Dbfetch

ID   CP001990; SV 1; circular; genomic DNA; STD; PRO; 164406 BP.
XX
AC   CP001990;
XX
PR   Project:PRJNA30165;
XX
DT   21-APR-2010 (Rel. 104, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Bacillus megaterium QM B1551 plasmid pBM700, complete sequence.
XX
KW   .
XX
OS   Bacillus megaterium QM B1551
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
OG   Plasmid pBM700
XX
RN   [1]
RP   1-164406
RX   DOI; 10.1128/JB.00449-11.
RX   PUBMED; 21705586.
RA   Eppinger M., Bunk B., Johns M.A., Edirisinghe J.N., Kutumbaka K.K.,
RA   Koenig S.S., Huot Creasy H., Rosovitz M.J., Riley D.R., Daugherty S.,
RA   Martin M., Elbourne L.D., Paulsen I., Biedendieck R., Braun C.,
RA   Grayburn S., Dhingra S., Lukyanchuk V., Ball B., Ul-Qamar R., Seibel J.,
RA   Bremer E., Jahn D., Ravel J., Vary P.S.;
RT   "Genome sequences of the biotechnologically important Bacillus megaterium
RT   strains QM B1551 and DSM319";
RL   J. Bacteriol. 193(16):4199-4213(2011).
XX
RN   [2]
RP   1-164406
RA   Eppinger M., Bunk B., Johns M.A., Edirisinghe J.N., Kutumbaka K.K.,
RA   Riley D.R., Huot-Creasy H., Koenig S.S.K., Galens K., Orvis J., Creasy T.,
RA   Biedendieck R., Braun C., Grayburn S., Jahn D., Vary P.S., Ravel J.;
RT   ;
RL   Submitted (05-FEB-2010) to the INSDC.
RL   Institute for Genome Sciences, University of Maryland School of Medicine,
RL   801 West Baltimore St, Baltimore, MD 21201, USA
XX
DR   MD5; a551028982974a98bd1402acd74de00c.
DR   BioSample; SAMN02603354.
DR   EnsemblGenomes-Gn; BMQ_pBM70123.
DR   EnsemblGenomes-Gn; BMQ_pBM70138.
DR   EnsemblGenomes-Gn; EBG00001189701.
DR   EnsemblGenomes-Tr; BMQ_pBM70123.
DR   EnsemblGenomes-Tr; BMQ_pBM70138-1.
DR   EnsemblGenomes-Tr; EBT00001768458.
DR   EuropePMC; PMC3147683; 21705586.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
DR   PubMed; 11251820.
DR   PubMed; 14602653.
DR   PubMed; 15933003.
DR   PubMed; 21705586.
XX
CC   Bacteria available from the Bacillus Genetic Stock Center,
CC   (http://www.bgsc.org/), The Ohio State University, 776 Biological
CC   Sciences Building, 484 West 12th Avenue, Columbus. Ohio 43210 under
CC   inventory No. 7A116 or from Patricia S. Vary (pvary@niu.edu), Dept.
CC   of Biological Sciences, Northern Illinois University, DeKalb, IL
CC   60115.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..164406
FT                   /organism="Bacillus megaterium QM B1551"
FT                   /plasmid="pBM700"
FT                   /strain="QM B1551"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:545693"
FT   gene            1..1287
FT                   /locus_tag="BMQ_pBM70001"
FT   CDS             1..1287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70001"
FT                   /product="replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70001"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72543"
FT                   /db_xref="GOA:D5E418"
FT                   /db_xref="InterPro:IPR009428"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D5E418"
FT                   /protein_id="ADE72543.1"
FT                   /translation="MTKLFTCYLEDVNTFNGRFTWLWKEKTTLRKRKEVFLETLRTYFK
FT                   QQQVALHKVFPKKRMEMLDYVIYNLVATGIQAIHSKTLMQKFDVSQSTVSRFVKSLKET
FT                   PFMIVARYIKEDTTGAHPDSYVFILKSHKNFDQICDEIFFDHDTTGVQTLQQEEMTTPV
FT                   TTPVTSPESAENVDITSFEDEKTSSPFINLDLPVNHINNHLISASQSFAYIKGVPKKVN
FT                   HVYASKYGHQLKDFYARIQNAAKAVKRDTEIEIIKEQVHEVAYTAIVGLDKYVHEANHK
FT                   GTPLSLDDMCRLVYQIAYNQFTNLLKGNTEEQSSKSDIHTEAKTAALFTPKHIIRKELV
FT                   PAWLKAEQEQKESTQETAISLDQQLEMIQLKQDLGQELTPEEENLLQEHSTTYSSLEMA
FT                   QLKQDLGQALTPEEQALLHEHTQLQDTVS"
FT   gene            1395..2120
FT                   /locus_tag="BMQ_pBM70002"
FT   CDS             1395..2120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70002"
FT                   /product="plasmid stability protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70002"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72544"
FT                   /db_xref="UniProtKB/TrEMBL:D5E419"
FT                   /protein_id="ADE72544.1"
FT                   /translation="MPHKMTLTGSATGPLREYDRYVAFDMREKGSPSAPKGLKKSTFIS
FT                   YTVFVAKKAFNKTGLTKKSIMHEKILIQGEPTLDIPIDECPGEIGIICFQITVLPNKND
FT                   KETNDSKDKKEAKQEVSKAQQEVAATKQEEKQAPVSQPVAKEEKKAAPQQKQLSTQPKG
FT                   TQDVVSFEEIIVPEAFLKTRPNPEKTQKVIDFVKRTGYLDEPLTIEKGSKILKDGYRRY
FT                   IVAKTVKMDKVPVVYAYEK"
FT   gene            3100..3705
FT                   /locus_tag="BMQ_pBM70003"
FT   CDS             3100..3705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70003"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72545"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D5E420"
FT                   /protein_id="ADE72545.1"
FT                   /translation="MDNAFEVEVGKSKYKKPSEVAKIFDMPESTLRKYSRVLEEAGYVF
FT                   RKGEKRMRLYSPADELVLYKMLKRIKEEDEGLAKAAAFAIEGQDSKVTDTDLIQSVSEE
FT                   VAATVQEESLKPFLEQVINKLTYIEENTVSKQEFNELVKLMQKALDENVELRRQNKEKE
