKEHGTGKQI
FT                   EGEVKPGDKVLLVEDVTTTGGSVLRAAEVLREAGAKIVGVFVVVDREEGARENLEAKGL
FT                   QLHPLILVSELFERRSKKSEP"
FT   gene            500324..500617
FT                   /locus_tag="PYCH_05980"
FT   CDS             500324..500617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05980"
FT                   /product="50S ribosomal protein L21e"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05980"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24286"
FT                   /db_xref="GOA:F8AI59"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="InterPro:IPR022856"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI59"
FT                   /protein_id="AEH24286.1"
FT                   /translation="MVQKAHSFRRKTRKKLRKHPRRRGLPPLTRFLQEFEVGQRVHIVI
FT                   EPSYHKGMPDPRFHGRTGVVVGKRGDAYIVEVTDGGKVKTLFIHPVHLRPQK"
FT   gene            500624..500986
FT                   /locus_tag="PYCH_05990"
FT   CDS             500624..500986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_05990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_05990"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24287"
FT                   /db_xref="GOA:F8AI60"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR005574"
FT                   /db_xref="InterPro:IPR010924"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI60"
FT                   /protein_id="AEH24287.1"
FT                   /translation="MIGRKRLAERYITIAEAKELLLKRQEEDLKKGLEEPMFYEARLAL
FT                   EHAERFAKVPAEKAKEIRERLMSEFEWMDERLASKIIDIMPEDNFDVRVIFAKEEYQPT
FT                   PEEAKRIVEILDEYRE"
FT   gene            501095..501334
FT                   /locus_tag="PYCH_06000"
FT   CDS             501095..501334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06000"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24288"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI61"
FT                   /protein_id="AEH24288.1"
FT                   /translation="MKIVEIDVRLPCNKRGALLKMLSSKLRGKIKEAHLYPPDSRGFSE
FT                   VLIEVETDEDPSSIMSELRRILHGVPFKIKVMQA"
FT   gene            complement(501343..501957)
FT                   /locus_tag="PYCH_06010"
FT   CDS             complement(501343..501957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06010"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24289"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI62"
FT                   /protein_id="AEH24289.1"
FT                   /translation="MKFRGSTFGNSVRIEFEILRLGELKIDDLSDFDTDEIKLEIRSST
FT                   SGLKLIGIWEGDIERVGEGIKKALEESAKLREKLLRRMKNKVERIRKALTEMGFREESM
FT                   SYGDVVRFTKKVGDYEIAILVSSRDDVVRVEVYGNNRKLLTPELETLFEDVNVEELELY
FT                   DIEEEGKEERVIINLELPKTDEKPEKRIAEAIEILENILMT"
FT   gene            502024..502794
FT                   /locus_tag="PYCH_06020"
FT   CDS             502024..502794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06020"
FT                   /product="geranylgeranylglyceryl phosphate synthase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06020"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24290"
FT                   /db_xref="GOA:F8AI63"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR010946"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI63"
FT                   /protein_id="AEH24290.1"
FT                   /translation="MKMRIGKVERLILNKLENSKLHFVLIDPDDVPPKTAGRLAALCEE
FT                   TGVDAIMVGGSTGAEGEVLDSVVKAIKEASGLPVILFPGSHGGISKYADAIFFMSLLNS
FT                   RNPFFITGAQALGAFTVKRYGLEPIPMAYIVVEPGETVGWVGDAKPIPRHKPKLAAAYA
FT                   LAGQYLGMRLVYLEAGSGAPEPVPPKMVKVVKAAIDVPLIVGGGIRRGEQARKLIEAGA
FT                   DIIVTGTAIEKSSSLDEARKKLEEINRAIKSVCP"
FT   gene            complement(502775..503986)
FT                   /locus_tag="PYCH_06030"
FT   CDS             complement(502775..503986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06030"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24291"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI64"
FT                   /protein_id="AEH24291.1"
FT                   /translation="MEGEFIKSGVERLDQILGGGFRKGYNVAVVGGLDGDNVLFLHNLV
FT                   YSLLSQDYRILLVEFRQEPSHLFSWLKSFGIDYEKAVEEGKLKIIDGFSNLYFPTPISK
FT                   EENVLPNPLDLSITTALIRDSIVRDSYNFLVLDDLSILYTLQADPKVYVRVMVRLVNSI
FT                   KKFGAQTIASLNSDVFSSKDLATLLVPFEYVIDVREGTAKVARSPYPLSSPQNCFPYTK
FT                   AKNGIVPLSEAYENLEVLKNSLKLDDEGNLWLGTERVQIVVEESEASLVEFVYNYLGPE
FT                   EGERFLYLWGKWEFKGYGSLIRKKHENLEDALMGLLSTTKVLGGGHLEFVQMTDELIVL
FT                   RGKNLFPRIERFPYHAHVNYAGAIAQFVEDFTGEKWEGKEVRCQGQGASHCEFVIKKVK
FT                   DKRI"
FT   gene            complement(504032..504634)
FT                   /locus_tag="PYCH_06040"
FT   CDS             complement(504032..504634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06040"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24292"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI65"
FT                   /protein_id="AEH24292.1"
FT                   /translation="MGLAGTVKGIREVEERALKEYIDLLKELKDPEDAELKRVVLRLAV
FT                   DKIFHRELALAIERAYREATKLLKEHLEPFYPELEPIRESVLELDNGVALVPGLPALLL
FT                   PPDLEKLGVRIPPEEVLEELVKGFPEPSLLPVDKAKEIREKLARVVEMEERMKKCYGEL
FT                   QKKAQHPVIKDIAKSVMHNEDQHGAILKKVLQKFANI"
FT   gene            504731..506536
FT                   /locus_tag="PYCH_06050"
FT   CDS             504731..506536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06050"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06050"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24293"
FT                   /db_xref="GOA:F8AI66"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI66"
FT                   /protein_id="AEH24293.1"
FT                   /translation="MKVVVPDTSVIVDGRLIQYLRELGEKVKVVIPEAVIAEIEHQANA
FT                   GRAIGHVGLEELKKLRAMADEGKILLEFYGERPDFWQIKRAKAGEIDHMVREVARELNA
FT                   TLITGDQVQRDIAIAKGIDVIYLESRKEPRMRLEDFFDEETMSVHLKAGIKPLAKKGRP
FT                   GEWKLVPVRDEPLTEEELEEIADDIIERARRDRESFIELDEQGATVVQLRNYRIVIAKP
FT                   PFADRIEITAVRPVKKLSIEDYNLSEKLMERLRERAEGILVAGPPGAGKTTFVQALAEW
FT                   YASMGKIVKTMEKPRDLQVSEEITQYTALGGSMEKTGDILLLVRPDYTIFDEMRKTSDF
FT                   LIYADLRLAGVGMVGVVHATKPIDAIQRFIGRIELGMIPQIVDTVIFIKAGRVAKVLTL
FT                   EYKVKVPSGMKEEDLARPVIEVRDFETGELEYEIYTFGEEVSVVPVKKEEKAPALRLAE
FT                   KKLKQEIKKFLPDVYADVEIISPHKAVIYADEFDIPAIIGKKGKRITELEKRLGISIEV
FT                   KSFAEKAPEPREKIPVDIEEKKKSIVLRVSPDYAKRPLRFYGGGEYIFTATPSKKGIVK
FT                   VAKNTPIGRELKRLIDEGVDIWASP"
FT   gene            complement(506533..506946)
FT                   /locus_tag="PYCH_06060"
FT   CDS             complement(506533..506946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06060"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24294"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR002837"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI67"
FT                   /protein_id="AEH24294.1"
FT                   /translation="MKGGYFLILFLPEDFHVKTKGRNFFLRAGYYVYVGSAMNSLEGRI
FT                   ARHFRKEKRPHWHIDYLLMQAELLRAYLVPSEKRIEEELSRGVAEFGEPVPGFGASDVS
FT                   VGTNLYRFDEPPDEKIKEILRRLGLKWMVVEKI"
FT   gene            complement(506943..507419)
FT                   /locus_tag="PYCH_06070"
FT   CDS             complement(506943..507419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06070"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24295"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI68"
FT                   /protein_id="AEH24295.1"
FT                   /translation="MKRSLLVLVSLIMAIPLINFGYLAIQYFAVGPVKDCKIELSEVKV
FT                   EEASVDGAILVATVTIDNPTDRSVRIDGFEYTLFANDTPIGTYKISRIILIPAGSSIKL
FT                   KGTFEVRYPTMPTGIIRAIMNGRLEEIEWRIEGEFYVNSTLGTFGVLFNVTTGR"
FT   gene            complement(507409..507867)
FT                   /locus_tag="PYCH_06080"
FT   CDS             complement(507409..507867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06080"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24296"
FT                   /db_xref="InterPro:IPR017140"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI69"
FT                   /protein_id="AEH24296.1"
FT                   /translation="MPKLMTGYVRASGYANKVRRVLFAITRGKVNPEEVVRAAGELNQS
FT                   IFEKFREVGVKKEDVVRISVDFEIQDGKIIWNYDSLQIEVYRKEEEERLAQAMEEIEEM
FT                   EKAFEEAIKELEGLAEKLRRLSEEISEKVERIKQEHTGLKLRVEEDET"
FT   gene            507926..508585
FT                   /locus_tag="PYCH_06090"
FT   CDS             507926..508585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06090"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06090"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24297"
FT                   /db_xref="GOA:F8AI70"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI70"
FT                   /protein_id="AEH24297.1"
FT                   /translation="MNILIFGPPGSGKSTQARKIVEKYGLTYIASGDLIRAEISAGTSL
FT                   GKEMEAYLARGDLIPDTVVNTLVISKLRRVRENFIMDGYPRTPEQVIALENYLYDHGIK
FT                   IDVAIDIFIPKEESIKRISGRRICSQCGAVYHVDFNPPKVPGRCDVCGGKLIQREDDRP
FT                   EIVAKRYDIYTANMTPIIKFYQKQGIYVRIEGCGTIGEVWERIRPLLDYIHNLESR"
FT   gene            508697..510448
FT                   /locus_tag="PYCH_06100"
FT   CDS             508697..510448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06100"
FT                   /product="7-cyano-7-deazaguanine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06100"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24298"
FT                   /db_xref="GOA:F8AI71"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR004804"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029402"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI71"
FT                   /protein_id="AEH24298.1"
FT                   /translation="MFRFEIKARDAAGRIGRLEVNGKRIETPAIMPVVNPKQLIVTPRE
FT                   LEEMGFGIIITNSYIIYKTPELRERALKEGIHRLLDYNGIIEVDSGSFQLMRYGGVEVT
FT                   NREIIEFQHKIGVDIGTFLDIPTPPDVPREKAEEDLKITLERAREAEEMKEIPMNATVQ
FT                   GSTYLNLRTLAARRLSEMNFEIHPIGAVVPLMESYRFRELVDVVIAAKLGLRPDRPVHL
FT                   FGAGHPMIFALAVAMGVDLFDSASYALYAKDDRYLTPEGTKHLNELEYFPCSCPVCSRY
FT                   TPQELREMPKEERMRLLAIHNLWMLREELNRVKQAIREGELWKLVDERARAHPKLYAAY
FT                   KRLLDYYKFLEENEPITKKSALFKVSEETLRWPIVRRARERAERVKEIFPETLRHPIFG
FT                   EIPKYLSLSYPFAQSEAEEDFTIERPSRMDAKKYVMAIAEYQFGPGAGEAFKDAFVELS
FT                   KKTGMPRQVKAKGVHLATVRADDGLLTLGIEGARRLHTVLPYPRMRVVVSEEAEPFVRE
FT                   GRDVFAKFVLFADPNIRPYDEVLVVNERDELLATGQALLNGREMVVFTTGRAVRVRRGI
FT                   AQRTQHS"
FT   gene            complement(510427..511254)
FT                   /locus_tag="PYCH_06110"
FT   CDS             complement(510427..511254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06110"
FT                   /product="radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06110"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24299"
FT                   /db_xref="GOA:F8AI72"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI72"
FT                   /protein_id="AEH24299.1"
FT                   /translation="MRKLKVYIPSVKFPPISVTGNYCHLNCAHCDHHYLEGMLKVTRRN
FT                   LVDYCKALEREGYMGCLLSGGLDERLKVPLDRFAEEIKAIKRETSLKLNAHVGFIDEDD
FT                   LEWLRYVDIVSLDFVGNDDVIRRVYKIDKTVKDYLRILELLTENKIKVAPHITIGLDFG
FT                   RIHWEFSAIDTLAQYPIDVLVLNVLIPTKGTEMEGVPKPGVDETIRVVEYAREHFGGEI
FT                   SVGCMRPFGRWREEFDRKAILADIDRLTNPPKNVLGWAKTVREVEILYECCVL"
FT   gene            complement(511251..512402)
FT                   /locus_tag="PYCH_06120"
FT   CDS             complement(511251..512402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06120"
FT                   /product="L-tyrosine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06120"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24300"
FT                   /db_xref="GOA:F8AIT4"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020931"
FT                   /db_xref="InterPro:IPR021115"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIT4"
FT                   /protein_id="AEH24300.1"
FT                   /translation="MRFPERGMDEEEVLEELERLTREDLTFDSGRILGSMCTMPHPLAI
FT                   KVFCRFIDRNLGDPGLHVGSRRIEREAVQMLGDLLHLERAYGHIVSGGTEANILAVRAF
FT                   RNMADVEKPELILPKSAHFSFIKAGEMLGVKLVWAELKSDYTVDVRDVESKIGDNTIGI
FT                   VGIAGTTGLGVVDDIPALSDLARDYGVPLHVDAAFGGFVIPFAKALGYDLPDFDFRLKG
FT                   VQSVTIDPHKMGMAPIPAGGIIFRRKKFIKVISVLAPYLAGGKVWQATITGTRPGASAL
FT                   AVWALIKHLGFEGYKEIVARAMELTRWFAQEIKNTAGAWLVREPMLNIVAFKTKNLPRV
FT                   ERVLKGRGWGVSAHRGYIRIVMMPHVRKDHLEAFLRDLREVLG"
FT   gene            complement(512443..513045)
FT                   /locus_tag="PYCH_06130"
FT   CDS             complement(512443..513045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06130"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06130"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24301"
FT                   /db_xref="GOA:F8AI73"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI73"
FT                   /protein_id="AEH24301.1"
FT                   /translation="MSIKLEIKRKALHLTGLSVPLVYLLLGRHAALFFTAFALVIFLAL
FT                   EPFRVIEDLRERAKRKLGLPNHVVEKLEREIDGIAREHERRGIGAHIYFTSAAFLVVLL
FT                   FPREVALGSITLATLGDAMAAIIGKPFGRHRFRNGKSLEGSLAYFVTGLLILTPLVGIF
FT                   PAVLGSLVGTVAELYELPPDDNFSNQLAVAVALWLVG"
FT   gene            complement(513029..513700)
FT                   /locus_tag="PYCH_06140"
FT   CDS             complement(513029..513700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06140"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06140"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24302"
FT                   /db_xref="GOA:F8AIT5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIT5"
FT                   /protein_id="AEH24302.1"
FT                   /translation="MIVDLDDTLCNTWEAAKKAAIRLLPRIFRLRKFRAFLYVASRRYK
FT                   ELEEMRELHLLGLDEIVQKVMGRIYKGENYSDIAEEFDKAFFSHLHLYPDAEPFLRGLK
FT                   EMGAKIVLVTDSSARWQRRKIEHLGIARYLDGVIISGETGHTKFEPHNFILAKRMFPKE
FT                   RRMFVVGDRDETDMKGGKSIGATTILVRRGYFKGRKARHADFVVKNLSEALEVIEREHK
FT                   A"
FT   gene            513785..514030
FT                   /locus_tag="PYCH_06150"
FT   CDS             513785..514030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06150"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24303"
FT                   /db_xref="InterPro:IPR002849"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI74"
FT                   /protein_id="AEH24303.1"
FT                   /translation="MRGELLTVLGIVLILVGFLLVFIGTMMSALSGESEVEGGGVIMIG
FT                   PIPIIFGTQRGATLAMVLAIVLMVLWFLLALVSRMK"
FT   gene            514080..515255
FT                   /locus_tag="PYCH_06160"
FT   CDS             514080..515255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06160"
FT                   /product="NapA-type sodium/hydrogen antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06160"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24304"
FT                   /db_xref="GOA:F8AI75"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI75"
FT                   /protein_id="AEH24304.1"
FT                   /translation="MNYILGISILLVFAKSLEWLLEKKDIHPILAHITTGIILGPFVLD
FT                   LVSPSEQLKVLSEFGLLMMMLYMGLTSNFSAIAQNTQKALVVASFGVAFSFILGYLTVR
FT                   AFGFPFVAAIFVGVTLGNTAIEVTSGVLVKERVGRLVSSVLMGAAFADDIIAVYLIGVV
FT                   TAMTKGSLDLISIVLLTLKIALFLVATLLISEFVFKRSHWFYAVVRNLNVFFTFTIILT
FT                   FALAVIAEEIGLNQIIGAYLAGLTISRLRERKDPLVVSKIKLNELINDLQVVLTEFFIP
FT                   LFFIYVGLMFNPPLEKVSIPLILALYASAVLGKLIGCSLGMKLFRASWSDAILVGIGMG
FT                   GRGSLELAILKFGLESGIIDQSLFATIIIISMLTALTTPIFFKHAIKKVKK"
FT   gene            515281..516975
FT                   /locus_tag="PYCH_06170"
FT   CDS             515281..516975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06170"
FT                   /product="bipolar DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06170"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24305"
FT                   /db_xref="GOA:F8AI76"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR018538"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI76"
FT                   /protein_id="AEH24305.1"
FT                   /translation="MLMKVFEGDPVGIVRGEASFSSFEFSVSPEAKLSFGEFVVTKNRN
FT                   GEWVIGTVRKIENMNWLLSGGKSNYNSLLLDIHEYGDSIGVNEEIRATVRILGKLSFGS
FT                   SVEVLPNRVPIPNGEFVYLASDEVLEEMYRPTGGSMEVGTLLMRDSVKISLDVDELVSR
FT                   HFAVLAVTGAGKSNAIAVMVAGIVEGLGGTVVVLDPHGDYVRLRLPKTGDELVNVIDAR
FT                   ITPELLDSDELAEILGVRRDAQIQRTFLERAWDTVRQGNQNIGGRELLVKLREKLNEWV
FT                   ENGGGEYWDPFEGRYKKIENLDSNTKNTILKVVMRISRFLRNYGHLLTSEDLLAKIEAG
FT                   KVNVIDLAPLEEEQMKVVVSRFLRRLFEARVDYESALKREESGKVDEELLREKRRIEGM