FT                   DQLDFMSEKFDRVINLVERNEREKDTKKKGFMSRWFSS"
FT   gene            4556..4777
FT                   /locus_tag="BMQ_pBM70004"
FT   CDS             4556..4777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70004"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72546"
FT                   /db_xref="GOA:D5E421"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5E421"
FT                   /protein_id="ADE72546.1"
FT                   /translation="MPKITKKSKLGKYLIEKGYTQTKTVKATNLERSTVSKIYNDSNYI
FT                   PSGSTIKKVMNILKKLDPKLKAEDFFNI"
FT   gene            complement(5034..5702)
FT                   /locus_tag="BMQ_pBM70005"
FT   CDS             complement(5034..5702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70005"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72547"
FT                   /db_xref="InterPro:IPR024976"
FT                   /db_xref="UniProtKB/TrEMBL:D5E422"
FT                   /protein_id="ADE72547.1"
FT                   /translation="MNYDILHSFLEKHFERLTLSPSLFYSWKNSIRFEISNPLIPYYKR
FT                   EHLEQAFYRSVRLFEAVFREEDEILFVTDVHSMKKDLFLQKRPLNVYSKYIKNKEKLYQ
FT                   LSHQLLPSVFDGEENDDDQSVTHRFVLSCKKPELKYVQLLKAICYEDFTHPSTILKNNP
FT                   QSGYDIYFVNLSKEIIFHLYDDRGCDVLASNKKSIKFLYEEYNHWILDYDREEIDRLFK
FT                   "
FT   gene            complement(6091..6327)
FT                   /locus_tag="BMQ_pBM70006"
FT   CDS             complement(6091..6327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70006"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72548"
FT                   /db_xref="GOA:D5E423"
FT                   /db_xref="UniProtKB/TrEMBL:D5E423"
FT                   /protein_id="ADE72548.1"
FT                   /translation="MLIIIRNSLIIAVCLYLASVFLPEVMNVNETVAKYLFVIPVGIWG
FT                   IKSKNKWWINLISFLLALIILIFSLDLLPESML"
FT   gene            complement(6422..7114)
FT                   /locus_tag="BMQ_pBM70007"
FT   CDS             complement(6422..7114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70007"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70007"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72549"
FT                   /db_xref="UniProtKB/TrEMBL:D5E424"
FT                   /protein_id="ADE72549.1"
FT                   /translation="MSFRLSQRDKDIIAFINQFRAVDRDSLVDLFFKQLKSPVNACNSV
FT                   MVRLYRLGLIERTQQYSPTVYLPVDAKIKKNSQKILHFLSILDVYKQMCTYSIPKQVIV
FT                   EDKPTGRKGGIEPDLFCIFKGSPFWIEIQRNQYSEQKTQDKIHLYEEFFFSDEWKTLHW
FT                   QPEDRAAIFPSVMVITPVRYAVTSEHIRIIQVSSIHELMEKYKGPVKQQKESRIKNNSS
FT                   NGIKINLT"
FT   gene            complement(7111..8244)
FT                   /locus_tag="BMQ_pBM70008"
FT   CDS             complement(7111..8244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70008"
FT                   /product="DNA segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70008"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72550"
FT                   /db_xref="GOA:D5E425"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E425"
FT                   /protein_id="ADE72550.1"
FT                   /translation="MFEKLKLRGKLIKAFRTAEIYRVIKRGDHTSYQFPKIHRIDHQHT
FT                   YTRYAFSLLNGIDPELLNKKRWALRQVLGSNIEVNGSLKNFSITVHHKSLPKMLNYRYE
FT                   VIHPHIEKMELPVCIGQDIYGNFVSWDFADLETLLISGEIGAGKSSLMRVILTTWVKYT
FT                   SPDDLRLVLVDLKRADLGLFHGIEHVDALCFEAKDMRKPFALLRAEMYRRGDLLLEHGV
FT                   THISRLPFKLPRIVVVVDEMSIIKRETDLVEIIQQFASQGRALGVHTIIAMQRPDADLL
FT                   NSALKANLRVRISGRQADAINAKVAGVVGAEEIDAAARGRMKIKIDEVKEFQAFFLDEG
FT                   ACKEILSPYKALVHDPEPDIEVAPQSIFGLLEKEEQR"
FT   gene            complement(8257..8556)
FT                   /locus_tag="BMQ_pBM70009"
FT   CDS             complement(8257..8556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70009"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72551"
FT                   /db_xref="GOA:D5E426"
FT                   /db_xref="UniProtKB/TrEMBL:D5E426"
FT                   /protein_id="ADE72551.1"
FT                   /translation="MRRTKGFTFRKIFLPPHKLSLTRPRPFKAYSFVPFSPLAMLDPTI
FT                   LILGGIVLAVAFIEQILERLGVIDLADQFEKVMRVILPVTFYGALFYFFATFMF"
FT   gene            9163..9723
FT                   /locus_tag="BMQ_pBM70010"
FT   CDS             9163..9723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70010"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70010"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72552"
FT                   /db_xref="GOA:D5E427"
FT                   /db_xref="UniProtKB/TrEMBL:D5E427"
FT                   /protein_id="ADE72552.1"
FT                   /translation="MFSPPKNIKIQIDEKYRMLDDAHTKLTEIWVDNIVFSFGWWTSLF
FT                   MTIIPWLIWFIFRNKESKTRLLLGGLWAMFISTWLDYVGVTMGFWRYYNKLIPLMPDYI
FT                   SWDFALMPVTIMFFLQVKPKANPFIKALIFASMTAFLAEPLFLWLGYYHYPGWNSILSF
FT                   PFFIVIYLIAHYLVNSEATKPLK"
FT   gene            9923..10024
FT                   /locus_tag="BMQ_pBM70011"
FT   CDS             9923..10024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70011"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72553"
FT                   /db_xref="UniProtKB/TrEMBL:D5E428"
FT                   /protein_id="ADE72553.1"
FT                   /translation="MKWTRDPKMSQGLKLNVIIKKELTIECQFPCIV"
FT   gene            complement(10031..10516)
FT                   /locus_tag="BMQ_pBM70012"
FT   CDS             complement(10031..10516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70012"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72554"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="UniProtKB/TrEMBL:D5E429"
FT                   /protein_id="ADE72554.1"
FT                   /translation="MVLIERVGEMRDIWDDGYSQSKKLTEEMVKDAEKKLGVKLPKSYI
FT                   ELCKMQNGGSLKYCDYPTPVPTNWADDHVNLPEIYGIGKEGILSSDYYIEEWELPKDIV
FT                   LLCGEGHWWVAFDYRNTKDNPPVIYMDLEWGTDTLIFELAPDFETLVNGLFIYEDEK"
FT   gene            complement(10517..10693)
FT                   /locus_tag="BMQ_pBM70013"
FT   CDS             complement(10517..10693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70013"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70013"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72555"
FT                   /db_xref="UniProtKB/TrEMBL:D5E430"
FT                   /protein_id="ADE72555.1"
FT                   /translation="MEAKEQQEIDLDKVYDYAEFPDKVSGRCNNCNSAYFKSSVKGGVF
FT                   LRECRECGMKKSI"
FT   gene            complement(10757..10966)
FT                   /locus_tag="BMQ_pBM70014"
FT   CDS             complement(10757..10966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70014"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72556"
FT                   /db_xref="InterPro:IPR014962"
FT                   /db_xref="UniProtKB/TrEMBL:D5E431"
FT                   /protein_id="ADE72556.1"
FT                   /translation="MEQINFILIEALHTNKQVYLTYYKKGQCITEKGFIQFVDFLGNLF
FT                   VFIDEVFELKNKMRLSELIDVHFT"
FT   gene            complement(11215..11760)
FT                   /locus_tag="BMQ_pBM70015"
FT   CDS             complement(11215..11760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70015"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72557"
FT                   /db_xref="GOA:D5E432"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D5E432"
FT                   /protein_id="ADE72557.1"
FT                   /translation="MSTKVEILMHPVRIKICQALMRNRENGLTPLEMVKILKDVPQATL
FT                   YRHLQIMFDSGIVCVIKEKKVKSVSEKYYAINEEEAKIDGSEWRELSSKEKLDYISYYQ
FT                   LSLMTQYQSYLKKLGEQNSQEDGATFSVVELQIDEEHFTQFQNELNELMTKYYHNQSKG
FT                   NEKEAPVRTIAITIIPET"
FT   gene            11886..12125
FT                   /locus_tag="BMQ_pBM70016"
FT   CDS             11886..12125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70016"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72558"
FT                   /db_xref="GOA:D5E433"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D5E433"
FT                   /protein_id="ADE72558.1"
FT                   /translation="MKLHYGLNDLKDLDFMAFLPVILPVIALGTLLVLIALIDLYRNRK
FT                   RRENVLIWALIILFVNTFGPILYFVIGRKDGENS"
FT   gene            12122..13027
FT                   /locus_tag="BMQ_pBM70017"
FT   CDS             12122..13027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70017"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70017"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72559"
FT                   /db_xref="GOA:D5E434"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E434"
FT                   /protein_id="ADE72559.1"
FT                   /translation="MKLEIINVTKSFKEKIVVNNFSLELKSGECVGLIGPNGAGKSTLI
FT                   KMISDIIDPNAGEVLLNGKKISKMKREIGYLPQYPNFFYWMTARETLMFMGQLSGVKKE
FT                   VLTNSIPEILTKVGLKAEENSKVGTFSGGMKQRLGIAQALLHKPSLIVMDEPVSALDPI
FT                   GRREVLNLIEEIKKDTTILLSTHILSDAEEICERFAIMKDGTKIEDTKITDLLNRNSEN
FT                   KLIVEITAKDRKWVDTIKKLPYVKDIEVVGLKVKVKVESIEENKASLLQNALEHKVDIV
FT                   KFEMNNDTLEEIFLKLVGQK"
FT   gene            13024..13812
FT                   /locus_tag="BMQ_pBM70018"
FT   CDS             13024..13812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70018"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70018"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72560"
FT                   /db_xref="GOA:D5E435"
FT                   /db_xref="InterPro:IPR025699"
FT                   /db_xref="UniProtKB/TrEMBL:D5E435"
FT                   /protein_id="ADE72560.1"
FT                   /translation="MKNLIVLIKKEYVQMLRDFKVIWLPIVFIFLGAAQPVLTHYLPAI
FT                   LKALGGSQGITIDPSMTAQKGGEVLASTLGSQFDQLGLMILAISMMGIIQTDKANGMLA
FT                   FILTRPVTVPSYIGGKMVSNYLMAAFSVTIGYFTSYLYVNYLFTAVPFSQMITGLIFYL
FT                   VWILFIVSFTTMTSAIFHSQGIIALISIVFLIGCRIIVGLNPIVDQLNPASMSKHAMET
FT                   LMTGLVDSNAVGNLLLTFVWILLTLFITNYWISNKKFSHE"
FT   gene            complement(14059..14445)
FT                   /locus_tag="BMQ_pBM70019"