FT                   YPALTEPVLVIVEEAHIFAPQGEESDVARILGRIAREGRKFGVGLGIVSQRPNRLNEDV
FT                   LSQTNTKIILRIVNPKDQEYVLRASEQLSKDLLDDIAGLGRGEAVIVGQAVKLPALVKI
FT                   YDFKKLGGNYGGGDIGVVERWKKRVAAQKAEKEVERLYGELGVDVDW"
FT   gene            516988..518232
FT                   /locus_tag="PYCH_06180"
FT   CDS             516988..518232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06180"
FT                   /product="DNA repair exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06180"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24306"
FT                   /db_xref="GOA:F8AI77"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI77"
FT                   /protein_id="AEH24306.1"
FT                   /translation="MKFAHIADVHLGFEQYRLPFRAEEFAESFRMAIEIALRERADFIL
FT                   ISGDLFHSSRPSPETIKQAIEILSLPKEKGIPVFAIEGNHDRTQRKVSVYNLLEDLGLL
FT                   NLVGIRDEKVNGEFLRSERIGGKFLIKGIFNDIEIHGLKYMSPAWHERNRIKGIFKPRG
FT                   KAILMLHQGIKEIIERMTFVPERQRNYYEIRLGDLPGGYLYYAMGHIHKNFVTSYDIGK
FT                   VVYPGSLERWDFGDYEVRYAWDGKAFKPIAGTEKGFYIVEDFEPRFIKLDVRPFIDVKI
FT                   KANEAVLRKELKRLAPRIPREAFVRVDVEWERPFDVAFIYETIRARHVQVRTRFGRRQE
FT                   RGPVKPEEYFTEAEKKIIELLGGREIEDIDAVIEILSGIVTERKESVEEEPKVERKFAP
FT                   PKKKGDILAWLGGGG"
FT   gene            518229..520883
FT                   /locus_tag="PYCH_06190"
FT   CDS             518229..520883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06190"
FT                   /product="chromosome segregation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06190"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24307"
FT                   /db_xref="GOA:F8AI78"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013134"
FT                   /db_xref="InterPro:IPR022982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI78"
FT                   /protein_id="AEH24307.1"
FT                   /translation="MRLEKVIIKDFRSHQLTAVDFTPGINLIIGQNGSGKSSILEAILV
FT                   GLYWPSRPSELKKEDILRVGGRGTEITVFFEVGGVKYQVHRKIHGSYAHVKYLDNGTWR
FT                   TIEASGHNAVREWMNRLISYDVFVNAVYIRQGEIEAILRDDVEREKVVRQVLGIEKLEN
FT                   AYSNLRAVLREIRRRITEAEDFLKKTEKVEETIVESERRLIEILSRINELSSKLPELRQ
FT                   ELAVVERELKELDEKEKRINGLKIELERKRGEMRELRAMEGELRKAIEEGKRKIEELKK
FT                   RLKGLEELEERAKEFKELSAFLENYRKRKAEIEREISAFEERLRAVEDRIMELEGKIER
FT                   IAELENKLRELRERLKELEPFKGKLDEREAIRRELENKRRKLRLSRKEIEKLREEIMRA
FT                   KSERETLQKRLQELSKLRGELESRMLDREKAIEELKRARGKCPVCGTELTEEHRQELIE
FT                   KYTLEVSGMEERLREIEEEVGKIRKKLREVERTLAREVELIKQEELLRQVEELEAKLKS
FT                   FSPEIEEKAREFERVRDEIGRIEGEVKGLREEASRLTALKKKRELLKEKLDGRKAWLNE
FT                   LEAELRKKGFGSEDELEKRLRELEPMYKEYLELRALKGQLEREIKDVAEKEVKLRKVRE
FT                   DVERLRGEIDSIEEELRGLEKTYDPVRHEEVRKRKERLAVELGKLENELKILEEERERV
FT                   EKTLEALREQREERKKKMEELKRLKKAELNAEELRKKIKMYKAAIRERALESVAEIASE
FT                   IFEELTEGKYSGVVLKADENKLRLFVVYEGKERPLSFLSGGERIALALAFRLALSMFLA
FT                   GEMSLLILDEPTPFLDEERRRRLISIMEGYLRKIPQVIVVSHDEELKDAADRVIRVRLE
FT                   DGVSRVSVEGVVS"
FT   gene            520880..522205
FT                   /locus_tag="PYCH_06200"
FT   CDS             520880..522205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06200"
FT                   /product="5'-3' nuclease"
FT                   /note="encoded next to Rad50 and Mre11 homologs"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06200"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24308"
FT                   /db_xref="InterPro:IPR016738"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI79"
FT                   /protein_id="AEH24308.1"
FT                   /translation="MRLLPANHVERITTMLKEQLKKVEEKLRDVKWRPLPKSEESRVYA
FT                   VDGSQGKARLSGTIIYMVSSFAFGSGRPYRLFYTNAMLYNYGISDQMIRLQMETLENKL
FT                   GYLAGKLGDVDLVIMDGTLTGSLTRPPVYPESVRGIRTLEMFLGKAELRRLVREFRKEL
FT                   DSHYRNLEDELMERGFSESPILADMLVDRFFERFTRGKIMPERIVIRSRESLPEKITIR
FT                   LTDLERAANEGKTAEDLLREIEEKKGIRVVATREELRDAFHVVLAYVEYLDSLERLLGL
FT                   DLFYVAKSFYTRRLSSKAGVPIVDSAYLDAILRKLRGSEEPGYLKLEERIRVEHEIPDP
FT                   LRDFFERVRRCGEEGVHGAYVRFERGDVIYMVQSNKEITRVLPKALHHRTGGYLRPLQR
FT                   AHEGVKISQREFRTALDVLMNHLRLKDPDLRVFVKYGRSPLE"
FT   gene            complement(522207..522506)
FT                   /locus_tag="PYCH_06210"
FT   CDS             complement(522207..522506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06210"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24309"
FT                   /db_xref="InterPro:IPR018664"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI80"
FT                   /protein_id="AEH24309.1"
FT                   /translation="MPRHFRKGVKREHHFLKGLEKPLERIAAIPGVKKVIPGRIYASDS
FT                   RGFEIKVSRETRTGLKLIAKSDGSVQEVFLVVDIGDRERVRKAIEELAEEWRKC"
FT   gene            522505..523200
FT                   /locus_tag="PYCH_06220"
FT   CDS             522505..523200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06220"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24310"
FT                   /db_xref="InterPro:IPR007364"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI81"
FT                   /protein_id="AEH24310.1"
FT                   /translation="MFTSSMQGFLKIRTIPPPVVRMPYLVIEHLEEISEWLWLEYKHVS
FT                   EWWGEKLIFTNVPAKDRERLAKLGSVLSQSITEFPIDRSKLIILDPFAEEELKPEDIED
FT                   DTIIVVGGILGDFEFTGKTKKFITDKIEGANARHIGSVQFSIDGSAIVAKLIAEGKRLD
FT                   EIEYELNPTIKLDEFSEITLHYAVPKLNGKLLLTPDLIELQKRELGYCKDHEEDEELEA
FT                   FFEGRKELK"
FT   gene            complement(523203..524354)
FT                   /locus_tag="PYCH_06230"
FT   CDS             complement(523203..524354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06230"
FT                   /product="myo-inositol-1-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06230"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24311"
FT                   /db_xref="GOA:F8AIT6"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIT6"
FT                   /protein_id="AEH24311.1"
FT                   /translation="MVRVVIVGQGYVASIFAVGLERIKRGDLGYYGVPLANELPIKVED
FT                   IQIVGSYDVDKTKIGLPLYEIVQRYWKGDVPETLQEVFVRKGVHLRSLRNLPIEAVGLE
FT                   DEMSLRDAIEHLVSEWKELKPDVIVNVPTTEAFVPFEDLEKLEKAIKEDDRDRLTATQV
FT                   YAYAAAQYAKEVGGAAFVNAIPTLIANDPAFVELAKESNLVIFGDDGATGATPLTADVL
FT                   AHLAQRNRHVRDIAQFNIGGNTDFLALTDKERNRSKEYTKSSVVEDILGYNAPHFIKPT
FT                   GFLEPLGDKKFIAMHIEYVSFNGAIDELVITGRINDSPALAGLLVDLVRLGKIAVDRKE
FT                   FGTVYEVNAFYMKNPGPKEAKNLPRIIAYEKMRQWAGLKPRYL"
FT   gene            complement(524514..525272)
FT                   /locus_tag="PYCH_06240"
FT   CDS             complement(524514..525272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06240"
FT                   /product="ribulose-1,5-biphosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06240"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24312"
FT                   /db_xref="GOA:F8AI82"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="InterPro:IPR022828"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI82"
FT                   /protein_id="AEH24312.1"
FT                   /translation="MLEHVAISRAIIESYMKELLNSLRLDVAIVGAGPSGMVAAYYLAK
FT                   GGAKVAIFEKKLSIGGGIWGGGMGFNKVVVQEEAREILDEFGITYEEFEPGLYVADAIE
FT                   VATTIASKTVKAGAKIFNMVEVEDLVVKEGRVSGVVVNWTPVRMTGLHVDPLTVEAKFV
FT                   IDSTGHGAQITQHLLRRGLIEKVPGEGPMWAEMGERLTVEHTKEVFPGLYVTGMAANAV
FT                   AGAPRMGPIFGGMFLSGRKAAMEILQKLRA"
FT   gene            525353..526645
FT                   /locus_tag="PYCH_06250"
FT   CDS             525353..526645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06250"
FT                   /product="Thiamine biosynthesis protein (thiC)"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06250"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24313"
FT                   /db_xref="GOA:F8AI83"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI83"
FT                   /protein_id="AEH24313.1"
FT                   /translation="MTQMEEAKRGVITEELKFIAEREGISAEKLRRSIAKGHTVIFRNV
FT                   RHDWIKPVAVGNVVRVKVNANIGTSRDIINVEEEIEKAKIAVKYGADTIMDLSTGGDLD
FT                   EIRKKIMKAIDVPIGTVPIYQAAEEMLAKGRAIIEMTEDDMWKAVEKHFRDGVDFATIH
FT                   VGVTKEVVEKMKKTKRIVGMVSRGGTFLAAWILHWDKENPFYKDYDYLLELAKEYDVVL
FT                   SLGDGLRPGGLPDAGDELQIAELYTLGRLVKRAREAGVQTMVEGPGHVPIDQIPAQIKL
FT                   AKIATDNAPFYVLGPIVTDIFPGYDYIAAAIGGAIAALNGADFLCYVTPAEHLGLPDKE
FT                   HVRLGVIAAKIAAHAVNLTRFEADFKKDYLMSLARGRLNWEKQYELAPDKERFIEIRKE
FT                   RPTKTEACSMCGDLCAIKIIQEILAKKGEED"
FT   gene            526642..527301
FT                   /locus_tag="PYCH_06260"
FT   CDS             526642..527301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06260"
FT                   /product="phosphoribosylaminoimidazolesuccinocarboxamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06260"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24314"
FT                   /db_xref="GOA:F8AIT7"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIT7"
FT                   /protein_id="AEH24314.1"
FT                   /translation="MRLIYRGKTKNVYEDGPYLIFYFKDSLLGFGDEEDTGGNEVIGER
FT                   KGKGSAVLKQAEFFFKLLEEHGIKTHFVERLDERRARFLKAEKIPLEVIYRFKAYGSFL
FT                   RRYCGWVEPLQELNIVEFTLKDDSLGDPLITEEAIERLGIASAEEIRQMKETTKKVAKI
FT                   LREFFSSKALDIIDFKLEFGRRERRLLVIDEISGDTMRVMRNGKLLSQEELLEVIG"
FT   gene            527298..528230
FT                   /locus_tag="PYCH_06270"
FT   CDS             527298..528230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06270"
FT                   /product="5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06270"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24315"
FT                   /db_xref="GOA:F8AI84"
FT                   /db_xref="InterPro:IPR009720"
FT                   /db_xref="InterPro:IPR010672"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI84"
FT                   /protein_id="AEH24315.1"
FT                   /translation="MIISTIASHSSLQILLGAKNEGFQTRLYIKPRRKAFYSSIPLVDE
FT                   LVVTEDMARILNDDGIVIPHGSFVAYLGIDAIENSKAKFFGNKRFLKWETTFELQDRAL
FT                   EKAGIPSVEVVESEDVKPDELYFVRIEGPRGGSGHFMAYGRELEEKLEKISEPYRIERF
FT                   ISGAYIYVHFFYSPIMDRLELFGVDERLVIADANKRRPFKSLPYIIVGNKAVALRESLL
FT                   PKLYDYGLAFVEAMKELERPGVIGPFALHFAYDGDFHCMGFASRIDGGSNASHWYSALY
FT                   WGKSMFMGERIAREIRMAINEDRLEEVIT"
FT   gene            528227..528817
FT                   /locus_tag="PYCH_06280"
FT   CDS             528227..528817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06280"
FT                   /product="IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06280"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24316"
FT                   /db_xref="GOA:F8AI85"
FT                   /db_xref="InterPro:IPR010191"
FT                   /db_xref="InterPro:IPR020600"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI85"
FT                   /protein_id="AEH24316.1"
FT                   /translation="MRYVGRMLGIGLNNGKPFAFYRLNSRSFPNRKAVVRGGDVFIVNQ
FT                   EETDNPYVSYPVVKLLEGYVVVSNGLQTTFIAQALEWESPKKALIHVLDAFDYERDDYN
FT                   TPRIAGIVERGKVRGWLGFVGRDELWVKGLKLREGMAFFTATYNVDGVEEIELSFSSAK
FT                   ELVEKVLSFKFTHAVLAIGVVEKEKGWEIAVGP"
FT   gene            complement(528823..529626)
FT                   /locus_tag="PYCH_06290"
FT   CDS             complement(528823..529626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06290"
FT                   /product="stomatin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06290"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24317"
FT                   /db_xref="GOA:F8AI86"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI86"
FT                   /protein_id="AEH24317.1"
FT                   /translation="MLPTNFIVLGIVLLFVLVFLASAIKIVKEYERAVIFRLGRVVGAR
FT                   GPGLFFIIPIFEKAVIVDLRTQVLDVPVQETITKDNVPVRVNAVVYFRVIDPVRAVTQV
FT                   RNYIMATSQISQTTLRSVIGQAHLDELLSERDKLNRELQRIIDEATDPWGIKVTAVEIK
FT                   DVELPAGMQRAMARQAEAERERRARILLAEAERQAAEKLREAAEIISEHPMALQLRTLQ
FT                   TISDVASDKSNVIVLTLPMEMLKLFKSLTEAAEAYREKAEKGEGK"
FT   gene            complement(529628..530944)
FT                   /locus_tag="PYCH_06300"
FT   CDS             complement(529628..530944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06300"
FT                   /product="nfeD protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06300"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24318"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI87"
FT                   /protein_id="AEH24318.1"
FT                   /translation="MRKPLLLLVIFLLLPSVLAQERTVYVAQVRGEITFYTYDQFDRYI
FT                   SEAERAGAEAIIIQLDTPGGRGDAMQAIIQRIQKAKVPVIIYIYPPGATAASAGTYIAL
FT                   GSHFIAMAPGTSIGACRPILGYAQNGSIIEAPPKIVNHYVAYIKSLAEESGRNATIAER
FT                   FITEDLSLTPEDALKYGVIEVVARDVNELLEKADGMTTKLPVNGRYVTLHLRGARVVYL
FT                   EPSFKDKLITYITDPTIAYLLLTLGIWALILGFLTPGWHVPETVGAIMIVLAIIGLGYF
FT                   GYRSAGLLLIIVAMLFFVAEALTPTFGLFTVAGLITFLLGSIMLFGGGEVEYLIGPDVF
FT                   RELRLVIITISVLLALFFAFGMAAVIRAHRRKAKTGKEEMTGLTGIVIEPLNPEGMVKV
FT                   RGELWRARSRDGKKIDVGEKVKVVDMEGLTLIVVKEGGD"
FT   gene            531119..531526
FT                   /locus_tag="PYCH_06310"
FT   CDS             531119..531526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06310"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24319"
FT                   /db_xref="GOA:F8AIT8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIT8"
FT                   /protein_id="AEH24319.1"
FT                   /translation="MRRYLIVRVKEDGKLELPLDVAYEVGLVKGAYFLVEADTDIKEMH
FT                   IERIALPGKELVEIELVIEDKPGVLAKVSGALGRLGVNILFNEAEELETLGLSAFVAIV
FT                   DVSGSKVTPEELEKVLGSIEEVKEVKVLRVQ"
FT   gene            complement(531504..533006)
FT                   /locus_tag="PYCH_06320"
FT   CDS             complement(531504..533006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06320"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   D"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06320"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24320"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI88"
FT                   /protein_id="AEH24320.1"
FT                   /translation="MNPLLLPAFPLTSALLVYLFGTLKWEGSIRARFRFPLLLEIKFLF
FT                   AIGSLTPLIILPFVNERVIVGNYPQPIGIEVGIWELNWPLLLAEVVVFGAAALYALRRV
FT                   NDWKELSLFLIMHGGLLGAFISLDLFNFYIFMELASVASFALIALSPEKGARKAAFKYL
FT                   MLSIVASYLFIFSLGVIYAETGYLNAELIREVAKPSKTLLAALSVALASLLLKAGIFPL
FT                   HVWLPDTHSKAKTHVSAVLSGLAVKAPIYGMLLLQYSLGIPEALLLALRLIAIASMIFG
FT                   VVMALFQTDVKRLLAYHTVSQMGYVLLGIALNLPGAVALYALAHAIFKGGLFLSLGALA
FT                   DARRSKELSRLGARGEPVLLTAVLLLSLAIAGFGPSIGGVVKGILAVGTLEKLAIYGVS
FT                   VGTAASFTKVNYYLRSGYGHGPGPIDTVPGLVLALLALILGVLLGGNVSPTDALLVLGL
FT                   IVFLALKLFGMPRREMVLDIDVGEGVALLSLLTTALIVLSAP"
FT   gene            complement(533003..533281)
FT                   /locus_tag="PYCH_06330"
FT   CDS             complement(533003..533281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06330"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06330"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24321"
FT                   /db_xref="GOA:F8AIT9"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIT9"
FT                   /protein_id="AEH24321.1"
FT                   /translation="MMKIAILVMTIGLAGIIINRDRLKQILSLNVMSLGIVLFFVAIGA
FT                   EKGSFPPLKEFGTPVDPLPAVLMLTTLVVDVAVTALALGLVMRGDGA"
FT   gene            complement(533284..533667)
FT                   /locus_tag="PYCH_06340"
FT   CDS             complement(533284..533667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06340"
FT                   /product="putative multisubunit Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06340"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24322"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI89"
FT                   /protein_id="AEH24322.1"
FT                   /translation="MKMSIVARTTTKLVSPFLVTYAIYLMLYSTDAPGGGFQAGVVLAV
FT                   AVVLLITSHGYKKVRKRFRKKVVGTFESAFGLAVVTLLLFVVALSLPPSNYYVVPFNVL
FT                   VAVKVGSAFTLIFYTLTAFLERD"
FT   gene            complement(533664..534125)
FT                   /locus_tag="PYCH_06350"
FT   CDS             complement(533664..534125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06350"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06350"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24323"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIU0"
FT                   /protein_id="AEH24323.1"
FT                   /translation="MLGTILEGTLILLALFVILHSKILPALVAYSLAGLSFILLLILLR