FT   CDS             complement(14059..14445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70019"
FT                   /product="hydrolase, NUDIX family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70019"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72561"
FT                   /db_xref="GOA:D5E436"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D5E436"
FT                   /protein_id="ADE72561.1"
FT                   /translation="MKKVTAAIIKDKNRILIAKRHSKDPLGGKWEFPGGKVEPGETPEE
FT                   CLVREIREELRVEVKIGSFYDNSVYSSQDHDIHLLFYWAEVSNGEMTPVVHDDLKWTTI
FT                   KQLANFDFAPADIPIVKRLMKENT"
FT   gene            14729..15655
FT                   /locus_tag="BMQ_pBM70020"
FT   CDS             14729..15655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70020"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70020"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72562"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D5E437"
FT                   /protein_id="ADE72562.1"
FT                   /translation="MNYFLVFQNKSYEEERKGGYLWAPQKNKNGQTFHHWTDMTLIRKG
FT                   DIIFNSFNGKLVSVLTAQANCQEHERPTGLEQLDLWERDGWLVDVEYSDLEQPITYKKY
FT                   MEGILKLQDNKYAPFNKSLRGNTGYLFRVSKELANFFFEIIEATNPFLRKKLQTEDNLQ
FT                   LENIKQIENDLNSIIILEKTEKETIIKSRIGQSAFKKALLTIEKKCRLCGVRDERFLVA
FT                   SHIKPWSESNNQERLDVDNGLLLCPNHDALFDKRYISFDETGKIMVKQSLEATTKMFLN
FT                   INDTMRIKLNERQQNYMKWHREKFSEN"
FT   gene            complement(16123..17028)
FT                   /locus_tag="BMQ_pBM70021"
FT   CDS             complement(16123..17028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70021"
FT                   /product="HTH-type transcriptional regulator gltC"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70021"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72563"
FT                   /db_xref="GOA:D5E438"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D5E438"
FT                   /protein_id="ADE72563.1"
FT                   /translation="MDFRQIRYFMEVATREHVTEAAHSLHVAQSSVSRQIVNLENELEV
FT                   DLFIREGRRVHLTPIGKIFFERMKHAMNVIDDARREVKEYLDPEKGTIRITFPISLAAY
FT                   TLPTVIYAFRLRYPEAKFQLKQALYHELIEGVIKGDFNLGLIGPLPLKEKRLQQKILFT
FT                   ENIVALLPIHHRLAKESSVKLQELVEEPFVLLPEGFVFRDIVVNACQNLGFTPNVAFEG
FT                   DDIDALKGLVSAGLGVTLMPEVTLVDSLPRSTVKIPLVEPNVTRSVGVITPKERELLPT
FT                   EKLFYDFLQEFFTRLDDFKS"
FT   gene            17198..18580
FT                   /locus_tag="BMQ_pBM70022"
FT   CDS             17198..18580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70022"
FT                   /product="glutamate/leucine/phenylalanine/valine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70022"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72564"
FT                   /db_xref="GOA:D5E439"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="UniProtKB/TrEMBL:D5E439"
FT                   /protein_id="ADE72564.1"
FT                   /translation="MITIEKNQSTYTESVQNYVNQVFETVKKRNPNESEFHQAVKEVFD
FT                   SLIPVLVKNPQYINQAILERIVEPERVISFRVPWVDDQGNVRVNRGFRVQYSSAIGPYK
FT                   GGLRFHPSVNASIIKFLGFEQIFKNSLTGQPIGGGKGGADFDPKGKSDGEIMRFCQSFM
FT                   LELSKYIGPDTDVPAGDIGVGSKEIGFLFGQYKKIRGNFEAGVLTGKGLGYGGSLARKE
FT                   ATGYGTVYFVEEMLKDNNLSFEGSTVVVSGSGNVSIYAIEKAIQLGAKVVACSDSNGYI
FT                   YDKNGLNLETVKRIKEIEKKRISTYVTDHPEAIYVESCNGIWTIPCDIALPCATQNEID
FT                   QNSAELLVSNGVKAIGEGANMPSTLEAVEIFLENNILFSPAKAANAGGVSVSALEMAQN
FT                   STRLSWTFEEVDSKLHAIMKSIYQNSKKAAQEYNAPGNLVVGANIAGFIKVADAMIEQG
FT                   VI"
FT   gene            18637..18918
FT                   /locus_tag="BMQ_pBM70023"
FT   CDS             18637..18918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70023"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72565"
FT                   /db_xref="GOA:D5E440"
FT                   /db_xref="UniProtKB/TrEMBL:D5E440"
FT                   /protein_id="ADE72565.1"
FT                   /translation="MGDLCIVSIIIIASLIVLSYALSRKKPTIKYIAPLIVGVISVGGV
FT                   IISFLIGGGTGMSVGTISFTAFISSLISLLIISIAESIKRKFSKNIHQ"
FT   gene            complement(19047..20273)
FT                   /locus_tag="BMQ_pBM70024"
FT   CDS             complement(19047..20273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70024"
FT                   /product="transporter, major facilitator family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70024"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72566"
FT                   /db_xref="GOA:D5E441"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D5E441"
FT                   /protein_id="ADE72566.1"
FT                   /translation="MGIPHTANQLEQPKLNIKPKIGLLIIGIILIGANLRAPLTSVGPL
FT                   VASIRDSLGISNTLAGTITTVPLLAFAFLSPFAPKLARRFGMEFTLFISLILLTIGIGI
FT                   RSFGGVETLFIGTILIGLSIAIGNVLLPSLIKHNFAQKIGMMTGIYAVSMNLCGAIGSG
FT                   ISIPISSLSGLGWTGALGGWGILSLLTIFIWLPQLRNRHKSMKPDQTAQKVKSINLWRS
FT                   KLAWNVTLFMGFQSFIFYTVITWMPEILEQKGLNTHDAGWMLSLMQLAVLPITFLVPIL
FT                   AGRLQDQRLLIVIPAVLLIGGLFGILYGNTLLIPLWIIMVGIGVGFVFSLAMMFFSLRT
FT                   QSTNEAAELSGMAQSFGYLLSAVGPVLFGGLHDITHSWNIPLLMLVLVSVLIFIAGMGA
FT                   GKNEYVTSK"
FT   gene            complement(20311..20610)
FT                   /locus_tag="BMQ_pBM70025"
FT   CDS             complement(20311..20610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70025"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70025"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72567"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="UniProtKB/TrEMBL:D5E442"
FT                   /protein_id="ADE72567.1"
FT                   /translation="MSRNILREAIQPLVHTGRLQTKQGQTYEKADIQLHKAILEASHNS
FT                   MLIDLYDHMIDSLHTSCHHIVEVSSHADFYLNLHCKLVDAIMAIYTVNEYITQI"
FT   gene            21146..21796
FT                   /locus_tag="BMQ_pBM70026"
FT   CDS             21146..21796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70026"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70026"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72568"
FT                   /db_xref="GOA:D5E443"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:D5E443"
FT                   /protein_id="ADE72568.1"
FT                   /translation="MEIIEVSWRTILLYVVIIIIFRFIGQRGINQLNVIDLVVVLMISE
FT                   LGVVAIEDTGDSLFYQLIPILILTLIQIGLTYIQLKSQKLRRVLDGQPIIVIRQGKIDE
FT                   KQMKKSRYNLDDLLLQLRDKNIGDIREVDYAILEPSGTLSVFKKSESKDDSGSIFLLPL
FT                   VIDGIIQEKHLNLINKNSSWLFNELKKRGYKDVKRILYCSFLNGHLFVDIKNE"
FT   gene            22215..22424
FT                   /locus_tag="BMQ_pBM70027"
FT   CDS             22215..22424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70027"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70027"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72569"
FT                   /db_xref="GOA:D5E444"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D5E444"
FT                   /protein_id="ADE72569.1"
FT                   /translation="MGRQNGTIKWYNFNKGYGFITREDETEIFVSYRSIEGNGYADLRE
FT                   GQKVSFDVETGQKGLEAVRVRVLD"
FT   gene            22980..23771
FT                   /locus_tag="BMQ_pBM70028"
FT   CDS             22980..23771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70028"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70028"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72570"
FT                   /db_xref="GOA:D5E445"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="UniProtKB/TrEMBL:D5E445"
FT                   /protein_id="ADE72570.1"
FT                   /translation="MSNDLSFSIGKFSKKTGVSIRTLHYYDEIGLLKAQKDLSSGHRLY
FT                   GEDHIVKLQKIIALILFLLGYNLEEIGLMLTNTSLNLNLKNTLIQQQKAFEKKKEHLDK
FT                   VLKAINQTISLLDGQENVPSEILISLINNIQNEEDQRTWLEHFTSKEITDKVYNKSDEE
FT                   NLSLDREFIDLSREVKRLVGKPVHDPEVQELANKHLQASLKYVGEEAMHAFGQLEDEEI
FT                   RDFQSMMASPYTEEEEKWLDQVIEYYMVQNGMYNPNQNNGK"
FT   gene            24126..24965
FT                   /locus_tag="BMQ_pBM70029"
FT   CDS             24126..24965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70029"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70029"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72571"
FT                   /db_xref="GOA:D5E446"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5E446"
FT                   /protein_id="ADE72571.1"
FT                   /translation="MTVVKNGTLQIPEAILYYEVRGSGPILLLIHGGGGDADKFNNIAD
FT                   HLADKYTVVTYDRRGHSRSNLIGKTEDYKVETHSKDAHLLLAELTDKPAYVFGSSSGAV
FT                   IGLDLCIRYSGQVRGMIPHEPVLLQLLFGNELKQAEQFMEDLQNNHRSEVIKLLSNLEM
FT                   NDAKPKQSIDVLTERLLSNSTYFTKYEIPGILNYTLDINKLSTLLKSSSIKIFPAGGSA
FT                   SRDLFPYGCAATLAEQLGTEFVEFPGHHAGFDTTHPEEFAERLHNVLITKIFKRYNE"
FT   gene            25304..25435
FT                   /locus_tag="BMQ_pBM70030"
FT   CDS             25304..25435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70030"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72572"
FT                   /db_xref="GOA:D5E447"
FT                   /db_xref="InterPro:IPR010981"
FT                   /db_xref="UniProtKB/TrEMBL:D5E447"
FT                   /protein_id="ADE72572.1"
FT                   /translation="MSKEDSKFDQEWISLMKEAYQLGLLIVEVKEFIYLNQKEPVSK"
FT   gene            25630..26292
FT                   /locus_tag="BMQ_pBM70031"
FT   CDS             25630..26292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70031"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72573"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="UniProtKB/TrEMBL:D5E448"
FT                   /protein_id="ADE72573.1"
FT                   /translation="MRTEAEAVLNSYIPIAKTIAKMFGPQCEVVIHDLTQPQSSVMFTM
FT                   NNHVTGREVGQSFDHLVKQVLLSEDFKEDHLAGYEIETDDHRLVKSSTTLIRDFQGQVI
FT                   GALCINYDMNLMLQMRKMLDGLMPVNHTDQQSSDEVKEEEDSIQNVEDITDQLIQQIIA
FT                   NSSHPFMKRREKIELIRFMDEKGIFLMKGAVDKVADQLGISRVTVYSYLDEVKKNTK"
FT   gene            26306..26680