FT                   APDVALSAIVVGALVIGLFIFAHESVREEGGLRLFLALAVIPLCLFLLTLEYRVAPGGS
FT                   YAYYLVNWRMNNLVTEILASWRLYDSVGEALLLFAASLGFSAVLGGGRR"
FT   gene            complement(534106..534420)
FT                   /locus_tag="PYCH_06360"
FT   CDS             complement(534106..534420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06360"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   G"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06360"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24324"
FT                   /db_xref="GOA:F8AI90"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI90"
FT                   /protein_id="AEH24324.1"
FT                   /translation="MLEIIFLLFGYSMMFFGALGVIRFPDVYTRLHAATKCDTGGAMGI
FT                   VFGLALMADAPIIVKAKLLILLMFIAMINPMISHAIAKGAYRYGVKPKVEVDMYAWDNP
FT                   "
FT   gene            complement(534413..534685)
FT                   /locus_tag="PYCH_06370"
FT   CDS             complement(534413..534685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06370"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   F"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06370"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24325"
FT                   /db_xref="GOA:F8AIU1"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIU1"
FT                   /protein_id="AEH24325.1"
FT                   /translation="MAQEGILVAGIWFLLLTTIMATYRVMVGPTLPDRVVGLNTVTTKV
FT                   VVMTAVLAVLWEEWYLIDAAIVLLMVNSVSGLLLAKYLERRGRRA"
FT   gene            complement(534661..535266)
FT                   /locus_tag="PYCH_06380"
FT   CDS             complement(534661..535266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06380"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   E"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06380"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24326"
FT                   /db_xref="GOA:F8AI91"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI91"
FT                   /protein_id="AEH24326.1"
FT                   /translation="MTRVPLYLRSRIEEVRKRFTYELYESQKLPDWERFAITWIVLMVF
FT                   WLIITSDLTLQGLALGLPATGIVAYFMRDFLTDDIRHSKHLVGKLLYFALLYLPQYFII
FT                   MAFRLLESNIKVAKHALLGDIRPGIVKIKTDLHSDTGVTILANSITLTPGTLTLDVVKK
FT                   LDGTYLYVHWIDVQTLNPDKAGEIIKGDVEEWLKKVFW"
FT   gene            complement(535289..536041)
FT                   /locus_tag="PYCH_06390"
FT   CDS             complement(535289..536041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06390"
FT                   /product="NAD-dependent deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06390"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24327"
FT                   /db_xref="GOA:F8AIU2"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR027546"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIU2"
FT                   /protein_id="AEH24327.1"
FT                   /translation="MMAEAAKLLARSKFAIAFTGAGISAESGVPTFRGKDGLWMRYRPE
FT                   ELATPEAFSRNPRLVWDFYKWRMKLIAKARPNRAHYALAKLEEMGILKAVITQNVDDLH
FT                   REAGTKNLIELHGNIFRVRCTSCDYRENLKESCSLEEFLREELPKCPNCGSLLRPDVVW
FT                   FGEPLPEEELSEAFKLARRADLILVIGTSGLVYPAAYIPYIVKENGGIVIEINVEESAL
FT                   TPIADIFLRGKAGEVMGTLLEEVKKILD"
FT   gene            complement(536082..536918)
FT                   /locus_tag="PYCH_06400"
FT   CDS             complement(536082..536918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06400"
FT                   /product="D-aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06400"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24328"
FT                   /db_xref="GOA:F8AI92"
FT                   /db_xref="InterPro:IPR007035"
FT                   /db_xref="InterPro:IPR027476"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI92"
FT                   /protein_id="AEH24328.1"
FT                   /translation="MRAFISVDLEGLPYVVSREHLLVKGTLYNEARKIATRLVKATADA
FT                   LHENGFDEIVIADSHGPMVNVVPEEMPEYVELVRGFPRPLSMVAFAKGSDMALFIGYHA
FT                   KAGTAYATFDHTYSGATIDRIEINGIEVSEFLMNAMLLGEWGIPLGVLAGDEALQKDAE
FT                   MTPWVEFVPLKRASGRYSAISPSLPRIEASIREAIGRAIRKLERGELRPLEVKKPMNVR
FT                   VRFLNSAHAEVAELLPFVERVDGKTVAFRAESVEDAYKVIEVLVFAAAGVNYIVSR"
FT   gene            537017..537436
FT                   /locus_tag="PYCH_06410"
FT   CDS             537017..537436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06410"
FT                   /product="hydrogenase nickel incorporation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06410"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24329"
FT                   /db_xref="GOA:F8AI93"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="InterPro:IPR020538"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI93"
FT                   /protein_id="AEH24329.1"
FT                   /translation="MHEWALADAIVRTVLEYAGKEGASKVLAIRVVLGELQDVNAEVVA
FT                   FAMRELMKGTIAEGAEIIFEEEEAIFRCRNCGHVWKLKEVKNRLDERIREDIHFIPEVV
FT                   HAFLACPKCGSHDFEVVKGRGVYIAGIKVEKEGGA"
FT   gene            537433..538158
FT                   /locus_tag="PYCH_06420"
FT   CDS             537433..538158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06420"
FT                   /product="ParA/MinD family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06420"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24330"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI94"
FT                   /protein_id="AEH24330.1"
FT                   /translation="MIDPRTSAIEARLEKVNRIIPIVSGKGGVGKSLISTTLALILAEK
FT                   GHRVGLLDLDFHGASDHVILGFEPKEFPEEDRGVVPATVHGVKFMTIAYYTEDRPTPLR
FT                   GVEVSDALIELLTITRWDELDYLILDMPPGMGDQFLDVLRFLKRGEFLVVATPSKLALN
FT                   VVRKLIELLKEEGHKVLGIVENMKLDEERDVEELAREVGVPYLAGIPFYGDLEEKIGKP
FT                   EELLKTEFAERIRKLAERL"
FT   gene            complement(538236..538973)
FT                   /locus_tag="PYCH_06430"
FT   CDS             complement(538236..538973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06430"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24331"
FT                   /db_xref="GOA:F8AI95"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI95"
FT                   /protein_id="AEH24331.1"
FT                   /translation="MRELLKKPELKYLLLILALSFGLSSLTLSALGMISFIPQFLALAL
FT                   TDSVNPCTFVVYTIFLIALSVKGLPKGKVYLVGLLFIMAVYISYYTLGVGLVILAGKIP
FT                   TVWAGYLAMAFGLYTAVTGLFEKSRVVGKGKLRKLAFSTEATVAGALLLGFAVSTTLLP
FT                   CSMGPYVVYAAIISKSGALAYLLLALYNIIFVLPLFVILFAMGSLSESKAFSRAMVKHS
FT                   RELSLLSGFLLVLLGLWILTANP"
FT   gene            539170..539652
FT                   /locus_tag="PYCH_06440"
FT   CDS             539170..539652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06440"
FT                   /product="hydrogenase maturation protease HycI"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06440"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24332"
FT                   /db_xref="GOA:F8AIU3"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIU3"
FT                   /protein_id="AEH24332.1"
FT                   /translation="MELWELLRNAGRVVICGMGNEMRGDDAFGLLVVEKLRELVKSRDI
FT                   LILNCGEVPESYTGKIASFKPDLVVFVDAVEFGGRHGDMIVADPEDTIGEAISTHGLPL
FT                   RFLVQYLKERTGARFILIGCQPRFLGLFEEPSDVIRERAEQLARALAGALGGRSDD"
FT   gene            539645..540541
FT                   /locus_tag="PYCH_06450"
FT   CDS             539645..540541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06450"
FT                   /product="cetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06450"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24333"
FT                   /db_xref="GOA:F8AI96"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI96"
FT                   /protein_id="AEH24333.1"
FT                   /translation="MIRIREAELWDCAKIVDVYISNEDVRSSSSLEAYLRVGPWARVET
FT                   CAIHLNNLKLHGGLALVAELDGRVVGEAELLFSEEPWKGRIMRTAHLSVIEVAKKYQGR
FT                   GIGRALVEHLIEKAQELGYEIMTVTPEKGAIGFYKRLGFEEELYRGVLVDIPTRPGRAP
FT                   TVETMEPSWTGLKELPMVLGQFQSSYNHWFSEFVDRIADIDLMVYFESGKVGNSFYVFE
FT                   GSYTDENAVTAYAWGGNTLEVLEGLLALAWERGFRTVRTTVEKVFMMNILNLGAEILGE
FT                   VNILVRPLGEPLWIRGG"
FT   gene            complement(540528..541103)
FT                   /locus_tag="PYCH_06460"
FT   CDS             complement(540528..541103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06460"
FT                   /product="Molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A (mobA)"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06460"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24334"
FT                   /db_xref="GOA:F8AI97"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI97"
FT                   /protein_id="AEH24334.1"
FT                   /translation="MIGAVLAGGRGRRFGGDKLLFRIGGKPLISYALQGLEMSRYIDEV
FT                   VIIAAPENAQRLRELGYRVVIDRLLVGPIGGIYIALSLGDAFVAAGDMPSIIPEFVDYI
FT                   IKQFWNSGKIVCVPRWANGYLEPLHAAYSQDFREILGEQIRSGDYMIRRAIEKVDACYI
FT                   PIEELPEEWKASFFNVNRKEDLRRFSPL"
FT   gene            541338..541574
FT                   /locus_tag="PYCH_06470"
FT   CDS             541338..541574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06470"
FT                   /product="[NiFe] hydrogenase maturation protein (hypC)"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06470"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24335"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI98"
FT                   /protein_id="AEH24335.1"
FT                   /translation="MCLATVAKVLQISEDGKTAVVDFGGIRREIRLDLLPNVEVGDYVV
FT                   VHTGFAIEKVDEKTAREILSVWEELWKLERRGG"
FT   gene            541576..542694
FT                   /locus_tag="PYCH_06480"
FT   CDS             541576..542694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06480"
FT                   /product="hydrogenase expression/formation protein HypD"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06480"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24336"
FT                   /db_xref="GOA:F8AI99"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="UniProtKB/TrEMBL:F8AI99"
FT                   /protein_id="AEH24336.1"
FT                   /translation="MASTNILGPYRDKELAQRIVQKIHEEAKGLDEVRLMHVCGTHEDT
FT                   VTRGGIRSLLPENVKIMSGPGCPVCITPVEDIVRMQEIIREAYAEGDRIILTTFGDMYR
FT                   IPTPLGSFADLKSEGYDVRVVYSIYDAYKIAKENPDRLVVHFSPGFETTTAPTAGMLNA
FT                   VVEGGLENFKIYSVHRLTPPAVEALVKQGTRFHGLIDPGHVSTIIGVKGWAPITEKYGI
FT                   PQVVAGFEPVDMLLAILLLIRMVKTGEVNILNEYTRVVKWEGNVVAQELIEKFFEVKDA
FT                   KWRALGVIPKSGLELRREWRELEIRTYYNPDVPKLPDLEKGCLCGAILRGLALPPQCPH
FT                   FGNACTPRHPIGPCMVSYEGTCSIFYKYGALF"
FT   gene            542787..545105
FT                   /locus_tag="PYCH_06490"
FT   CDS             542787..545105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06490"
FT                   /product="hydrogenase maturation protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06490"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24337"
FT                   /db_xref="GOA:F8AIA0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIA0"
FT                   /protein_id="AEH24337.1"
FT                   /translation="MRAYRIKVQGIVQAVGFRPFVYRIAHAHNLRGYVRNLGDAGVEIV
FT                   VEGREEDIEAFLRDLYTRKPPLARIDRLERKEIPPQGFDRFYIEKSSQEGEGGNSIIPP
FT                   DIAICEDCLRELFDPANKRYMYPFIVCTNCGPRFTIIEDLPYDRENTTMKEFSMCDFCE
FT                   SEYKDPLNRRYHAEPVCCPVCGPSYRLYTNDGQEITGDPLKKAAKLIDKGYIVAIKGIG
FT                   GIHLACDATREDIVAELRRRTFRPQKPFAIMARDLETVKSFAYVSPEEEEELMSYRRPI
FT                   IALRKKDPFPLPDNLAPGLHTIGVMLPYAATHYLLFHHSKTPVYVMTSANYPGKPMVKD
FT                   NEEAFKELREIADYFLLHNRKILNRADDSVVRFVDGKRAVIRRSRGFVPLPIEIPFEYN
FT                   GLAVGAELMNAFGIAKGGKVYPSQYIGNTSKVEVLEFMREAIAHFRRILRVKELDLIVA
FT                   DLHPSYNTTKLAMEIANELNVEFLQVQHHYAHVASVMAEHGLEEVVGIALDGVGYGTDG
FT                   KVWGGEVIYLGYEDVERLAHIAYYPLPGGDIASYYPLRALMGILSKVYDVEELEGIIRG
FT                   YCPRAIESLKYGETEFKVALGQLVRGINVAYASSTGRVLDALAVLLNVVYRRHYEGEPA
FT                   MKLESFAMKGKNDLKLEVPVEGKTIKVEELFVDVLDLLEKASPADIAYSVHIAMARTFA
FT                   EVAVEKAREFGVKAVALSGGVAYNELITKTIRKIVEANGLRFYSTYEVPRGDNGINVGQ
FT                   AFLGGLYLEGYLSRDDLTM"
FT   gene            complement(545075..546601)
FT                   /locus_tag="PYCH_06500"
FT   CDS             complement(545075..546601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06500"
FT                   /product="Predicted metal-dependent hydrolase with the
FT                   TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06500"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24338"
FT                   /db_xref="GOA:F8AIA1"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIA1"
FT                   /protein_id="AEH24338.1"
FT                   /translation="MVELKAFVNGRIYVSFRPLKIVDGLLIAGGRVLYAGDMAKVAEVA
FT                   RRLGGEVVDLRGKTVMPSFFDSHIHLDELGLSLEMLDLRGVRDIETLKRKLLKYASGHK
FT                   TSWVLGYGWDQEELGRYPTREDLDVVKNRPVLLYRRCFHVAVANSRALELLDLKPSEDF
FT                   DPETGIIRENALDEARKKVEETLTVWDYARFIEKAQEHLLSLGVTAVAFVSVGEKALRA
FT                   LLWLDRKERLLLRVFAYVNPDVLPKLDALGIGPFGGDMLRIAGVKVLADGSLGARTAWL
FT                   SEPYADEPTRGHPNLNRKELKEIVEAAKALDLDVAIHAIGDATLDMILDVFGEANVKGR
FT                   VEHASLVRDDQLDEMASLDIRAAVQPRFVISDWWAVRRLGPRARFLYRFRSMREKGIEV
FT                   GFGTDSPIEPANPWEGVYAAVTRGRFEGIETFHYTAQEVLSIREALDAYTRCSALVTLA
FT                   PDIGRLEPGCRADFIVLDKDPLAISESELREVEVLETYVAGHMVRSSLLR"
FT   gene            546650..548497
FT                   /locus_tag="PYCH_06510"
FT   CDS             546650..548497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06510"
FT                   /product="indolepyruvate: ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06510"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24339"
FT                   /db_xref="GOA:F8AIA2"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIA2"
FT                   /protein_id="AEH24339.1"
FT                   /translation="MKRLLMGNEAIAYGALESGIAFATGYPGTPSTEVIETIARLKPEV
FT                   FAEWAPNEKVALEEAAGVAYTGLRALVTMKCVGLNVAADPLMSLAYSGVEGGLVILVAD
FT                   DPGPHTSQTEQDDRYYGKIALLPVLEPADPQEAHDLIKYAFELSERYKVPVIFRTTTRV
FT                   NHTTADVEVGEFVELNREPKFKKDIERYVRASMEGNRRRHKWLNETLAKIEEEFNSMPF
FT                   NWVEGDGRIGIIVEGAPYNYVKEVLPKLDGDFKVLKLSTPHPLPRKLVVEFLKGVDMAI
FT                   VIEDGAPFLEEEVKIVAYEEALNVPVYGKRTGHLPLEGELTPSIVRNALLRLLGKEAEE
FT                   YRKPEEVKRAESLAPKRPPVMCPGCPHRGSYRALLDALRELGFGKFDIPVHGDIGCYAL
FT                   SLLPPLEAIWTEYVMGGSISLANGQSAVMKKKIVATIGDSTFFHNGIQPLIDAVYKDLD
FT                   VLVIILDNRTTAMTGHQPHPGTGGSETGRRFREIDIEALVKAIGVKYVKTVDPYDLKAT
FT                   KEAIKEAMKVKGPAVIIARRECVIPVIRRGEIGEIPVVVEEKCTGCKACILLTGCPALI
FT                   YEQETRKVRIDSLICTGCGVCNQICPFEAIKFPSELRSS"
FT   gene            548586..548990
FT                   /locus_tag="PYCH_06520"
FT   CDS             548586..548990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06520"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24340"
FT                   /db_xref="InterPro:IPR018716"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIA3"
FT                   /protein_id="AEH24340.1"
FT                   /translation="MGKYSPILEAVKLKGSNEFSRSELIGIITFKLSLLGVKEAKRLVE
FT                   EAIKEGIIEERGELLVVNLQVAEEEEEGDVLGEIVTYIARELGMTEMEVMEELREFGRR
FT                   YGNLDMKLVAYLYGLEKGLDMSPFRDRLEG"
FT   gene            549198..549521
FT                   /locus_tag="PYCH_06530"
FT   CDS             549198..549521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06530"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24341"
FT                   /db_xref="UniProtKB/TrEMBL:F8AJ14"
FT                   /protein_id="AEH24341.1"
FT                   /translation="MLPTAFITTALLIDASALRIEIDERELRLRGLLGIFRKTIPIDEI
FT                   ESFLVSDSWSACHGMIHFTIPAKGCIQINRRKGWSISFSTNQPEEIAMVLATLGVPRAL
FT                   RLK"
FT   gene            549654..549887
FT                   /locus_tag="PYCH_06540"
FT   CDS             549654..549887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06540"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24342"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIH6"
FT                   /protein_id="AEH24342.1"
FT                   /translation="MPSETIKLTAKFKLKETPEGLDELFQTYREIVNFLITHAFENNVT
FT                   SFYRLKKETYKTLHSEGENPVRVLPCKVPREV"
FT   gene            complement(550104..554222)
FT                   /locus_tag="PYCH_06550"
FT   CDS             complement(550104..554222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06550"
FT                   /product="DNA helicase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06550"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24343"