FT                   /locus_tag="BMQ_pBM70032"
FT   CDS             26306..26680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70032"
FT                   /product="Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70032"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72574"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:D5E449"
FT                   /protein_id="ADE72574.1"
FT                   /translation="MESIFKVGNLKSNGHYALATIHKDTVYVSGQFSIDPVTQEKKFGM
FT                   IEEETLQALENVEYILKEVGSRKDQILRMTLYVSDIQLWDRVDSVYKRFFGNHKPARSV
FT                   VPTNKLHYGFQIEVEAIAYI"
FT   gene            26776..27882
FT                   /gene="thrC"
FT                   /locus_tag="BMQ_pBM70033"
FT   CDS             26776..27882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="BMQ_pBM70033"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70033"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72575"
FT                   /db_xref="GOA:D5E450"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniProtKB/TrEMBL:D5E450"
FT                   /protein_id="ADE72575.1"
FT                   /translation="MKEQYRCHSCGTTYNVTDFVWKCTCGGVLDLVKEKVTIDVTKLQE
FT                   KMPTMWRYVDVMPFEKDSNVWKEVTMGEGNTPLIGLDNSEPHTLVKVDYMMPTLSFKDR
FT                   GAAVLIAKAKELGVKSVIADSSGNAGTAIAAYAKRANIACDIFLGKGTSPKKIAQVKAH
FT                   GANVREIDGTREDVAAAAQKAVKEEKKFYASHVYNPYFYEGTKTYAYEIWEQMKGAPDS
FT                   LIIPVGNGTLLLGAYYGFKELMENQLINKMPKLVAIQAENCAPLAQAFVNNEIEANQIE
FT                   GNPTLAEGIAIASPARSAQILEAIRATEGEILTVNEEEILKARTLLAGKGFYVEPTTAT
FT                   NYAGYLKYKRLPSEKIIIPLCGAGIKAN"
FT   gene            complement(28199..28963)
FT                   /locus_tag="BMQ_pBM70034"
FT   CDS             complement(28199..28963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70034"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70034"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72576"
FT                   /db_xref="GOA:D5E451"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:D5E451"
FT                   /protein_id="ADE72576.1"
FT                   /translation="MGMLKTKRIQQIQEYVLKHQSVSLDDLGTVFGVSKTTIRRDIRKL
FT                   IKEGMIQKVYGGVAISHAKLESFNERKARNQLQKRLIAKTAADYVENGDVIFIDSGTTT
FT                   LEMITFLKNKQITIITNNLDIIIEALAFENLNVISTGGFLERDTKSFSSYSHADSFKKY
FT                   NFDKVFMASTGVSIVNGVTNSSPIESGIKETIVKGNADVFLLVDHTKLDKYAMVTYCGL
FT                   EEIDYLITDDCLDDSYQDYAKENSIELVVIKE"
FT   gene            complement(29360..29482)
FT                   /locus_tag="BMQ_pBM70035"
FT   CDS             complement(29360..29482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70035"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70035"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72577"
FT                   /db_xref="UniProtKB/TrEMBL:D5E452"
FT                   /protein_id="ADE72577.1"
FT                   /translation="MRGNIRNMWHLNTKAVIERVQSVEKCVRTADNGAVWVKYQ"
FT   gene            complement(29588..30511)
FT                   /locus_tag="BMQ_pBM70036"
FT   CDS             complement(29588..30511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70036"
FT                   /product="AP endonuclease, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70036"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72578"
FT                   /db_xref="GOA:D5E453"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:D5E453"
FT                   /protein_id="ADE72578.1"
FT                   /translation="MSIKISGAPCCWGVDNPQNPYLPPWERVLNEASQAGYKGIELGPY
FT                   GYIPMNIERVQAELSKNDLTIMAGTIFDDLVTESNLENLLHQVDDICSLITKLPSTLQE
FT                   KGQKFPTPYLVIIDWGHDERDYDAGHPEKAVRLSERDWDNMMAHIRALAVKAWDKYGVR
FT                   SVIHPHAGGYIEFEDEIEKLLEDIPYEIAGLCLDTGHLYYSKMDPIKWLQKCANRLDYI
FT                   HFKDIDLNVYKQVMEERIRFFDACGKGVMCPIGQGIIDYNSIHKLLKEIDYHGYITIEQ
FT                   ERDPRNSDTSLPDVKQSVDYLKSVGY"
FT   gene            complement(30695..31699)
FT                   /locus_tag="BMQ_pBM70037"
FT   CDS             complement(30695..31699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70037"
FT                   /product="oxidoreductase Gfo/Idh/Moca family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70037"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72579"
FT                   /db_xref="GOA:D5E454"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D5E454"
FT                   /protein_id="ADE72579.1"
FT                   /translation="MGEIRIGLVGAGRMGSFHGKSIAHKIHGAKLTAIAAPRTGPAERL
FT                   ASELGASKTYTDPREMFQDPSVDAVIIATPARSHAELIIAAANEGKAVFCEKPMAITLE
FT                   EADKAILSAQKANVPLQIGFNRRFAAGFRAAHNDIVEGRIGTPQLLRSLTRDPGLGDPT
FT                   PIPEWAIFLETLIHDFDALLYLNPGAEPTEVYAVADALVRPDFKDNGLLDTAVVNIRFD
FT                   NGAIATAEANFQAVYGYDVRSEVFGSAGSAQQTNMIRYIAEGISSDTCRQDTELFHDAY
FT                   VAELTSFVECIRTGNIPYLTGRDARRALSIALACIESVKTNTPVKIKDNAQLV"
FT   gene            complement(31848..32870)
FT                   /locus_tag="BMQ_pBM70038"
FT   CDS             complement(31848..32870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70038"
FT                   /product="oxidoreductase, Gfo/Idh/Moca family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70038"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72580"
FT                   /db_xref="GOA:D5E455"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D5E455"
FT                   /protein_id="ADE72580.1"
FT                   /translation="MKTHVRWGVLSTAQVAQDELLPAYMKAINAAVTAIASSNIKVKEI
FT                   ASKFEIPKIYESYDKLLEDPDIDAVYIPLPNALHSHWVKKAAKKGKHVLCEKPAALTFK
FT                   ETKEMIETCRENGVMFMEGFMYHFHLQHQRVKEIIASGEIGNVKTMKATLSSYLKNQNG
FT                   NIRMNGELGGGSLYDMGCYCIHAIRNILNSEPKRVFTSMQKDHDRQVDISVTGLLELNN
FT                   GMTAIFDAAMDRTRTDYYEIIGTEGSIQLPRAFAPQVFKGKASILIYTEDGNYRTEEAL
FT                   GDQYKLQVEYLSNCILEGEIPSYFTENTINNMKAIDACFKSVEKEAFINVSPEDLKVSK
FT                   "
FT   gene            complement(32998..34422)
FT                   /locus_tag="BMQ_pBM70039"
FT   CDS             complement(32998..34422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70039"
FT                   /product="MFS transporter, sugar porter (SP) family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70039"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72581"
FT                   /db_xref="GOA:D5E456"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D5E456"
FT                   /protein_id="ADE72581.1"
FT                   /translation="MENLKLPNDYSAQTEQVKEKDSKKFLKLVTIVSTFGGLLFGYDTG
FT                   VINGALPFMARPDQLNLNPFTEGLVASSLVLGAAFGSIFGGRLSDNKGRRKVILYLAIL
FT                   FFFSAAGCVIAPNTTIMVAFRFLLGLAVGGSSVVIPSYLAEIAPTDRRGILVTQNELMI
FT                   VTGQFLAYICNAVIGNVFGDAGHAWRYMLVIATLPALALWIGVLILPESPRWLASKGKM
FT                   TDALKILQKIRSESIAQQELKDIKAHISEEQKIEKMSFKDLRTPWIRRIVVLGIFIGSI
FT                   SQLVGINSIMYYGTQILENSGFGTKTALIANVANGLIAVVAVIVGMSLLNKVNRKPMLL
FT                   TGLTGVTVALITIGISALILTGSPVLPYVVLSMTVVYLAFFQGAIGPMVWLILAEIFPV
FT                   RLRGIGMGFAVLFLWFCNFLVGLFFPLLLDVIGLSSTFFLFAAFGIVGIIYVAKFLPET
FT                   RGLSLEQIEANFKKES"
FT   gene            complement(34845..35021)
FT                   /locus_tag="BMQ_pBM70040"
FT   CDS             complement(34845..35021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70040"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72582"
FT                   /db_xref="GOA:D5E457"
FT                   /db_xref="InterPro:IPR018540"
FT                   /db_xref="UniProtKB/TrEMBL:D5E457"
FT                   /protein_id="ADE72582.1"
FT                   /translation="MILREVLDLSKSIANYRLDMYELAKNKGFSDPDVLKINQQLEFKI
FT                   QNIKNIAKDIRSF"
FT   gene            complement(35186..36400)
FT                   /locus_tag="BMQ_pBM70041"
FT   CDS             complement(35186..36400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70041"
FT                   /product="oxidoreductase, Gfo/Idh/Moca family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70041"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72583"
FT                   /db_xref="GOA:D5E458"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D5E458"
FT                   /protein_id="ADE72583.1"
FT                   /translation="MLNGEKKIARPLRWGMVGGGRLGQVGYKHRIGALRDNTAFQLVAG
FT                   AFDIDPARGKDFGVNIGVSEKRCYPNYETMFAEEAKRKDGLEVVSIATPNGTHYEICKA
FT                   ALHAGLHVICEKPLFFTSDEVVEIKALAEEKGKIVGVTYGFSGNQLLLQMRAMVEKGEI
FT                   GDIRVVELQYTHGFNATDDGDKVNAAQKWRVDPKIAGPSYVLGDLSTHTYYMSQLIMPQ
FT                   MKIKKLLCDRQSFIGSRAPLEDNAYVLMHYENGAVGRLWTSSIDAGCMDGHRIRIVGSK
FT                   ASLEWWDSKPNELRYEVQGQPIQTLIRSMPYLDESCNADERLGALHQEGLSESWSNIYL
FT                   KFAIAIDAKMRGDQETLDTLVYPDINAGLEGVRWIENCVRSADQGSAWVDFESNKEAAL
FT                   VGKTL"
FT   gene            complement(36520..37461)
FT                   /locus_tag="BMQ_pBM70042"
FT   CDS             complement(36520..37461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70042"
FT                   /product="AP endonuclease, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70042"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72584"
FT                   /db_xref="GOA:D5E459"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:D5E459"
FT                   /protein_id="ADE72584.1"
FT                   /translation="MKLSYVTDSLGHLPFEEMLDVITEMGIDIIEMTTGGWSPAPHLKL
FT                   NELLESDYKRAEFLNELEKRNIKLCALNCSGNPLDPGELGKEHREVTDKTFELAKLLGI
FT                   KKVIMMSGLPAGSPEDKIPNWITYTVSWPPVLKDILDYQWNEVAIPYWKELVKKAESCG
FT                   IEKIALENFSSQLVYNPETLFKLRNAVGPIVGLNLDPSHLIWMGADPILSARELGAAIH
FT                   HVHGKDVRLERHLSGVNGVMETKEVTDVANRAWNYVAVGCGQDLQWWKEFFSVVKMMGY
FT                   DEEVSLEMEDLTMSVEAGVRTSIDALKQTLSF"
FT   gene            complement(37856..38755)
FT                   /locus_tag="BMQ_pBM70043"
FT   CDS             complement(37856..38755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70043"