FT                   /db_xref="GOA:F8AIH7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIH7"
FT                   /protein_id="AEH24343.1"
FT                   /translation="MPEILHPSEIARFFELQECSNYLRLLFSYKRGELEKYKLVLKVKE
FT                   EAGRSLAKWGENFEVELLRRLRHILLNTQFYGFFTSCKRDGSFSFFNRFFPKNIILCSS
FT                   DQECFERVGELLKREDKLLLYQPHLRGRIGAFIVSGRADFIVREGSTFYILEAKFTREE
FT                   KLAHRFQAVTYAYLLAQMLEELKIRGRILLAVITKGKLKGWPPESFEFSRDVEEYVMTL
FT                   EGKLSENGPFARVLRGGRSHLWLTARCAECPFEPVCIKEAVEARSLGLLGIPPGHQEAF
FT                   KSVGVNTVDDLAGLFEFSSLWPTNFSEPVMRRPDIVLKLMRVVGITNLPKLSRLAQVIK
FT                   RELDRVPGDKAWPEFIPGTGYNLPKDTCEGKCPENYPAGSLVRVYLFIEQSHITDTLLG
FT                   ASAVVENTMTGKMEIVAEVVEEPPMDPEIGEKLEGLMLDKFFRKLFAAIRQVAPNLEGE
FT                   TYKVGRKVESCNGDEVFLHLYFYSRFHRDALMDAVRRHPHLYGSRAIRALLSLRRAIDQ
FT                   EGYSIIKDELISRHALRFPPGLGIMLVASQFGFKWRVVNGFEEIFKFLAERRGYEINLE
FT                   KLYSIAEEGLDSKSKALYPVFNREDEQIPFTAFWQALLDEKKDSLLEMLKQMALAVRHI
FT                   ERRIPEKVKDAWVPKEPLSMRELESFDLESPNLASVLMEYQMLEFFARKQQLEQYYRLP
FT                   RETRAYLEKSAFVQVEDVITSKSGCFIRGKIVLPDSETWRPYSKEEVLIDLDEGSWVAV
FT                   TPLEAFGNEDPARVIRRSPLGVITRIDHDDGSVEVKLIGTPGRGRFIFSHEGFSCKKGK
FT                   ITIGKANVISKGSIIVLDPSIDDISMSRAYDVLEKIIRGKRHYVYEKLSAIYSAGKVET
FT                   SDDNFKINIWQEEDIEEFLVKLENVAKLNEEQKKFVKDIHSFLVSLQGPPGTGKTARAV
FT                   APAILARAYSSIKRKKDALFIVTAISHRAVNEALIKTARLLEELSPLIPELKNVELIRG
FT                   LANEEAIESIKRELEGIKNIKFEHEKLNFGGGQRSLEAIISKRGLVKVLFATPQTLAKI
FT                   VEWGKADLVVVDEASMMDLPIFLLATAPARGQVLIVGDHRQMQPIQVHEWELEDRKTIE
FT                   EHLPFLSAINFIRFLRGELEERELKKFKRILGRDPPEWIANKDDILPVYRLKKTYRLPE
FT                   ALAKLHTELFYIFDGIELESEKKYDEEKLKLLREASRERSWVGWILDPKHPVVLIVHEE
FT                   SSSTKINEFEAKLVAEIVSKIPNGLSIGIVVPYRAQKRLIKSLIGNKAEVDTVERFQGG
FT                   ERDVIIVSMTSSDPAYLMQVFDFIYNPNRLNVAASRAKEKLILIASENLFTLSAHDLDH
FT                   FEKLRPWKKFYLLMTRKEELRTDKFRAFR"
FT   gene            554416..556044
FT                   /locus_tag="PYCH_06560"
FT   CDS             554416..556044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06560"
FT                   /product="Na+/H+ antiporter, putative, NhaC family"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06560"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24344"
FT                   /db_xref="GOA:F8AIH8"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIH8"
FT                   /protein_id="AEH24344.1"
FT                   /translation="MTDYGILSLLPPLVAIGLAILTKRVLFALFFGVWVGGLLVAGGDP
FT                   IGATVQTLKWIVLNIASAWEENGQLVTDLWNTRILVFDTLIGAGVALIYKAGGMNAIAK
FT                   AVTKKVKSSRAASLMAAIFGTIIFFDDYTNTIIVGNTMRPITDRTRVSREFLAYADDST
FT                   AAPVAVLAVVSTWIGYELGLLKDALASIGENISAYSAWFASWPYRFYPILAIILVYLVA
FT                   ITHRHYGPMLKAEYRARTTGKVLRDGAQPMMTTEIDVGTPIKGKENIWVFILPVITLIA
FT                   LTFIGLWVTGGGSEAYAKGGFQEVLSNADSTWALVWGSFGMVIVAMALILGMKIMDLKQ
FT                   VEETIVAGMKQMHFAMMILILAWSIKSACDAVGTADYVVRVASDILSPSLVPFVIFVIS
FT                   AFISFTTGTSWGTFAIMMPIAVPLAYHLSGGLGPVVYASIASVFAGGVFGDHCSPISDT
FT                   TIMSSMFSGCDHIDHVNTQIPYALTAAIIGAIMLLLFAIGITNGWLLLAIAIPMLIGFH
FT                   YILSEWYGKKVGIPHGKVPIYIVEE"
FT   gene            complement(556526..556804)
FT                   /locus_tag="PYCH_06570"
FT   CDS             complement(556526..556804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06570"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24345"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIH9"
FT                   /protein_id="AEH24345.1"
FT                   /translation="MSLIGTFEPFPDLSSEPGLSILFESYWNDVLLHDEEAGAGDFQFS
FT                   LSLIGTPETNVQTYEVSPDFQFSLSLIGTGGFFACFLLCFSWESWIL"
FT   gene            complement(556903..557046)
FT                   /locus_tag="PYCH_06580"
FT   CDS             complement(556903..557046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06580"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24346"
FT                   /db_xref="UniProtKB/TrEMBL:F8AII0"
FT                   /protein_id="AEH24346.1"
FT                   /translation="MIQKNSERSSFQFSLSLIGTPAGADFPPARAPLSILFESYWNIGV
FT                   MT"
FT   gene            complement(557211..557489)
FT                   /locus_tag="PYCH_06590"
FT   CDS             complement(557211..557489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06590"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24347"
FT                   /db_xref="UniProtKB/TrEMBL:F8AII1"
FT                   /protein_id="AEH24347.1"
FT                   /translation="MSLIGTEIHVENDILDTLLLLSILFESYWNTANHVFLYTANDFQF
FT                   SLSLIGTLAAPSKSIISAPTFQFSLSLIGTLYVVMNEQHKLLPFNSL"
FT   gene            complement(558368..559363)
FT                   /locus_tag="PYCH_06600"
FT   CDS             complement(558368..559363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06600"
FT                   /product="pyruvate ferredoxin oxidoreductase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06600"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24348"
FT                   /db_xref="GOA:F8AII2"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:F8AII2"
FT                   /protein_id="AEH24348.1"
FT                   /translation="MAVRKPPVTTREYWAPGHAACAGCGCATALRLATKAFSEAMEEKY
FT                   GDPNAFAIAQATGCMEVVSAVFPYTSWKAPWIHVAFENAAAVASGIEAAWKKLGRKGKI
FT                   LAIAGDGGTADIGMQALSGMLERWHNVVYLMYDNEAYMNTGIQRSSSTPYGAWTTTSPP
FT                   GKLSIGEDKPKKWVALIAAAHQIPYVATASIANPFDFIKKMKKAAKVDGPAFVQVHCTC
FT                   PTGWRTPLEKGIEIARLAIETGIWPLFEIENGDFHNIKIQPPGGGAKVHREGGRVVRIE
FT                   FKKPIEEYLKLQGRFKHLFKSPEAIDQLREQIKAMWKVLGVEAILPKPEE"
FT   gene            complement(559374..560561)
FT                   /locus_tag="PYCH_06610"
FT   CDS             complement(559374..560561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06610"
FT                   /product="pyruvate ferredoxin oxidoreductase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06610"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24349"
FT                   /db_xref="GOA:F8AII3"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:F8AII3"
FT                   /protein_id="AEH24349.1"
FT                   /translation="MPIRKVMKANEAAAWAAKLAKPKVIAAFPITPSTLVPEKISEFVA
FT                   NGELDAEFIKVESEHSAISACVGAAAAGVRTFTATASQGLALMHEILFIAAGMRLPIVM
FT                   AIGNRALSAPINIWNDWQDTISQRDTGWIQFYAENNQEALDLILIAYKVAEDERVLLPA
FT                   MVGFDAFILTHTVEPVEIPDQEVVDEFLGEYEPKHAYLDPARPITQGTLAFPAHYMEAR
FT                   YKVWEAMERAKEVIDEAFAEFEKRFGRKYQKIEEYRTDDAEMIFVTMGSLAGTLKEWVD
FT                   KKREEGYKVGAAKITVYRPFPVEEIKALAKKTKVLAFIEKNITIGLYGAVFTDASATLI
FT                   NEKEKPLMLDFIAGLGGRDVTFEQLDEAFSITRRALEEGKVEKPINWIGLRKEIL"
FT   gene            complement(560573..560890)
FT                   /locus_tag="PYCH_06620"
FT   CDS             complement(560573..560890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06620"
FT                   /product="pyuvate ferredoxin oxidoreductase subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06620"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24350"
FT                   /db_xref="GOA:F8AII4"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:F8AII4"
FT                   /protein_id="AEH24350.1"
FT                   /translation="MAESPFKADIERAQRELTEKMTPGAIVYIPGSSVINKTGSWRVFR
FT                   PEFHRDKCVRCYLCYIYCPEPSIYLDDEGYPVFDYDYCKGCGICANECPAKAIEMVREV
FT                   K"
FT   gene            complement(560952..561887)
FT                   /locus_tag="PYCH_06630"
FT   CDS             complement(560952..561887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06630"
FT                   /product="2-ketoisovalerate ferredoxin oxidoreductase
FT                   subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06630"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24351"
FT                   /db_xref="GOA:F8AII5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:F8AII5"
FT                   /protein_id="AEH24351.1"
FT                   /translation="MEVPENVKKKVTIPFEEHFFAGHTACQGCGASLALRYVLKAYGKK
FT                   TIIAIPACCSTIIAGPWPYSTLNVPLFHTAFETTGAVISGIEAGLKALGYKVKGDDGIM
FT                   VVGWAGDGGTADIGLQALSGMLERGHDAVYIMYDNEAYMNTGIQRSSSTPYGAWTTNTP
FT                   GGKRHFLEKKHKKKVIDIVIAHRIPYAATASIAYPEDLIRKLKKAQKIPGPSFIQLFAP
FT                   CPTGWRAPTDKTIELARLAVQTAYFPLFEYENGKYKINMPNPKKEPKPIEEFLKLQGRF
FT                   KYMTKEDVEILQKWVLDEWERLKKLAEVFG"
FT   gene            complement(561893..563077)
FT                   /locus_tag="PYCH_06640"
FT   CDS             complement(561893..563077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06640"
FT                   /product="2-ketoisovalerate ferredoxin oxidoreductase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06640"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24352"
FT                   /db_xref="GOA:F8AII6"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:F8AII6"
FT                   /protein_id="AEH24352.1"
FT                   /translation="MEYKPIKKVISGNYAAAYAALHARVQVVAAYPITPQTSIIEKIAE
FT                   FIANGEADIQYIPVESEHSAMAACIGASATGARVFTATSAQGLALMHEMLHWASNARLP
FT                   IVMVDVNRAMAPPWSVWDDQTDSLSQRDTGWMQFYAENNQEVYDGVLMAFRVAETVNLP
FT                   AMVIESAFILSHTYDIVEMIPQELVDEFLPPRKPLYTLTDFDNPIAVGGLATPADYYEF
FT                   RYKIAMAMEKAKEVIKEVGREFGERFGRDYSQMIETAYIDDADFVFMGMGSLMGTVKEA
FT                   VDILRREGYKVGYAKVRWFRPFPREELIEIAERVKGIAVLDRNFSFGQEGILFNEAKGV
FT                   LYNTGLRPIMKNYIVGLGGRDFTVKDAKVIADDMRKLIERGKLDKEVEWYHLKR"
FT   gene            complement(563088..563405)
FT                   /locus_tag="PYCH_06650"
FT   CDS             complement(563088..563405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06650"
FT                   /product="2-ketoisovalerate ferredoxin oxidoreductase
FT                   subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06650"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24353"
FT                   /db_xref="GOA:F8AII7"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:F8AII7"
FT                   /protein_id="AEH24353.1"
FT                   /translation="MNTLFGRAKEEVRRISLKSVDEYPEAPISLGTTLINFTGDWRTFM
FT                   PIIDKSKCVKCYICWKFCPEPAIYIKPDGYVEVDYDYCKGCGICANECPTKAITMVREE
FT                   K"
FT   gene            complement(563435..563992)
FT                   /locus_tag="PYCH_06660"
FT   CDS             complement(563435..563992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06660"
FT                   /product="pyruvate ferredoxin oxidoreductase subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06660"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24354"
FT                   /db_xref="GOA:F8AII8"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:F8AII8"
FT                   /protein_id="AEH24354.1"
FT                   /translation="MIEIRFHGRGGQGAVTAANILAEAAFLEGKYVQAFPFFGVERRGA
FT                   PVTAFTRIDEKPIRIKTQIYEPDVVVVLDPSLLDTVDVTAGLREGGIVIVNTEKSKDEV
FT                   LEKLKKKPAKLALVDATTIALEILGLPITNTAILGAVAKATGLVKIESIEEAIKDTFSG
FT                   ELGEKNARAAREAYEKTQVFEL"
FT   gene            564169..565125
FT                   /locus_tag="PYCH_06670"
FT   CDS             564169..565125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06670"
FT                   /product="Sodium/phosphate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06670"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24355"
FT                   /db_xref="GOA:F8AII9"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:F8AII9"
FT                   /protein_id="AEH24355.1"
FT                   /translation="MDTALVAALAVGFYIAWNIGANDSANAMGTAVGAGILNFRQATLT
FT                   IGIFVILGAYLRGYKVMKTVGEGIISSMSMELAILILFSAGIWVTIATIKGLPVSTTQA
FT                   IVGGVIGAGLATGATINWSVMEKVVGAWVLSPVIAGIFAALLYKFYSRIIASIKSLRRL
FT                   ELLYKWMAILGGSYMAFNFGANEVANATGPLVGADLLTPRWAGLFGAISLTLGSLTFSY
FT                   AVMHTVGKKITSLGPVSAFSAQFSSAIAVSLANYFGLPVSSSQAIVGGVVGVGLAAGER
FT                   VDKRIVADVLFGWVATPTTGMVIAFTLSKLFMAVGLL"
FT   gene            complement(565103..566383)
FT                   /locus_tag="PYCH_06680"
FT   CDS             complement(565103..566383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06680"
FT                   /product="GTP-binding protein hflX"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06680"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24356"
FT                   /db_xref="GOA:F8AIJ0"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIJ0"
FT                   /protein_id="AEH24356.1"
FT                   /translation="MKVVGVIRHEPRRRASREEFEELLRSAGYEVLAIVEQVREEHPRY
FT                   NIGPGKLEEVKKLVKALRPDRVVFANRLTPSQAYNLWRELRVEIMDKWQLVLEIFEKRA
FT                   HSKEAKLQVELANLQYELPLVKEAIRRIRLGDRAGFKGMGEYQTQQYLKHIRYRMGKIR
FT                   EELEKIRAERAVRRKKREEEGFVLIALAGYTNAGKSTLLNILTNEDVDAKNQMFTTLDT
FT                   TTRRFRLRGKKVLITDTVGFIDDLPPFIVEAFHSTLEEIVKADVVVLVVDASEPWPEVR
FT                   RKFLASLDVLRELKALDRPIIVALNKVDLVGEEDAGEKEALILELAERRSVTLSGTAKI
FT                   SARLGRVEELLEVLERTILSLPKFRLFEIKIREPEKVGKVLSIVRSIGELVAVEYGPET
FT                   TIRAYIQAGMIRELTKLGVELRAAQPP"
FT   gene            complement(566422..566703)
FT                   /locus_tag="PYCH_06690"
FT   CDS             complement(566422..566703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06690"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24357"
FT                   /db_xref="InterPro:IPR023108"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIJ1"
FT                   /protein_id="AEH24357.1"
FT                   /translation="MLIEEVKELCRELGEEGLITTIDSFVSLNRELEGKRGNEFVEIAV
FT                   LGFLEGILTTLKIRHEDGRIDALLGKVRARREELEALFRRSRSPLTEV"
FT   gene            566764..567600
FT                   /locus_tag="PYCH_06700"
FT   CDS             566764..567600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06700"
FT                   /product="fumarate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06700"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24358"
FT                   /db_xref="GOA:F8AIJ2"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIJ2"
FT                   /protein_id="AEH24358.1"
FT                   /translation="MELVDALVEAIRLAVTKIPDDVEKALTRAYEKEENDIAKFNISLI
FT                   LKAIKIGQEKRVPVCQDTGTPTFFVELGDYSNPGELVKAIKEAVRITTEDVPLRPNALN
FT                   VLTNENLGNLPIIHMETTEEKATRIAVLMKGGGSENCSALAMLTPAEGLDGLKRFVIEK
FT                   VAECGGKPCPPIILGIGVGGTAEKAMELAKRALLRRIGERNPNPQLAALEEELLKAVNS
FT                   LGIGPMGLGGKTTALDVKVEVAPRHPASFPVALAVQCWAHRRAFVEIKGGRVRVWQ"
FT   gene            567597..568124
FT                   /locus_tag="PYCH_06710"
FT   CDS             567597..568124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06710"
FT                   /product="fumarate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06710"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24359"
FT                   /db_xref="GOA:F8AIJ3"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIJ3"
FT                   /protein_id="AEH24359.1"
FT                   /translation="MRLKTPLSARDVLRLKVGDKVLLSGIVYTARDLAHKRIIKEGPPF
FT                   NPEGAVIYHCGPLIKDDRVISAGPTTSARMNIYLEEVLRMGIRGIIGKGGMMPEPFRGR
FT                   AVYFAFPGGAGSLAAEHVRRIKGVFWPELGMPEAVWALEVEDLPLLVAIDAHGRTLYRK
FT                   FTQELTSRPSQL"
FT   gene            complement(568087..568767)
FT                   /locus_tag="PYCH_06720"
FT   CDS             complement(568087..568767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06720"
FT                   /product="aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06720"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24360"
FT                   /db_xref="GOA:F8AIJ4"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIJ4"
FT                   /protein_id="AEH24360.1"
FT                   /translation="MKTIGILGGMGPLATAELFRRIVEKVPARRDQDHPKVIVISNPQI
FT                   PDRTAFILGYGEDPRPALVETAKRLEACGADFIIMPCNTAHAFIEDIQRAVKIPVVSMV
FT                   EETARKIAEMGVKRAGLLATTGTVVSRVYERALARWAVEVVVPDEEGQEKVMRAIYEGV
FT                   KAGNIELGRRLILEVARSLEGRVDCVIAGCTEVSLVLHDGDLSVPIVDPMDVIAERAVR
FT                   LALE"
FT   gene            complement(568764..569282)
FT                   /locus_tag="PYCH_06730"
FT   CDS             complement(568764..569282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06730"
FT                   /product="cobalamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06730"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24361"
FT                   /db_xref="GOA:F8AIJ5"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIJ5"
FT                   /protein_id="AEH24361.1"
FT                   /translation="MRVTTKTGDRGTTSLFGGDRVWKDSPIIEANGTIDELTSFLGEAR
FT                   HYLDDEMRVIIDTVQGHLYSIMAELGSKGRMKSVGDGEIKWLENVIAKYEPQVELRSFV
FT                   LPGGTLASAKLDVCRAVARRAERRVATVLREFGIGEKPLIYLNRLSDLLFLMARVIEIR
FT                   EGRLREVKL"
FT   gene            569389..573027
FT                   /locus_tag="PYCH_06740"
FT   CDS             569389..573027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06740"
FT                   /product="reverse gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06740"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24362"
FT                   /db_xref="GOA:F8AIJ6"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005736"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIJ6"
FT                   /protein_id="AEH24362.1"
FT                   /translation="MKAIYRGMCPNCEGRISDERLSMKNPCESCLDEPVGEQVYFDLIK
FT                   AVRDALKLKGTLKEWEEIYKLNKAVKDVEKFFEKATGFTFWSAQKTWVKRLVRGRSFSI
FT                   IAPTGMGKSTFGAFMAIYFAQKGKKSYIVVPTTPLVIQTVRKIRTMAERAGVEVNLAYY
FT                   HGNLKKKEKEDMLAKIRDGNFEILVTSSQFLATRFDELLKDKKFDFIFVDDVDAFLKAS
FT                   KNIDRSLILLGFTEDVIAKAWEIIKLKKQLAKLLQRGNIEDIERLNSQIERLEEEIEAF
FT                   RQKNNVGVLIVASATGSARGDRIKLYRELLGFEVGSGKSVLRNVVDSYLIPEKPVEDVV
FT                   AELLQKLGKGGLIFVPIDKGIEYAEKLTEFLKERGFRVELVSARSKKGLELFERGEVDH
FT                   LVGVATYYGTIVRGLDLPHLIRFALFTGIPKFRFSLDLEQPTIYRVLGLMSEIIEFLPE
FT                   EDRRTGEKLYSRLRKIIRNVPQFELMKIEEALAEGLPLEGFQNHVLEIFREAVEFLRRV
FT                   LKNEIVLKKIAEDPFLSLKREGDKWFIEIPDVRTYIQASGRTSRLFAGGITKGLSVLIV
FT                   DDEKVFNGLVRQMRWRFTEFKMIPFEELDLEEVLKEIDEDREKVKLVMEGKISAKVKDL
FT                   VKSALMIVESPNKARTIASFFGQPSKRRIGDLVAYEVSIGDRMLTILASGGHMFDLVTN
FT                   EGYHGVLIQKKEGRPFFIPVYDTIKRCRDCGHQFVDWEEKGACPRCGSKNVHDALENVK
FT                   AMREIAQEVDEILIGTDPDTEGEKIAWDIRNVLAPYAPVIKRIEFHEVTRPAILKALRE
FT                   ARDVNENRVNAQLVRRIEDRWIGFELSQKLWEVFENRNLSAGRVQTPVLGWVIQRYKEF
FT                   TESETDFLNITLENGLSITLEGAKGKVGEVIVEDVQVEERDVNPLPPYTTDTMLQDASR
FT                   ILGFSAPYAMQLAQDLFEAGLTSYHRTDSIHVSNTGIEIAKEYITQEIGEGYFQPRPWG
FT                   QEGAHEAIRPTRPIDTGRLIQLIRDGIITLPKNLTRDHFRLYDLIFRRFIASQMKAARV
FT                   LYEKAIINAGLGKAEVEGYLEVLFDGWSRIKPLPLKQLPKLEPGQRIKVKELKHWRAPK
FT                   VSLYTQGDLIALMKERRIGRPSTYAKIVQTLLQRGYVVETKGRKKLVPTEKGIKVYHYL
FT                   VSKYKDLVSEERTRQLEELMDMVEEARADYQEVLNDLYKEIQTYVR"
FT   gene            573204..573998
FT                   /locus_tag="PYCH_06750"
FT   CDS             573204..573998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06750"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24363"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR021586"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIJ7"
FT                   /protein_id="AEH24363.1"
FT                   /translation="MSKERMVELLQEHFELNLYEARAYVALVAFGVLTPAELASVSEVP
FT                   APRTYDVLRSLEKKGFAMSQPGKTNKYRPVHPANILEKFIEEWQERVKEELEAKKKAKE
FT                   ELLELMAPLIETEVPKYGVERVWVVRGIKNSTLKTKEMLEEVEKEILLADDGFIAVNLE
FT                   EDILAAADKGVKIKVVLTKSLLPRLKGSKLIEYAKKGKIEIRAIEKIDIPMLICDEEVF
FT                   FALEDIAARYFNYETQVWIKDYRIVELFKSKFNEYWDKGEKI"
FT   gene            complement(574065..575108)
FT                   /locus_tag="PYCH_06760"
FT   CDS             complement(574065..575108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06760"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24364"
FT                   /db_xref="InterPro:IPR027552"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIJ8"
FT                   /protein_id="AEH24364.1"
FT                   /translation="MEADRTVLGIPCGYSVRCAENKTIVILFLSLTLFSRAVVSVESGG
FT                   YVYNVRYSVISNGSDAFVPLLILTYEPYCPPLSGINCANATTGEVLGGNEYLFYFNDAQ
FT                   LYILNFTPAFRALYPNYSTLLDQFRALYHYTLRHSLNGARFINGSWYLDLTFYPPMTHV
FT                   YGIYRFNPSKFCIEPVNVRMRGFTLPSSVGGLALLSVLSKDCLLAVKNSEGWPLNDNPN
FT                   PGLPVGVTGRRPGLRAEPKLVTGVGDGPANRTASGEGLTRWNPRPSGRGGGQWFPDSVK
FT                   IANVTVCKTSADTSTKTVETNGTTYTTKMSPNTTKTPTNTKETKKGICGPGLISLLVVI
FT                   PLILRRR"
FT   gene            complement(575197..575610)
FT                   /locus_tag="PYCH_06770"
FT   CDS             complement(575197..575610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06770"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24365"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIJ9"
FT                   /protein_id="AEH24365.1"
FT                   /translation="MYTTIPFKRPDGGQRDQTLIPFKYSGVNSYYKGWIDGVLSVNNGN
FT                   LRGFYWSYESCLQTSNYGKNVSKEFIQYMYDYIHDHWLELIWIPATNDRGVSYLSNDAF
FT                   DGILKVGGYFDYVFVQPNYYQNKNCITNVPVLI"
FT   gene            complement(575931..576143)
FT                   /locus_tag="PYCH_06780"
FT   CDS             complement(575931..576143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06780"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24366"
FT                   /db_xref="GOA:F8AIK0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIK0"
FT                   /protein_id="AEH24366.1"
FT                   /translation="MKHLKVLKALENGPKTVEEIAEETGIGPMEVRRYLLRFAESGKVG
FT                   SYRKDGKLYWKLKERDELGEEFKYV"
FT   gene            complement(576140..576457)
FT                   /locus_tag="PYCH_06790"
FT   CDS             complement(576140..576457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06790"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24367"
FT                   /db_xref="InterPro:IPR009563"
FT                   /db_xref="InterPro:IPR022954"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIK1"
FT                   /protein_id="AEH24367.1"
FT                   /translation="MITDEEIRKIIAPLLLSGAKMLDKHCPKCGAPLFEKDGKVFCPVC
FT                   EYREKKRREEMRSVEEVLLEKLRELASSLPKDIEALERHLEVMEKLITVIERYRRLEGG
FT                   T"
FT   gene            complement(576454..577185)
FT                   /locus_tag="PYCH_06800"
FT   CDS             complement(576454..577185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06800"
FT                   /product="arginase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06800"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24368"
FT                   /db_xref="GOA:F8AIK2"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIK2"
FT                   /protein_id="AEH24368.1"
FT                   /translation="MVTLIALGEAPNREGVKYVGRLLVREGLVDDFRLVEALTLQGLPG
FT                   IPEDKCYIVGEHLATYGILKRVKPGRIISVDAHTDLMHDYLDHGSWLAYALEERVVERA
FT                   AVIGPVLMIPATEKSRLWTRRVRIYPAIPRSRKTGRGWRTYVNLRSHGVLGVVEDARRY
FT                   LGPAIYLTVDLDVLRPEYRIARFQHGELCLEELLELIEAIGEVFTVRAFDMAEISDRVK
FT                   KSQLGRRAVLEVFQALKEVIE"
FT   gene            complement(577201..578037)
FT                   /locus_tag="PYCH_06810"
FT   CDS             complement(577201..578037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06810"
FT                   /product="Met-10+ like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06810"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24369"
FT                   /db_xref="GOA:F8AIK3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="InterPro:IPR030867"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIK3"
FT                   /protein_id="AEH24369.1"
FT                   /translation="MRTQVIKPRIREILSRELPPELLEKLPKHWVRIGDVLLLPLRPEL
FT                   EPYKRRIAEVYAQVLGVKTVLRKGHIRGETRKPDFELLYGNDTITVHIENGVKYKLDVA
FT                   RIMFSPANVKERVRMAEVAKPGELVVDMFAGIGHLSLPMAVHKRARVIVIEKDPYTFRF
FT                   LVENIWLNGVQDLVTPYNMDNRNFPAENIADRVLMGYVVRTHEFIPKALSIAKDEAIIH
FT                   YHNTVPERLMPEEPFRTFRKVAGELGYEVEKLNELVIKRYAPGVWHVVVDVKVYKS"
FT   gene            complement(578018..578548)
FT                   /locus_tag="PYCH_06820"
FT   CDS             complement(578018..578548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06820"
FT                   /product="putative NTPase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06820"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24370"
FT                   /db_xref="GOA:F8AIK4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004948"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIK4"
FT                   /protein_id="AEH24370.1"
FT                   /translation="MRFFVSGMPGVGKTTLAKRIAEALREKGYSVGGMITEEVRSGGRR
FT                   VGFRVVALDTGEVGRLAYVGQGYPRVGKYVVDVEGLERVGVPAIRRAIESADVVIIDEI
FT                   GAMEFKSNEFVRVLGEALKAEKPLLATVHRRYVDRYRVLGEYYWLTPENRNSVFMEVLS
FT                   ALLRVLGNENAGY"
FT   gene            complement(578580..579296)
FT                   /locus_tag="PYCH_06830"
FT   CDS             complement(578580..579296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06830"
FT                   /product="iron (III) ABC transporter, atp-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06830"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24371"
FT                   /db_xref="GOA:F8AIK5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030286"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIK5"
FT                   /protein_id="AEH24371.1"
FT                   /translation="MPELSVEVSFSYGRKRILEGASFSARKGELLSIIGPNGAGKSTLL
FT                   KCIVGILRPTGRVSYDGVDLLALKPRERACYVAYVPQSSFPEFAFTVEEFVEMGTYATG
FT                   GDVRDALERVGLWERRGELITRLSGGEYQLALIARALAQGSDVLLLDEPTSHLDVNHAV
FT                   SIMELLEELKEEKVVVTVLHDLNLALQYSDRIVILREGRVFWEGRREELEENVLGAVYG
FT                   IPLRIREVEGRLVVVP"
FT   gene            complement(579289..580140)
FT                   /locus_tag="PYCH_06840"
FT   CDS             complement(579289..580140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06840"
FT                   /product="iron (III) dicitrate transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06840"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24372"
FT                   /db_xref="GOA:F8AIK6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIK6"
FT                   /protein_id="AEH24372.1"
FT                   /translation="MGSNAYIILKIRLPRVLLAYIVGFSLASAGTASQALFKNPLADPY
FT                   ILGISGGASVGAALAMVYAPKYVGLAALVGALLAVYIVYGLAKVDGHVPVDVLLLAGIA
FT                   LGFFSHALTSYILYVNREEIHAGILWLMGTFSLADWGKLAVMIGAVLVGFSLLMFSWRE
FT                   LNLLLLGEESVALGLDVNLYRKLVIAAISLLTGVAVANSGIIGFVGLVSPHVMRLIVGP
FT                   NHRRLLPAAALFGGVLMVLSDLISRVVIAPAEVPVGIITALFGAPFFTYLLVRRKRGEL
FT                   YA"
FT   gene            580169..582295
FT                   /locus_tag="PYCH_06850"
FT   CDS             580169..582295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06850"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06850"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24373"
FT                   /db_xref="GOA:F8AIK7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIK7"
FT                   /protein_id="AEH24373.1"
FT                   /translation="MEGLRDEKTSERGILTEPSERAIMREAMDSRMSVVVTLTFMLDKS
FT                   SMSLKGFSTTREQLLNDPAPIFMVVLVILRGKIVAGKVPRFKHRWFGILDVDVGGEIYR
FT                   LYMSGIAQWLVEGDEVEIHIKNPPRTVDGVRLLDFDDYELYKFYKGEKVKVWPLWVKTY
FT                   KAKRFSPLTGELLYTYEIRAREATYESDFEAIAELEQYHYASQKEKVALWRCEKCGMII
FT                   EANTRPPCPKCGSEKVHILEIKGSTPASRFLLLELVKREEYEPRVLAYVRIDPPIPLMH
FT                   RRLPDGSVDKNIREKVFPEDWLKPSFWPEKIMKELYEELKKKYPRKIARSLLWEKAKER
FT                   ALRESDTAGARIARVVVHPDYRSDGLGQLSVRAALEWIAERRIPEMRKKKHFVETIAQM
FT                   ARYNPFFEKVGFRFVWETASGRPVLIYPLTDEAAKYLDRYFREDPHAPKGPLWRPSYGK
FT                   VEPLSGPIVFRNVSKVFESELDIKGLPDDIQELLKAFGVRHRVIQRPVLRNLNFEIRPG
FT                   ELIAVVGASGAGKTTLLRLILGAAKGYWEEKYRPTSGEVKVPRNVRVSVLIPGEFEPSF
FT                   GSESILEHVYRKIKDLNAAVEVLNRAGLSDAVLYRARFSELSTGQKERAKIASLLAERP
FT                   NLLLIDEFAAHLDTLTAMRVARKVAEIIREAGITAVIITHRPEVVKALDPDRVLFVGYG
FT                   TAVMKKSEEVVDKR"
FT   gene            complement(582385..582777)
FT                   /locus_tag="PYCH_06860"
FT   CDS             complement(582385..582777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06860"
FT                   /product="CoA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06860"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24374"
FT                   /db_xref="GOA:F8AIK8"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIK8"
FT                   /protein_id="AEH24374.1"
FT                   /translation="MNPKEFKKIALVGASKNPAKYGNIILHDLLGKGFEVLPVNPNHED
FT                   IEGLKCYKSVKELPKDVDVIVFVVPPEVGIQVAKEAIEAGFKRLWFQPGAESEEIRELL
FT                   ESHGVEYSFGKCIMVETSDRKMFLEV"
FT   gene            complement(582884..583105)
FT                   /locus_tag="PYCH_06870"
FT   CDS             complement(582884..583105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06870"
FT                   /product="ThiS family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06870"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24375"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIK9"
FT                   /protein_id="AEH24375.1"
FT                   /translation="MKVVLILYGELALKFSPRSEVEVEEGTTIGELLRKLGISAEEHHI
FT                   LVNEKKVSEDHVLKEGDIVKLLPVVFGG"
FT   gene            complement(583131..585002)
FT                   /locus_tag="PYCH_06880"
FT   CDS             complement(583131..585002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06880"
FT                   /product="formaldehyde:ferredoxin oxidoreductase wor5"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06880"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24376"
FT                   /db_xref="GOA:F8AIL0"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIL0"
FT                   /protein_id="AEH24376.1"
FT                   /translation="MHGYTGKLIDVDLGTGKVKTVEIDEEMLRFYGGRGLGTYILWKEL
FT                   GERWEKVDPLGEENLLLILTGPLTGYYPGIKTSVVAKSPESNGVVGSVLSSEVGLELKA
FT                   SGYDGIIIRGKAKEPVYLFINDDEVEIRDASKYWGMGGIELHKTLLREVHDELRKKARL
FT                   RGVPKEPAMMYIGRGGEKKVRFSAIMSKLMHAAGYGGYGAVMGSKNLKAILVKGSGPLP
FT                   AVHDRDKVKAMLREFWRELFQMTTFRQWGTGAGGYSVGKDRSSEPIKNWQEEYHDDERI
FT                   SVVNFELKAWVKKYWADYGCPVNCMKISYLRYGEYKGAITDAPDYELMAYMGTNLGIFE
FT                   PEKIIYLSYLVDELGLDGINAGNVLGFAAELYQRGILTEEDIGFKLEWGDEKAFAKLLE
FT                   LIVERKGIGEILAEGTYRAALRISEMKGVDVLKYAVHVKGIGVGAHGVRSGLDYTKEIS
FT                   YAVSVQGGDHTATAGLPAKSYEGELVNAFYDSAVICMFTTKPGFEKIIEFGNAVTGFDL
FT                   TPEKWFNEVGLRIIHLQRILLLLGGPDVYWDPRKDDDNPQRFYEPLPSGPMKGKAPTME
FT                   DIMEKRKQYYAEIGYDENGIPREDVLEELGLGEAKREVRRIRKRLGL"
FT   gene            complement(585007..585528)
FT                   /locus_tag="PYCH_06890"
FT   CDS             complement(585007..585528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06890"
FT                   /product="4Fe-4S binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06890"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24377"
FT                   /db_xref="GOA:F8AIL1"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIL1"
FT                   /protein_id="AEH24377.1"
FT                   /translation="MSTEDRIWILVTPERCSGCRLCEVACSLEHEGVIWPEASRIRIYE
FT                   LLPGVNVPHTCVQCQDYPCVKACNFDALSVDEKTGAVLVDEEKCTTCGACVLACPGNVP
FT                   RIPVGKGSVVICDLCEGNPKCVEVCHEAGHDALTLVKGQYRSVYRTFAKDPVEKSIELA
FT                   RKLYGEEFLG"
FT   gene            complement(585535..586056)
FT                   /locus_tag="PYCH_06900"
FT   CDS             complement(585535..586056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06900"
FT                   /product="ferritin A"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06900"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24378"
FT                   /db_xref="GOA:F8AIL2"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIL2"
FT                   /protein_id="AEH24378.1"
FT                   /translation="MLSERMLKALNEQINKELFSAYFYLGIAAYFKDKGLEGFAKWMEA
FT                   QAEEELGHAMRIYDYVFNRGGKVELYEIEKPKQDFESPLKAFEAVYLHEVGVTQSIFKL
FT                   VELAQEENDHATYNFLQWFVEEQVEEEASTKAILDKLKIIGDNPQALFMLDRELGQRQA
FT                   KLGTLIQDKE"
FT   gene            complement(586094..586894)
FT                   /locus_tag="PYCH_06910"
FT   CDS             complement(586094..586894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06910"
FT                   /product="N-glycosylase/DNA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06910"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24379"
FT                   /db_xref="GOA:F8AIL3"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015254"
FT                   /db_xref="InterPro:IPR016544"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIL3"
FT                   /protein_id="AEH24379.1"
FT                   /translation="MTPDRFLGLDDNVARLKGILGKLGIECARTIEERVDLQFDALRNL
FT                   WKNLGDEEPFLKLVIANAVVSYQLSGKGEDWWWEFSQYFSKNPPRGSIAEAYARFLPQS
FT                   KTNRRLVGRKVARLRKLEPFLARLDLGRLRYYYRNMLSLQSNLANVLGTGKSTKTVVFA
FT                   VKMFGYACRITFGEFRPYPMEIPIPEDVRIRAYTRRFTREPPATFWSRIARDVGIPPLH
FT                   IDSILWPVLGGDERVIERLRRHCKKADLVLELANLGTNVNGQHP"
FT   gene            587131..587218
FT                   /locus_tag="PYCH_t75"
FT   tRNA            587131..587218
FT                   /locus_tag="PYCH_t75"
FT                   /product="tRNA-Leu"
FT   gene            587238..587546
FT                   /locus_tag="PYCH_06920"
FT   CDS             587238..587546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06920"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24380"
FT                   /db_xref="InterPro:IPR007355"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIL4"
FT                   /protein_id="AEH24380.1"
FT                   /translation="MSGKVYIKVYRVQGEVLLAACDEELLGKTFREGELRLDVKERFYK
FT                   GELVEVDALADFLKEATIANLVGERCVGKAIELGYVDEERVLRIQGVPHAQMAKMLW"
FT   gene            587553..588713
FT                   /locus_tag="PYCH_06930"
FT   CDS             587553..588713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06930"
FT                   /product="nonsense-mediated mRNA decay protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06930"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24381"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIL5"
FT                   /protein_id="AEH24381.1"
FT                   /translation="MRFCYRCGISEEEGGPLIDGLCQVCFRRENPILLLEPEKNTELCQ
FT                   NCGSYKKGGVWVDPQNYELPALIFEVAENTLIESLEECLVRVKDFEIVGWEDIEEREPP
FT                   VGRALVAFRPVDWHVDYFPAIIIYEVRAKARIHELQVEPHDETRRVTVYVRQTVCPRCQ
FT                   RFLAGYYEAILQVRVEGREFTKEEREEITRLVQAKVDEIMKRDRMGFIQDTIEKEEGID
FT                   FYMGSTSSARKLAQAIRERFGGTISEAYELVGLDRQTSKEIYRTSVTIRLPKFRKGDVV
FT                   GDKHGRVYVVERVDGKGLKLRNLEDWSEEHRDWRTVKRDGIDLVEHEERKALLMNLTPK
FT                   EAQFMDMQTYETFEIERPKMELEEGRVYRLIRVRGRYYVGFMGVSE"
FT   gene            588710..589021
FT                   /locus_tag="PYCH_06940"
FT   CDS             588710..589021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06940"
FT                   /product="periplasmic divalent cation tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06940"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24382"
FT                   /db_xref="GOA:F8AJ15"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="UniProtKB/TrEMBL:F8AJ15"
FT                   /protein_id="AEH24382.1"
FT                   /translation="MSMILVYTTFPDWESAERVVKKLLEERLIACVNLREHKAFYWWQG
FT                   KIEEDTEVGAILKTKEELWETLKARLEEEHPYTVPAIIRIDASDVNEPYLRWLFEETK"
FT   gene            589075..590259
FT                   /locus_tag="PYCH_06950"
FT   CDS             589075..590259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06950"
FT                   /product="mannosyl-3-phosphoglycerate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06950"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24383"
FT                   /db_xref="GOA:F8AIL6"
FT                   /db_xref="InterPro:IPR012812"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIL6"
FT                   /protein_id="AEH24383.1"
FT                   /translation="MLLEAPVYKEIFGAVKIYELQKVIKMDTETEEVPIYTITNVPREK
FT                   IYSTLGEMAIVVPMKDEKLHLVDGVLKAIPHKCPIIIVSNSKREGPNQYKLEVDLVRHF
FT                   YNLTHSKVIMVHQRDPGLAKAFKEVGYTDILDEKGNVRSGKGEGMLIGILLAKAIGAKY
FT                   VGFVDADNYIPGSVNEYVKDYAAGFLMSESDYTMVRLHWRHKPKVTKGSLYFRKWGRVS
FT                   EITNHYLNMLISEQTAFETTIMVTGNAGEHAMTMKLAEIMPFSTGYSIEPYEIVYLLER
FT                   FGRWENVEEFQDVFDRGIEIFQIETLNPHFHEDKGKEHVKEMILLSLTTIYHSKLASEN
FT                   LRKRILEDLREHGIIGPNEEPPKPTVMRPIKDIDVKEWMEVLENSAETLLRFEV"
FT   gene            590256..590987
FT                   /locus_tag="PYCH_06960"
FT   CDS             590256..590987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06960"
FT                   /product="mannosyl-3-phosphoglycerate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06960"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24384"
FT                   /db_xref="GOA:F8AIL7"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006381"
FT                   /db_xref="InterPro:IPR012813"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIL7"
FT                   /protein_id="AEH24384.1"
FT                   /translation="MRAIFLDLDKTLIGDDYSPELARPVVKALKRKGFIIVFNTSKTRA
FT                   EVEYYRQALGVEDPFIVENGSAIFIPKDYFPFPVEGREKGEYIVIELGMRYETIREALD
FT                   EIAQEYGLKYYGNSTIEEVVAFTGLPRDLAKLAVKREYSETVFRWTRDGWAELLKARGL
FT                   KVTRGSRFHTVTGNTDKGSAARVLLDLYLKVGPVESWAVGDGENDLPMFDVVDRAFIVG
FT                   DLRHSKAKNIPSIEKLLEVIG"
FT   gene            590984..592366
FT                   /locus_tag="PYCH_06970"
FT   CDS             590984..592366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06970"
FT                   /product="mannose-6-phosphate isomerase/mannose-1-phosphate
FT                   guanylyl"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06970"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24385"
FT                   /db_xref="GOA:F8AJ16"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F8AJ16"
FT                   /protein_id="AEH24385.1"
FT                   /translation="MKTLVLAGGKGTRLWPLSRELLPKQFIKLFDDRSLFQSTIERALL
FT                   FSKPKEIFIVTNREYRFRVFDELDELGIRVPEENVLLEPVGKNTLPAIYWGLKVIRENF
FT                   GRSVVAVLPSDHRIEVNESYMEAFKRAKKLAEEYLVTFGIKPTKPHTGYGYIRPGEKLE
FT                   GGYLVAEFKEKPDYETAKRYVENGYYWNSGMFMFSTEIFMEEARKHAPELVRAFEEAKT
FT                   IEEAYELAPETSVDYGILEKTDKAAVVPLNTYWNDLGSFDAIYEAMEKDKNGNAVRVKG
FT                   FKAKYINVDSRNNLIMTERLTATIGVEDLVIIDTGDALLVAKKGETQKVKEVFKRLKED
FT                   GDERALVHRTAYRPWGSYTVLEEGDRYKIKRITVLPGKKLSLQMHYHRSEHWVVVRGTA
FT                   KVIVGEKELILRPGESTFIPAGVKHRLENPGKVVLEVIETQIGEYLGEDDIVRFQDDYG
FT                   RE"
FT   gene            592369..592752
FT                   /locus_tag="PYCH_06980"
FT   CDS             592369..592752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06980"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24386"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIL8"
FT                   /protein_id="AEH24386.1"
FT                   /translation="MGERDGWERFSSGISSLSINLLSTLLFILVLSYVLTWGLKGAELR
FT                   IPVSGQVVTMKLPDIGVPMNVQAIRSLVIYLFGTILLGLPMPLFPEKLKPLKALVALLQ
FT                   AGTFVYALYVFVRAILDFAAMLA"
FT   gene            592763..594133
FT                   /locus_tag="PYCH_06990"
FT   CDS             592763..594133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_06990"
FT                   /product="phosphohexomutase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_06990"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24387"
FT                   /db_xref="GOA:F8AIL9"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIL9"
FT                   /protein_id="AEH24387.1"
FT                   /translation="MGKLFGTFGVRGIANEDITPEFALKLGMAFGTMLKRENPAKELWV
FT                   VVGRDTRVSGEMLKNALISGLLSVGVNVIDVGIAPTPAVQFACKHFRADGGAVITASHN
FT                   PPEYNGIKLLEPNGMGLKKEREAIVEEIFLKEDFDRAEWDEIGRVRREDIIRPYIDAIK
FT                   SKVDVDAIRKRKPFVVVDTSNGAGSLTLPYLLRELGCKVVSVNAHPDGHFPARNPEPSE
FT                   ENLKGLMKIVKALGADFGVAQDGDADRAVFIDENGRFIQGDKTFALVADAVLRERGGGL
FT                   LVTTVATSNLLDDIAKRNGAKVLRTKVGDLVVARALLEHAGTIGGEENGGVIFPDHVLG
FT                   RDGAMTVAKVVEIFAKSGKKFSELIDELPKYYQIKTKRHVEGDRKAVVAKVGELARRRG
FT                   YRIDTTDGVKVIFEEGWVLVRASGTEPIIRIFSEAKSEEKAQEYLELGLELLEKAME"
FT   gene            complement(594249..595139)
FT                   /locus_tag="PYCH_07000"
FT   CDS             complement(594249..595139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07000"
FT                   /product="Acetamidase/Formamidase family"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07000"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24388"
FT                   /db_xref="GOA:F8AJ17"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:F8AJ17"
FT                   /protein_id="AEH24388.1"
FT                   /translation="MILIPKEKHVYSFGPNMKPVARAKPGDIVVFETIDALGGQIKDES
FT                   DTIEKIDFSRVNPATGPLYVENAKRGKVLAVEILDIEIAGRGIVVTAPKAGVLGDKVEK
FT                   PRTRICEIKDGTVHFGNLKIPVKPMIGVIGVAYDEEIPTGTPGRHGGNMDTNLITKGTI
FT                   LYLPVFKEGGLLAIGDLHAVMGDGEVCVSACEVSGRVKVKVDVLDGVLEWPLLETADAY
FT                   YLLVSMEKLDDAIREGVELGVEALAKANGLEWDDAYMLASLVMDVEISQLVDPAKTIRV
FT                   RIPKEYVSLEAFFKG"
FT   gene            complement(595338..595598)
FT                   /locus_tag="PYCH_07010"
FT   CDS             complement(595338..595598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07010"
FT                   /product="uncomplete cobalt ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07010"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24389"
FT                   /db_xref="GOA:F8AIM0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIM0"
FT                   /protein_id="AEH24389.1"
FT                   /translation="MEIHADRETRELSFGEKKRVAIATVLAMGPEVIVFDEPFANLDFG
FT                   GKVLVENIIRELRTEGKTVILASHEAEYLMLCDRIAPMDGG"
FT   gene            complement(595610..596419)
FT                   /locus_tag="PYCH_07020"
FT   CDS             complement(595610..596419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07020"
FT                   /product="ABC-type cobalt transport system, CbiQ permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07020"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24390"
FT                   /db_xref="GOA:F8AJ18"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AJ18"
FT                   /protein_id="AEH24390.1"
FT                   /translation="MVFSLTLFNPGRPIVNTPLGPITHEGVRSFLLLLGKAFLSSGATV
FT                   VIVNSVGFSRILAEMEALKFSNIITLTLAFTYRYLDVFIGEAMRMKRALDSRAFGIGRL
FT                   EYYRKLGALIGEVFVRAYMRSERVYWAMLSRGFGEFPKVDEGAILYFAPYCPHLGGTAP
FT                   MIELRNVHFSYGGREVLRGVSLKIERGEVFGFLGPNGAGKSTLLFHLNGILKPKRGEVL
FT                   VEGLNPAKTRKKLGGRLAYQQFLRTWPLVPTTSASGEKSSGSGFSGP"
FT   gene            complement(596424..596582)
FT                   /locus_tag="PYCH_07030"
FT   CDS             complement(596424..596582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07030"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24391"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIM1"
FT                   /protein_id="AEH24391.1"
FT                   /translation="MYLPFIFIYAISVVTRKSLAELAYFTLLFGLVLAYDEAQEGDFTS
FT                   PRLSPRI"
FT   gene            complement(596584..596736)
FT                   /locus_tag="PYCH_07040"
FT   CDS             complement(596584..596736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07040"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24392"
FT                   /db_xref="UniProtKB/TrEMBL:F8AJ19"
FT                   /protein_id="AEH24392.1"
FT                   /translation="MEKVSLEEGPIYHAPLDYGETWGQGFAMGLLGILLTFAVGYGIGK
FT                   LAKGA"
FT   gene            complement(596828..597283)
FT                   /locus_tag="PYCH_07050"
FT   CDS             complement(596828..597283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07050"
FT                   /product="cobalamin biosynthesis protein m"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07050"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24393"
FT                   /db_xref="GOA:F8AIM2"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIM2"
FT                   /protein_id="AEH24393.1"
FT                   /translation="MVNFPIIGGVSGHLLGATLVAVLLGPYAAVIVMTAVLLIQTLLFG
FT                   DGGITALGANILNMGLIGAFIGYAIYSRLRGINEAFAMGIAAWTSVVLGAVMASIEIGV
FT                   SKSVPFLKVLTLMTGYHAVRGIGEAILTVLIAQAIRMKLPEVKGVPA"
FT   gene            597613..598980
FT                   /locus_tag="PYCH_07060"
FT   CDS             597613..598980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07060"
FT                   /product="AcdA-3 acetate--coA ligase (ADP-forming) , alpha
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07060"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24394"
FT                   /db_xref="GOA:F8AIM3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIM3"
FT                   /protein_id="AEH24394.1"
FT                   /translation="MLDYFFKPRSVAVIGASNDPKKLGYEVFKNLQKYGGNVYPVNVKE
FT                   EKVQGVKAYKSVKDIPGDVDLAIIIVPKKFVKQTLIECGEKGVKGVVIITAGFGETGAE
FT                   GKREERELVEIAHSYGMRIIGPNCVGIMNTHNDLNATFIMDAKKGSIAFISQSGALGAG
FT                   IVYKTVKEGIGFSKFISIGNMADLDFAELMEYLADTEEDKAMALYIEGLRDGRKFMEVA
FT                   KRVTKKKPVIVLKAGKSESGARAASSHTGSLAGSYRIYEAAFKQSGVIVAETIDEMLSM
FT                   ARAFTQPLPRGRSVAIMTNAGGPGVLTADEIDKRGLKLANLEEKTIEELRSFLPPMAAV
FT                   KNPVDMIASARGEDYYRTAKLLLSDANVDMLIAICVVPTFAGMSPTEHAEGVIRAVEEV
FT                   NNGKPVLALFMAGRVSEPAKELLERYGIPTYERPEDVAAGAHALVRQAENVGLLEK"
FT   gene            599032..600966
FT                   /locus_tag="PYCH_07070"
FT   CDS             599032..600966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07070"
FT                   /product="indolepyruvate ferredoxin oxidoreductase, subunit
FT                   alpha"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07070"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24395"
FT                   /db_xref="GOA:F8AIM4"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIM4"
FT                   /protein_id="AEH24395.1"
FT                   /translation="MAKVTDIVLWDKPGERVLLLGNQAIARGALEANIAVFAAYPGTPS
FT                   SELTDTMAAVAKRAGVYMEYSTNEKIAFETALSASWAGLRAMTAMKHVGLNVAMDSFMT
FT                   VSYMGVNGGLVVMVADDPSMWSSQNEQDTRAIGKFANVPVLEPASVQEAKDMTKYAFEL
FT                   SEKFGQMVILRTTTRTSHMRGDVVLGELPEEIKLGKRKFGDFKKDPERYVDIPAFQRKK
FT                   HAWLLETIEKIRKELENAPFNRIEGDGKVGIIAPGLAYAYVKEALAWLGVKNVRILKLG
FT                   SPFPVPYGLLEKFFDGLEKVLIVEELEPVVEEQVKVWAFDNGVDIPIHGKDLVPRVHEM
FT                   TTRRAVEAIAKFSHLKTPVNFAEIDERYKKVQEIVPPRPPSLCPACPHRNTFYAIKKAA
FT                   TPRAIFPSDIGCYTLGVLPPLKTVDTTIAMGGSVGVAHGLSVALNGAVSEEQRAEKKKV
FT                   IVATIGDSTFFHTGLPALANAIYNRSNVVIVVLDNLVTAMTGDQPNPGTGETPHGPGKR
FT                   ILIEEVAKAMGADFVEVVDPYDIKATYETIKKALEVEGVSVVVARQMCALHRIGQMRRK
FT                   GEKWPIYQVVEEKCTGCKVCINAYGCPAIYWDAEKKKARVDPLMCWGCGGCAQVCPFDA
FT                   FEPVKEGGA"
FT   gene            600963..601571
FT                   /locus_tag="PYCH_07080"
FT   CDS             600963..601571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07080"
FT                   /product="indolepyruvate oxidoreductase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07080"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24396"
FT                   /db_xref="GOA:F8AIM5"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR017719"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIM5"
FT                   /protein_id="AEH24396.1"
FT                   /translation="MREYNIVITGVGGQGVLTAANILGWAALRAGYKVRVGEVHGMSQR
FT                   FGSVIAYVRFGEDVYGAMVPEGKGDVILSFEPVEALRYINYLKKGGLVFTNARPIPPVQ
FT                   VSMGLAKYPSLDEIRRIVEEDFGGRFLAFDAEALAIKAGNVITTNVVLIGALTQTPGFP
FT                   LSADHVKEVIKVSVPPKAVEVNMKAFDLGVQAAREMLGL"
FT   gene            complement(601612..602055)
FT                   /locus_tag="PYCH_07090"
FT   CDS             complement(601612..602055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07090"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07090"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24397"
FT                   /db_xref="GOA:F8AJ20"
FT                   /db_xref="InterPro:IPR004645"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR018384"
FT                   /db_xref="InterPro:IPR029291"
FT                   /db_xref="UniProtKB/TrEMBL:F8AJ20"
FT                   /protein_id="AEH24397.1"
FT                   /translation="MVKTFLTDQQIKVLVLRAKGLRQSEIAEMLGTSRANVSILEKKAL
FT                   EKIEKARNTLLLWEQINSKIRVEVKKGEDVFEVPEKLFRKADEMGIKVPYSTAEIITFL
FT                   VEHAPVENRLVKRDFTLFLDSRNRLRISECILDDITIEGDRKG"
FT   gene            complement(602183..602260)
FT                   /locus_tag="PYCH_t80"
FT   tRNA            complement(602183..602260)
FT                   /locus_tag="PYCH_t80"
FT                   /product="tRNA-Arg"
FT   gene            602328..603047
FT                   /locus_tag="PYCH_07100"
FT   CDS             602328..603047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07100"
FT                   /product="thymidylate synthase, flavin-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07100"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24398"
FT                   /db_xref="GOA:F8AIM6"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIM6"
FT                   /protein_id="AEH24398.1"
FT                   /translation="MVDVRLINYTPRPLETITWAALISYWEEWESEAFERMSREDVERH
FT                   LPRILGYGHESILEHAVLTFAIEGCSRVCTHQLVRHRIASYTQRSQRYIVEDGVDFVIP
FT                   ESVGRAEREKLGKKVEEFLKLAGELYEELIRAGVPQEDARYILPQAVKTKIVVTMNLRE
FT                   LKHFFGLRLCERAQWEIREVAWKMLEEIAKREELRPIIRWAKLGPRCIQLGYCPEGELM
FT                   PPGCWKRTKEKWERMTR"
FT   gene            complement(603044..604324)
FT                   /locus_tag="PYCH_07110"
FT   CDS             complement(603044..604324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07110"
FT                   /product="transporter, major facilitator family"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07110"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24399"
FT                   /db_xref="GOA:F8AIM7"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIM7"
FT                   /protein_id="AEH24399.1"
FT                   /translation="MEAIENSRLNKFHYTLLVILGTVWAFIAVNTISAGFVIALLKNDP
FT                   AFQGSLTKLGSLGSAALFGMLFGAWLFGYLADRIGRKKTLTLAVATFSLASTVSSFAGN
FT                   LDALIILRFIVGLGLGGSLPVASSYFAEFMPKSVRGAMISVLESFWAIGTVIIGVVAIL
FT                   VKADWRGILLFGGAVILILPLLLTLPESPRYLLIRGRVKEAEETIRKALGVSVKLEAPK
FT                   GERKASVGDLWRRYGKTTLMLTIAWFSIAFAYYGFFIWLPRFLSATLGITVFRSFQYFI
FT                   ITAIAQLPGYWSAAYLLERIGRKKTLSYYLLLSGIAGVGFYFAANSGNETAIVASAVAF
FT                   SFFNLGAWGAIYAYTPELYPTAIRGTGTGWAGAMARIGGGLAPIVAGKIMEVSGVALAV
FT                   LVIAIVSIIGAIDVLALGEETMGKELA"
FT   gene            complement(604410..605732)
FT                   /locus_tag="PYCH_07120"
FT   CDS             complement(604410..605732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07120"
FT                   /product="zinc-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07120"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24400"
FT                   /db_xref="GOA:F8AIM8"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIM8"
FT                   /protein_id="AEH24400.1"
FT                   /translation="MFDVNEFILKKAKELGFGDVVVLSHEMNRRQIRFANNEITVAKNW
FT                   HERKVELFVELEKRVAGTTITELSEENIERTLKTLLSNMKGMSPKEDYYGIAEGPFQYR
FT                   DIPETFDKAIVELDELGEYVERAINAALEEGAKRVAGVLYTDHNRLYLTTSNGVEAFDE
FT                   GTGIEISVRAFIGDLESGHGTNSVRVLKKFDPESAGRKAGEIASLARNPEQGPEGKFDV
FT                   IFDPLAFANLLSYMSFMTSAYAAEAGFSFLVNKLNQKVASELVTIKDIGNLPNGYGSRK
FT                   FDDEGVPTRETTIIENGTFKTFLLNTSLAKKYGTETTANAGLIMPRAWNILLEPGDYTR
FT                   EELFEEVKRGIYITNVWYTRFQNYVAGDFSTIPRDGIFLVENGELRPIRNIRVSDNFQR
FT                   ILEGIKALGKESHHIHWWEVRTPVSTPYVLVKDVGITRATI"
FT   gene            complement(605743..607164)
FT                   /locus_tag="PYCH_07130"
FT   CDS             complement(605743..607164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07130"
FT                   /product="zinc-dependent protease, TldD/PmbA family"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07130"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24401"
FT                   /db_xref="GOA:F8AIM9"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIM9"
FT                   /protein_id="AEH24401.1"
FT                   /translation="MHDLVEFAVEKALELGASYAEARFEEKTGTSIAMKNGVPEGLSIL
FT                   ADKGIGIRVLVDGGMGFASTNVLTKESISEAVKKAVKLARAASKVRNEPIVFSEEDFHR
FT                   VSYKVKMKKDFRDFSPEEKLELLRKVEEEVKATGVNVPMRYLSYSDQLWKKVFLNSEGA
FT                   YVKSKIPRVSITYNLVVFENGQMEQAPFVQRAFSGGLELIEKDEPWSWAVKDVLALKKL
FT                   IYEGQKPPEGRVDLVISPEVVGIAVHESVGHPYEADRIFGREAAQAGESFVKPDMLGER
FT                   IGSEAVTVIEDPTIPNSWGFYLYDDEGVKARPRYLIKDGIITEFLTNREYAAKLGQRSN
FT                   ASARAINYNREPIVRMANTYLAPGDYSFEELIEDIKLGVYMVSFNEWNIDDRRYQQRYI
FT                   GREAYLIENGEIKHPVRRPILEITTRALWSSVDAVGKEVEFFPGTCGKGEPGQGVPVWM
FT                   GGAHARLRNIPLRRP"
FT   gene            complement(607225..608442)
FT                   /locus_tag="PYCH_07140"
FT   CDS             complement(607225..608442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07140"
FT                   /product="predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07140"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24402"
FT                   /db_xref="GOA:F8AIN0"
FT                   /db_xref="InterPro:IPR004751"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR022324"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIN0"
FT                   /protein_id="AEH24402.1"
FT                   /translation="MGRNFWLFAIGRFISQLGWAVQEVALPLYVLDKTHSGAMMSLFVL
FT                   ADVIPSLIFMPFAGVIGDRYNRKTLMVGLDLLRGVLLFGVITFDLLDIYELLAVQVVMA
FT                   IMGTFFGAATGAMFPDLVEERELERANSVVSSFSIVARLVGPALGGVIYAIGGIRLALL
FT                   INAVSFFGSGLFEAFIRYEWKTRQLESIRQVIEDIREGITFLRSSRYLMVLMSFALFMN
FT                   ALGQPFGMVLMPYAFREVLKFSSRQFGLLQSAFMGGMLLGNLLIAVKLKNPGRLFFKAL
FT                   AFNGAMMLVFIALISPYTNLSKWAAFFTLAGVAILWGASNAIINVPLNAKIQRAIPTEL
FT                   RGRVFSALALLINISAPVGLAVVGTLMKIFEAWEISLALWLLMSAVVAHYYFRHREVLL
FT                   NGSTHI"
FT   gene            complement(608521..609183)
FT                   /locus_tag="PYCH_07150"
FT   CDS             complement(608521..609183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07150"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24403"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="InterPro:IPR025386"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIN1"
FT                   /protein_id="AEH24403.1"
FT                   /translation="MKFENVREVEIRATNGRIEIEGWENDHVEVNYTVHGEANVEVEQK
FT                   GSKLIIREEPKKRRVLGLFEKSLGGWAEIEMRIPRSVLVRARNVNGELKARGACFGDVT
FT                   TVNGEISIENCEAEKLSSVNGGIRAHLTVAGPLQVKTVNGEIELTIEELEGDVEVSCVN
FT                   GDITLRLTEFCDARIIIKRVSGDVKFVGIDPDEPVIGTGEFRVKVSTVNGDVRVELI"
FT   gene            complement(609173..609829)
FT                   /locus_tag="PYCH_07160"
FT   CDS             complement(609173..609829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07160"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24404"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIN2"
FT                   /protein_id="AEH24404.1"
FT                   /translation="MRFEGIEKVWIKLIDTDVQILPSEDGTVHVYVEPEDAFTLKRDGS
FT                   TLKVLTSTGWKLKNLLKKEKERARLSMRIPDDFCIEGSMKRGSLKAKRTRFDSIAIGEA
FT                   TAELEECEVKSPSVGPSKVKGSMYIREEAEVTVSMGNLELKILELGGDLEVLAVMGSIT
FT                   LKLPEDCDAVIETVQQGGGVVVNSGRLLGSGDHRVKISSVKGVVIVDTWGELDEV"
FT   gene            complement(609861..611147)
FT                   /locus_tag="PYCH_07170"
FT   CDS             complement(609861..611147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07170"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24405"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIN3"
FT                   /protein_id="AEH24405.1"
FT                   /translation="MSLYYEESFLRFRIRDYLKGLTALLIVLWLFKGWLRLEAYNEYMV
FT                   WAIIALIVIIELLGVGRWFGVTVSGVIFALAKAAFLIAVFLFFGKWLGLPEGFPITAGT
FT                   AFAYAVVLAIAALLVAKFDKGEIKAKVESKAYEFTGAHFGNVELVGRGKAYPVKFGRRM
FT                   VGWVIDGSVEVVAETPLGTVRKKLIPPIAVWTSLSIVGKKTSPDPAFVEMANRLMHHDR
FT                   LYKKNKADTVVDLGFLKVYEGEDFEYVKLPFLEVIETPSGEEVRIGPIRIREGHPERPP
FT                   SEMLTIRELTNGFQLTKIGDRLRIQTEDYSIEVSGERVTYRSGGESLSLGKDHVSLKAG
FT                   DVSITVGRGRAKIRIEDVVISAKDGKVRIRVGGKIHTIEDAEACQLVIEKAKEIVEEQS
FT                   AELIEGLGVDRARLNKRVKELLEELMGHI"
FT   gene            complement(611144..611548)
FT                   /locus_tag="PYCH_07180"
FT   CDS             complement(611144..611548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07180"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07180"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24406"
FT                   /db_xref="GOA:F8AIN4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIN4"
FT                   /protein_id="AEH24406.1"
FT                   /translation="MEDLRAQLEELKRRLELLEKSIDPVDEIMLSIKALLRKRLETLPE
FT                   LDEEKSAKTLKALANPDRIRILKMLSERPMGFKEIKEALGVESPTVSHHLKLLKRTGMV
FT                   RSEDKYVITENGRLLLRLLTIITALGEVEE"
FT   gene            611547..611756
FT                   /locus_tag="PYCH_07190"
FT   CDS             611547..611756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07190"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24407"
FT                   /db_xref="UniProtKB/TrEMBL:F8AJ21"
FT                   /protein_id="AEH24407.1"
FT                   /translation="MLPPGTDFCSMIFCTYMGSKVYKKFTHHLVLHTTFDYSSPNSNQA
FT                   ISYFLIDILSLSFLSYYHLAMLFW"
FT   gene            612785..612946
FT                   /locus_tag="PYCH_07200"
FT   CDS             612785..612946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07200"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24408"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIN5"
FT                   /protein_id="AEH24408.1"
FT                   /translation="MGKILGVSVLSSKGTVTIPKKVREFLRLSRGDLVVFKLTDNGEIV
FT                   IKRGDNVE"
FT   gene            612936..613847
FT                   /locus_tag="PYCH_07210"
FT   CDS             612936..613847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07210"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07210"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24409"
FT                   /db_xref="GOA:F8AIN6"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIN6"
FT                   /protein_id="AEH24409.1"
FT                   /translation="MLSEKYNKIYHMDCLKGMRELLEDKEVDVVVTSPPYNIGIKYNKY
FT                   KDNIPREKYLKWIEKVGKEIKRVLKDDGSFFLNIGYTNKDPWIAWEVVFKLRKHFVLQN
FT                   VIHWVKSIAIQKEDVGNYPNILGDIAVGHYKPVNSKRYLSIMHEYVFHFTKNGDVELDK
FT                   LAIGVPYQDKSNIGRWKSAKKDLRDRGNVWFIPYETIKSKEKERPHPATFPTKLPEMCI
FT                   KLHGLHRTNLVLDPFMGLGSTAIAAIRLGVNYIGFEIDEYYIKIAEERIKREIEKIKAA
FT                   GHNIKDRRVTLDKYLNALKYMK"
FT   gene            complement(613904..615367)
FT                   /locus_tag="PYCH_07220"
FT   CDS             complement(613904..615367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07220"
FT                   /product="asparagine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07220"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24410"
FT                   /db_xref="GOA:F8AJ22"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:F8AJ22"
FT                   /protein_id="AEH24410.1"
FT                   /translation="MRGEGMCLVVGGLHLGREKLVRMMLTGKHRGPDSFGVWADGSVFK
FT                   SSNFSDLDDVPSGKIVLAQCRLAMTGSKDFTQPFYNDLVLVHNGEIYNHIQLRAYLVER
FT                   GHSFESDVDSEVILKLLEHLLFDKGLSVEEAVRKAMLMLNGDYAVAFFDGQRIYLFRDP
FT                   LGIRPLYYSPNGFFASEKKVLWAIGEEAIPVRPGELVEVAEGGIKRFQLVNPLSFSGKL
FT                   FTEERALKGILNVLPHATRIRTTKRTGVLFSGGLDSSLIALLAARYSDITLYAAGTEDS
FT                   PDIEGARRVADELGLPLKEFIFTREDVEEALPKVAFAIEEPNAVNLAIAIPIYFATLLA
FT                   REDGVKVLLSGQGADELFGGYAKYLQRPELMERDILEMGERNLARDDKVSMLNGVEVRY
FT                   PYLDPAVVRVAIRTPLELKIKEGIRKLILRRAAEQLGLPREVAWKEKKACQYGSRSQKL
FT                   LEKIAKARGTTLRGLAEMLFSETFQRSTA"
FT   gene            615503..616390
FT                   /locus_tag="PYCH_07230"
FT   CDS             615503..616390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07230"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07230"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24411"
FT                   /db_xref="GOA:F8AIN7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002468"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018349"
FT                   /db_xref="InterPro:IPR028595"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIN7"
FT                   /protein_id="AEH24411.1"
FT                   /translation="MEVEKFIEAGKIAKKVREEVVKLVKPGVKLIEIAEFVENRIRELG
FT                   GKPAFPCNLSLNEIAAHYTPYREDETTLREGDYLKIDIGVHIDGHIADTAVTIRVGMEE
FT                   DDLMVAAREALDNAIATVRAGVEISELGRAIEEAIRARGFNPIVNLSGHKIEPYKLHAG
FT                   ISVPNIYRPHDNYVLREGDVFAIEPFATTGAGQVIEVPPTLIYMYVRDAPVRMAQARFL
FT                   LARIKREFKTLPFAYRWLQGEMPEGQLKIALKQLEKAGAIYGYPILKEVRNGIVTQFEH
FT                   TVVVEKDGAIVTTE"
FT   gene            complement(616403..616488)
FT                   /locus_tag="PYCH_t85"
FT   tRNA            complement(616403..616488)
FT                   /locus_tag="PYCH_t85"
FT                   /product="tRNA-Ser"
FT   gene            complement(616521..617852)
FT                   /locus_tag="PYCH_07240"
FT   CDS             complement(616521..617852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07240"
FT                   /product="threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07240"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24412"
FT                   /db_xref="GOA:F8AIN8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIN8"
FT                   /protein_id="AEH24412.1"
FT                   /translation="MFTCPRCGREYSSVIPPFCVCGESLEIRYDYSAVDVRKWRRREKG
FT                   VWRYKELLPPVRRIVSLREGGTPFIKAKIGEKLGFDVFIKDETRNPTGSFRDRLATVSV
FT                   SYGLPYAGNGFIVASDGNAAASLAAYAARAGREAFVVVPKKVDKGKLAQMIAFGARIIR
FT                   YGESVDECIEYAKELAKLNGLYDVTPENNVIGLEGQKTIAFELWEEVNPTHVIVPTGSG
FT                   SNIYSIYKGFRELFELDLIGELPRLIAVQVDRCNPIAAEILGLKKNCGLTKALGLFVKE
FT                   PVMKEGAVEAVKKSEGTAVIVGEDELDLGERMLAAEGIFAEYASAVVMPALLKLAEDGY
FT                   FERGDRVVLVVTGSGLKGWSGERERFSIGGTKLEILRLLAEKEMYGYEIWASLERPLKY
FT                   QAVYQHMRELEALGLVEVAFKRGRRVYYRLTEKGRRLLENLEAP"
FT   gene            complement(617857..619803)
FT                   /locus_tag="PYCH_07250"
FT   CDS             complement(617857..619803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07250"
FT                   /product="mRNA 3'-end processing factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07250"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24413"
FT                   /db_xref="GOA:F8AIN9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR019975"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIN9"
FT                   /protein_id="AEH24413.1"
FT                   /translation="MIKRETRVDEILKEIREIVSQMVPKEAKITDIEFEGPELVIYVKN
FT                   PEAIMKDGELIRDLAKVLKKRISIRPDPEVLLPPEEAEKLIMEIVPKEAEITSVSFDPS
FT                   VGEVLIEAKKPGLVIGKNGETLRLITQKVHWAPRVVRTPPLQSQTIYSIRQLLQTESKD
FT                   RRKFLRQVGRNIYRKPEYKSRWIRITGLGGFREVGRSALLVQTDESYVLVDFGVNVAAM
FT                   NDPYKAFPHFDAPEFQYVLKEGLLDAIIITHAHLDHSGMLPYLFRYNLFDGPIYTTPPT
FT                   RDLMVLLQKDFIEIQQSNGQEPLYRPRDIKEVIKHTITLDYGEVRDISPDIRLTLHNAG
FT                   HILGSAIVHLHIGNGLHNIAVTGDFKFIPTRLLEPANARFPRLETLVMEATYGGSNDIQ
FT                   MPREEAEKRLIEVIHRTIKRGGKVLIPAMAVGRAQEVMMVLEEYARIGGIDVPIYLDGM
FT                   IWEATAIHTAYPEYLSKRLREQIFHEGYNPFLNEVFKPVANSRERQDIIDSNEPAIIIA
FT                   SSGMLVGGPSVEYFKQLAPDPKNSMIFVSYQAEGTLGRQVQNGAREIPMVGEGGKTEVI
FT                   KVNMEVYTIDGFSGHADRRELMNYVARVKPRPERVITVHGEPQKCLDLATSIHKKFGLS
FT                   TRAPNNLDTIRLR"
FT   gene            complement(619814..620428)
FT                   /locus_tag="PYCH_07260"
FT   CDS             complement(619814..620428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07260"
FT                   /product="proteasome beta subunit precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07260"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24414"
FT                   /db_xref="GOA:F8AIP0"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR019983"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIP0"
FT                   /protein_id="AEH24414.1"
FT                   /translation="MTEKFKGTTTVGIVCRDGVVLAADRRASLGNMVYAKNVTKIYQID
FT                   ERLAIAGAGNVGDILSLVRLLRAEVRLYRSRVGRSMSAKALATLLANILNGTRYFPYLV
FT                   WFLVGGYDDAPRLYSVDMAGGITEDKYVAAGSGMEFAFSILDSQYKPEMSVEEGVKLAV
FT                   RAINSAIKRDVFTGEGITVVTITEKGYRELSEEEVNTILKG"
FT   gene            complement(620507..621115)
FT                   /locus_tag="PYCH_07270"
FT   CDS             complement(620507..621115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07270"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24415"
FT                   /db_xref="GOA:F8AIP1"
FT                   /db_xref="InterPro:IPR007158"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIP1"
FT                   /protein_id="AEH24415.1"
FT                   /translation="MRVFIIKANEARTDATFSFKDLPGTSGRIDLLCRALNAAFHISHG
FT                   FRKNVRVWLSLYGPPNPPKAIRFEGQIMKPKTLNPDELSTAKLIARALKGAKGLREPSK
FT                   ELEVLPGIYVSNMTFEDIVRRTIKGATLYYLHEEGEDISKVKFSGNVAFVLGDHIGLPP
FT                   EDETFLRPIAKRVSVGPRSYLTSHVIAYVNIHLDRLGVL"
FT   gene            complement(621115..621702)
FT                   /locus_tag="PYCH_07280"
FT   CDS             complement(621115..621702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07280"
FT                   /product="membrane-associated metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07280"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24416"
FT                   /db_xref="GOA:F8AIP2"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIP2"
FT                   /protein_id="AEH24416.1"
FT                   /translation="MKTLLLFLLLLPIPYVAYFHGNFLPFPLGYLFLYVLVPFLAALIL
FT                   GFHPKDLGLSRGKREGYKLALILLLLSIPLSLAGTLIPEMRSYYPIFPYETPIEFIAGE
FT                   LKMALFMFAHEFFYRGVLLFPLARRNKWGTILAQNVPYTLVHIGKPAVEIPYAFVAGII
FT                   FADLDLRAESIFPSFLLHWLGSMIFDVMCGVM"
FT   gene            complement(621708..622604)
FT                   /locus_tag="PYCH_07290"
FT   CDS             complement(621708..622604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07290"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24417"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIP3"
FT                   /protein_id="AEH24417.1"
FT                   /translation="MDRFELLLKDLSLRLPEREIKRAGEVIKAFRELASIPISPINPSR
FT                   THPLVLLKKRLGGIDREVLVSPIELKIITKANMPPWHRVFEFHLDKHLVERTQIMGVPL
FT                   LLVGDERAVRLVKKILSNILPAMRERPRRISSFGNEIYMDFGGDRFVKLMMVGSTLELA
FT                   THNVPLSLLPRLLGRATFILDSMFHSKNAEFYRLLFAASLDTFGHFYEFFMRHVYPKLP
FT                   LEHREFLEEMHDYRNFLQLLYFHLSRINLDRIGNEVGIIIRRRSRPDRPLELAIVFREG
FT                   KVEVRDRVKRSQINLLV"
FT   gene            complement(622628..623437)
FT                   /locus_tag="PYCH_07300"
FT   CDS             complement(622628..623437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07300"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07300"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24418"
FT                   /db_xref="GOA:F8AIP4"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIP4"
FT                   /protein_id="AEH24418.1"
FT                   /translation="MKVQKGDVIRLHYTGRVKETGEIFDTTYEDVAKEAGIYNPKGIYG
FT                   PVPVAVGAGHLISGLDKRLEGLEVGKKYTIEVPPEEGFGLRDPRLVKVFTLGQFRRQGI
FT                   IPFPGLEVEITTEDGKKLKGRVLTVSGGRVRVDFNHPLAGKTLVYEVEIVEKVDDPIEK
FT                   IKALIELRLPMVDRDKIMIEVGEKDVKIDFGDQPVDRNTLILGEILLESDIKFLGYEKV
FT                   EFKPGMDELLKPPGTEGEASEEKEKAEGEPQEPTEEPQGEEAKPESS"
FT   gene            623532..624572
FT                   /locus_tag="PYCH_07310"
FT   CDS             623532..624572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07310"
FT                   /product="putative deoxyhypusine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07310"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24419"
FT                   /db_xref="GOA:F8AIU4"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="InterPro:IPR022899"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIU4"
FT                   /protein_id="AEH24419.1"
FT                   /translation="MKPKDIVLKESEEVGGTPIEGPWLDDVNTLEEVIEYYHRIGFQAT
FT                   HLGKAVEIWRKVEAKRAKGEEVRIFLGYTSNIVSSGLRELIAWLVKEGKVDVIVTTAGG
FT                   VEEDFIKTLKPFILGDWHVDDADLRRRGINRIGNIFVPNDRYIEFEKYMIPFFERVLEL
FT                   EKERGKPLTASELIYELGRYMDEKLGKEKEHSIIYWAYKRNVPIFCPAITDGSIGDMLY
FT                   FFKEERGDKELIIDIANDIVKLNNLAVTAKETASIILGGSLPKHAIINANLFRGGTDYA
FT                   IYITTAIPWDGSLSGAPPSEGVSWGKIKARADYVEIWADATLVFPILVWMVMKRKTSTG
FT                   ALEECQ"
FT   gene            complement(624543..625229)
FT                   /locus_tag="PYCH_07320"
FT   CDS             complement(624543..625229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07320"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24420"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIU5"
FT                   /protein_id="AEH24420.1"
FT                   /translation="MKKALVVLLVLLLALPPAVVYYGYSRFPAVLSPTDGPQAKDVIYV
FT                   PCHGKLIRFEVESYMAHSSGNFFKDLNWTVRFAHYKEPYKSITIIVGSTDFEECANVDK
FT                   ETCLLRTESAGDISGCIGAIATAPFYLQLVKELGNETEARLEASKKAMGITHNTYLTFM
FT                   QKVKLGLGIIGNDRNLVIILIGPKEGAKENKIYIPRDGVLVVEATGERELNCAVGALLT
FT                   LLKCPG"
FT   gene            complement(625275..627338)
FT                   /locus_tag="PYCH_07330"
FT   CDS             complement(625275..627338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07330"
FT                   /product="S-layer protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07330"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24421"
FT                   /db_xref="GOA:F8AIU6"
FT                   /db_xref="InterPro:IPR006454"
FT                   /db_xref="InterPro:IPR022650"
FT                   /db_xref="InterPro:IPR022651"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIU6"
FT                   /protein_id="AEH24421.1"
FT                   /translation="MKVKKIAALAVGAAMVGATLGAVSAQPEIGQLPAKDFFVKDGKPN
FT                   VKIVVGSGAAAEDVVAAADIALAIGSLLYTEEEVKASATAVFTEILPKTLETVPVYSFA
FT                   GNFTTETAAANALPNYWWNGADYAGTLDDWRNWWNTYDVKLDIGLREKILNEGDNPSSD
FT                   WSDKLDDVNPNAYVSVIIDKIDINLGPDENEPEWPDGDETITVPAGAFQYIVDYWQWSS
FT                   TTVVTVNIPDCCGLGGDYQEVTYYTLTDPGIEPGDSFTLLGHKYHVVCVYGTYTPGTPN
FT                   LASICPTCEATKAGDYVLLLADQTIEGEEGWVQVGDSLTIGPYKITVVDISPTGDKVLL
FT                   NVEDTTGQRPARQVTVALESTEIPQGVSVWGDYDGDGADDLVVALADSFIGLNTEPKVR
FT                   LVAYTNLKAVNEGDAWPTADWTVHFMGLVDYNADGGWIQDTAAEGLLDTSDDTTTYETY
FT                   YGFGWYTQNVANIINLPGTAYAKAVAKIKLVNADDIGGTTDIEIPTLDPIYRLHYAVDY
FT                   CGGQCTVEGNDYYGQYVYNIYAEIQIQQIANPDIMKLEVGDKLDVNGDYVPDYELTSAE
FT                   ATVTTYKIVKPSEGITVLDTDIQIPDDVNSNLIVVGGPVINKVAAALAEAFGVPTTYDE
FT                   WKSKYGTGKEAYVLKVAQIPGTDYEALLVAGTDREGTMEAAKYLLEYLANLS"
FT   gene            complement(627524..628330)
FT                   /locus_tag="PYCH_07340"
FT   CDS             complement(627524..628330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07340"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24422"
FT                   /db_xref="InterPro:IPR020292"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIU7"
FT                   /protein_id="AEH24422.1"
FT                   /translation="MLALRVIFYIEAIGNDKKAVETSISEIEKKLKDEKITLHRLEKGD
FT                   VIEVEEGPLKYSAMLEVELEGEFGKVVELIMKYGPTLVELVDIKGTEINAKELMETLGK
FT                   VSYFMGKLMKEFGGLAVYPSLEGIPEPRVGYSEDEIEEMILDEGMVRYQFVIKVYGNDY
FT                   KELESNIKKALSLEGCRINKFVLQPQGEFEVNGKKRVEALVAAELLSTFETLFVLTAKY
FT                   APIGIAIVEPQIVEPSPSEIQNALSDLAALINELVHRPLANLQFGE"
FT   gene            complement(628332..629378)
FT                   /locus_tag="PYCH_07350"
FT   CDS             complement(628332..629378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07350"
FT                   /product="pyruvate formate-lyase activating enzyme related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07350"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24423"
FT                   /db_xref="GOA:F8AIU8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIU8"
FT                   /protein_id="AEH24423.1"
FT                   /translation="MREAMYWEPLEGGRVRCRLCPLNCIIDDGQRGSCKIRKNIGGKLY
FT                   TLNYGKVSSVALDPVEKKPLFHFWPGSCAFSIGTVGCNMHCKHCQNWEISQGEERFPYL
FT                   EDATPEGLVAMAKHYGCENIAYTYNEPTIWYEFVLETARLAKREGLNNILVTNGYINEE
FT                   PFRELAPYIDAMNIDIKAFDDRFYMRIASVLGGEPSRRTAVIAKKEFGIHVELTYLIIP
FT                   TLNDEEGEIRAFARWVVENLGDDTPVHFSRFYPHYKLLHLSPTPLETLEKAYKIAKEEG
FT                   LKFVYLGNVPGHDGENTYCPRCGRIVIGRWGFAITEYHVKDGKCQYCGEPIPIVGRYLG
FT                   KSYRGMWW"
FT   gene            629426..630409
FT                   /locus_tag="PYCH_07360"
FT   CDS             629426..630409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07360"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07360"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24424"
FT                   /db_xref="GOA:F8AIU9"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIU9"
FT                   /protein_id="AEH24424.1"
FT                   /translation="MTKGIKDPRGKLSGIAMKIYVLGAGAIGSLFGALLARAGNDVLLV
FT                   GRRPHVEAIQRDGLKVIGVEEFTVDIDAAVEIPEEPPDLIVLATKSYSTAEALEAAKKA
FT                   IGERTWIMSIQNGLGNEEKALKYTKNVIGAVTTNGAMLEAPGRVKWTGKGITVLGLYPR
FT                   GRHPFVEEVKEEMRRAGLEAFVTENAAGWKWAKAIVNSAVNPIGALLEVKNGYLLENES
FT                   LLSIVMEVVKEGCRVALQNGIEFEVPPMELLFQTLERTRENYNSMLQDIWRGKRTEVDY
FT                   INGKIVEYAGAVGLEAPMNELLWALIRGKEALAAGGKNADTGRKGG"
FT   gene            630381..631025
FT                   /locus_tag="PYCH_07370"
FT   CDS             630381..631025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07370"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24425"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIV0"
FT                   /protein_id="AEH24425.1"
FT                   /translation="MPILGGKEDEVFEKIEEHVEVVGETLGALKELIRAYLDGDVESAE
FT                   KLVKAVEGKESQADELRREVELMLYGGAFIPANRGDYARLSELIDNVADAAESAAHVLI
FT                   FAKPDVPADLKMEIWELVEESLKTFDYLKEAVLSLNRDVDDALRLSKKTEEQEEKADKV
FT                   EYDLLRKIFESSTLSTYAKLIWNQVITKIGDVADRAEDASDQVMLMAIKRR"
FT   gene            631030..631950
FT                   /pseudo
FT                   /locus_tag="PYCH_07380"
FT                   /note="phosphoglycerate dehydrogenase (serA) / fragment"
FT   gene            complement(631956..633650)
FT                   /locus_tag="PYCH_07390"
FT   CDS             complement(631956..633650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07390"
FT                   /product="Alpha-amylase (intracellular)"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07390"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24426"
FT                   /db_xref="GOA:F8AIV1"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR015293"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIV1"
FT                   /protein_id="AEH24426.1"
FT                   /translation="MKGYFTFVLHTHIPYVRKHGKWPFGEEWLYEAIAESYLPLLMELE
FT                   RLKEKGIKFRLVIGITPILMEQLADGDIKAGFEEYMERKLKKMREDLEKFNDFKLKRAI
FT                   RFMIGYFEDVYDYWKKIEGDVIGKLRKLQDEGYVEVIASTATHGYLPLLERDEAIEAQI
FT                   VNGIATYEKHFGKRPKGIWLPECAYRPAGFWRSPSTGEVVWRKGLEEFLKKHGIEFFFV
FT                   ESHLIDEGPATQQYGVILPAKSRKSTLRPYFLKNGIAVFARNRETSMQVWSGDIGYPGD
FT                   FWYREFHKKAEGSGGQYWRVTGKHIDLAHKEPYEPEKALEKVEEHARHFVSLVKSLLEE
FT                   FERETGEKGIVVAPYDTELFGHWWFEGVKWLGRVLELMADEGIATTTISEFLNDYRGLR
FT                   YEIELPEGSWGMFGNHYTWWNPKVEWTWSHIHLAERRMVYLASKYLGEDRFGDRVLEQL
FT                   GRELLLMESSDWQFLITTGQAKEYGERRVLEHAHYFHRIANALEEYFETGDFREMELLE
FT                   ELEKMDNPFHPIILEPYVSEEPPEVPTYVEPPEVPTGGEEAEVGKNV"
FT   gene            633839..635785
FT                   /locus_tag="PYCH_07400"
FT   CDS             633839..635785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07400"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24427"
FT                   /db_xref="GOA:F8AIV2"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIV2"
FT                   /protein_id="AEH24427.1"
FT                   /translation="MKEAMTSVDIRYIVKELRELVGARVDKVYHEGNEIRIKFHKAGEG
FT                   RKDLIIEAGKRIHLTTYIKEIPTPTSFAMLLRKHLGGAFLSGIEQHDFDRIVKLSFRDY
FT                   TLVVELFGKGNLVLVGPDGLIIAALRYEEFRDRAIKPKVEYKFPPSRESPLEVSWERFR
FT                   ELVASDDSEIVRVLARKFSIGGLYAEEILLRAGIEKGRKARELTEDELRKIFETMKGLF
FT                   SAPKRPSIVYKDGQMVDVVPIELKWYDGYERKYFETFSEALDEYFGKLTVEKAKAEKTR
FT                   KLEEKRKALEISLERIREQMMAFEEEAKKNQELGDLIYANYSLVERLLEELRAAVKKLG
FT                   WEELERRVEEGKKTGNKAAEVIKGIHPSENAVTVEIDGKAIKLYLNRSLGENAELYYER
FT                   AKRAKAKLEGARKAYEETKIKIEELERLIEEEGKKVGVKKLERRKKKWFEKFRWFISSE
FT                   GFLVIGGKDATTNEMVVKRHMEENDIYCHADVYGAPHVVIKDGRKAGERTIFEACQFAV
FT                   SMSRAWGQGLYSADAYWVYPEQVSKKSPAGEYLPKGAFMVYGKRNWFHGIPLKLAVGVV
FT                   KYEGDELVMCGPVDAVKAHTNRYVVIRPGDLKKSELVKRIKKILEGWGYKVPEEDLMAI
FT                   LPPGGGEIVEVVG"
FT   gene            635782..636228
FT                   /locus_tag="PYCH_07410"
FT   CDS             635782..636228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07410"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24428"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIV3"
FT                   /protein_id="AEH24428.1"
FT                   /translation="MSLMKLYALARELARDLVFEIDGEVVTLSVKGVLLVKIPSDNYNF
FT                   SFFEVTEQEFILAIQMGGYMVYLGIEADDEVEEEAYPMVVRTLIAQLIPDVNALIREAK
FT                   KVKYAGPGDMLLDDNMSPDLKEAMYDILMRHRRGITPYEQVEVA"
FT   gene            636387..637136
FT                   /locus_tag="PYCH_07420"
FT   CDS             636387..637136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07420"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24429"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIV4"
FT                   /protein_id="AEH24429.1"
FT                   /translation="MEVRYSGPERYFPLINAHSNIIVDGLSSLGIKVEEVEVGARELAI
FT                   GGRLILHVVMEIKVNVEESGLMRSQLEKIVYPLVDRFREALKRELYPIGVVPYIRTEDI
FT                   RIVPLKKEVDKLGNVVVDAPPEFESAFRRYAQGIAIGLRERGIKFETLVVSVYEDGKRL
FT                   GLRVVLVPLKEFEGIEKTLRGLAEKYMGFLRYTLKNIKVSLDGVEVITSKIKPWPARIL
FT                   AQKERIIAQVDEIIEDEDVKSLMVKLR"
FT   gene            complement(637151..637984)
FT                   /locus_tag="PYCH_07430"
FT   CDS             complement(637151..637984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07430"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24430"
FT                   /db_xref="GOA:F8AIV5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIV5"
FT                   /protein_id="AEH24430.1"
FT                   /translation="MYIRPFDPWRSRLCTCPFKYTLNPYTGCDHACVYCYITGYIPKAF
FT                   RVRVKEDLLPKLEKELRRFDKRHIIALSYSSDPYPTIERELGITRKVLELFRRYDIRCL
FT                   LLTKSDMFERDLDILRELRCAIGITVTTADERKAKLLEPNAPPPKARIRALKKAWREGI
FT                   PVYARIDPVIPFYTWEDFDKTLDALSFVRHITVSTLKLRPDIRARMRAKFPELMEKLET
FT                   LYTERHEGYLYIRRDMRFKILEEARRKIEAKGITFGSCREGYYSWPTCDGSHLVP"
FT   gene            638041..638475
FT                   /locus_tag="PYCH_07440"
FT   CDS             638041..638475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07440"
FT                   /product="Osmotically inducible protein C-like protein
FT                   (OsmC)"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07440"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24431"
FT                   /db_xref="GOA:F8AIV6"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIV6"
FT                   /protein_id="AEH24431.1"
FT                   /translation="MTEVRGRVRWVEGEQFIGRIEDDKCSVILGEGGISPMKLLLLSVA
FT                   GCTAYDVVMILKKMRQPIEGLEVDIKGERREEHPRIYKRIHIHYRIYGNVDEDKARRAI
FT                   ELSQDKYCSASAHLKLSGAEVTYSYEIIPAAGEGIEAQDR"
FT   gene            638456..639112
FT                   /locus_tag="PYCH_07450"
FT   CDS             638456..639112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07450"
FT                   /product="Predicted zinc-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07450"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24432"
FT                   /db_xref="GOA:F8AIV7"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIV7"
FT                   /protein_id="AEH24432.1"
FT                   /translation="MRLRIGDVEVEYEVVLRPTRYVTIRVNPNGSLTVVSPVEGVDEIL
FT                   KRKARWIRRQLAVVEEGKRLASQGFPLFGRFYKPVRCERTGVEGESLCYSSLRALENFI
FT                   RNSLKERIGEIVEDVSGVLGVRPRKVFIRVMRTRWGSCSGRGNVAINLAAAALPFDLLH
FT                   YLVTHEVAHLISPRHDGEFWSAVAKLHPDYREKRGVLKVWWVVVHVHELWREVLG"
FT   gene            639109..639873
FT                   /locus_tag="PYCH_07460"
FT   CDS             639109..639873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07460"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07460"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24433"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIV8"
FT                   /protein_id="AEH24433.1"
FT                   /translation="MRIILLGSGSYSGTPKPFCGCENCTRARRFPIYRRTRFSLYLGKL
FT                   KAIVDPSPDLHYHLEHLNEKVEQVLITHPHFDHIAGVPELQIFEKLTFYSHEETLRVVK
FT                   WLQEAFVGEKRWEHVSLSFGEWKSFGNFNVLHFRTPHKPGDVAGGFVIEIGGKKIGITG
FT                   DTGPEILKDEKTLESLTDLDLLVVEMTHRESIPGTHLGVEDALRLVELTKPELAVFAHI
FT                   SHNNYPHEILERKVMERGIRGIVGRDFLHLDI"
FT   gene            complement(639870..640283)
FT                   /locus_tag="PYCH_07470"
FT   CDS             complement(639870..640283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07470"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24434"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="UniProtKB/TrEMBL:F8AIV9"
FT                   /protein_id="AEH24434.1"
FT                   /translation="MRVVRKELRFSTRGEIDLIDITDEVERFVAESEITNGQVLIFVPG
FT                   ATGAVVAIEHEEGLLEDFRRLLRELVPKEKGYLHGRIDDNAHSHLRATLLGPSLVFPII
FT                   DGELVRGTWQQIFFVELDTRPRKRKVILQAIGD"
FT   gene            complement(640295..641185)
FT                   /locus_tag="PYCH_07480"
FT   CDS             complement(640295..641185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PYCH_07480"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PYCH_07480"
FT                   /db_xref="EnsemblGenomes-Tr:AEH24435"
FT                   /db_xref="GOA:F8AIW0"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR019293"