FT                   /product="AraC-like ligand binding domain/transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70043"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72585"
FT                   /db_xref="GOA:D5E460"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D5E460"
FT                   /protein_id="ADE72585.1"
FT                   /translation="MDKFISGKIALNEYIQRTRSNGVSFYIHYWGVMPQHYNNLPHKHS
FT                   FFEVCYVLEGRGTYIDQGCTYQIEENTIFLSRPEVLHQIKSDTGLFLLYVGFELDESES
FT                   SEKWVTIIEEAKQCSEVVIDVKEDEAAPLMWKSLLIQAANSESALFEEILSNLAHSLIL
FT                   SLIQTFVVSSNYHSQKTVPKKSSLILTLAKLYIKDNLSNSIKLTDTATYLHLSSRHLSR
FT                   LFKAELGISYSEYVQNERIQRAATLLKTTDLSIRDIAQETGFPDVHYFTRVFTASMHSS
FT                   PGRFRALYTKLKTVIYKD"
FT   gene            complement(38873..39043)
FT                   /locus_tag="BMQ_pBM70044"
FT   CDS             complement(38873..39043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70044"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72586"
FT                   /db_xref="GOA:D5E461"
FT                   /db_xref="UniProtKB/TrEMBL:D5E461"
FT                   /protein_id="ADE72586.1"
FT                   /translation="MKEINLLFLSELTLLKANSVPNPFIQVEYIMCLILISLSFYFLSL
FT                   RVKKLKLSDFS"
FT   gene            complement(39434..40684)
FT                   /locus_tag="BMQ_pBM70045"
FT   CDS             complement(39434..40684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70045"
FT                   /product="integral membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70045"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72587"
FT                   /db_xref="GOA:D5E462"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:D5E462"
FT                   /protein_id="ADE72587.1"
FT                   /translation="MSIFFQSFRKLTALELRLLLCFLLPPLGVFLLLLSGLHTICKHWK
FT                   EKKRFVFSLSSYFFLCLFISTIGASISMKEISYLSVSGMILGYWGLYLRILDTEKNQLF
FT                   QHFRLIMIFGGVYSCVIGWFSQWYTFPLAVGYLTGTVPLGLGHFDLNRLVGCTYNPNFT
FT                   VYILLISISFLLAHLLASLRSKRFVHFVWVFPILFLLSYGVIQTGSRAGFASMILIYLL
FT                   FIMRLNRYIFIISILFILSLSKWLLHLMPRNELVNLSMQVRKDIWKSSYKIWQDHSIFG
FT                   VTPIGFGQKYLKDYHEVVPHAHNILIGMFAEYGTLGGLAFLLVICLNLVKCIHLFFSIR
FT                   SHKCLLDSFLLSLPIIILTGVFDEPLFSPQIGFLTVILFACWDRYTKRMHYVIVYPFIS
FT                   RIKDWIYLDVTAPNNQK"
FT   gene            41106..41225
FT                   /locus_tag="BMQ_pBM70046"
FT   CDS             41106..41225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70046"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72588"
FT                   /db_xref="UniProtKB/TrEMBL:D5E463"
FT                   /protein_id="ADE72588.1"
FT                   /translation="MENKWLFISENSENSPDPNDTVNLDEWESEGGRIVEITK"
FT   gene            41422..41700
FT                   /locus_tag="BMQ_pBM70047"
FT   CDS             41422..41700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70047"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70047"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72589"
FT                   /db_xref="GOA:D5E464"
FT                   /db_xref="UniProtKB/TrEMBL:D5E464"
FT                   /protein_id="ADE72589.1"
FT                   /translation="MKNKDFLLSIVLNVFLAYLWIFLIYLIFDFVKLKDNALLFGIVLA
FT                   STGTLLFAEVVRRVNPFIEYKITHPVKVAGFISFGLIAVANLYWISF"
FT   gene            complement(41846..42076)
FT                   /locus_tag="BMQ_pBM70048"
FT   CDS             complement(41846..42076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70048"
FT                   /product="Cold-shock DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70048"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72590"
FT                   /db_xref="GOA:D5E465"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D5E465"
FT                   /protein_id="ADE72590.1"
FT                   /translation="MAERQVGTVKWFNHEKGFGFITPENGPDLFVHFTAIERTKGTEGV
FT                   VIKSLKEGQKVTFVVVNGQRGMQAEMVRVLG"
FT   gene            complement(42162..42275)
FT                   /locus_tag="BMQ_pBM70049"
FT   CDS             complement(42162..42275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70049"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72591"
FT                   /db_xref="GOA:D5E466"
FT                   /db_xref="UniProtKB/TrEMBL:D5E466"
FT                   /protein_id="ADE72591.1"
FT                   /translation="MGVGAISFTAFISSLISLIIISVVEALKGKGNKNIHQ"
FT   gene            42805..43554
FT                   /locus_tag="BMQ_pBM70050"
FT   CDS             42805..43554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70050"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72592"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5E467"
FT                   /protein_id="ADE72592.1"
FT                   /translation="MDRNKFSSIAHSNHLFSNPIAETKINRIIDFLQLEPPAKVLDIGA
FT                   GKCELLIRLVEKYGIEATAVELYEGSILEAKQQAQKRIPEEKITYIVKDAKQVVSEYIN
FT                   HFDVGICVGSTHALDSLELTLQSLKRNVKKGGFILVGEGYWKKKPSPAYLEALGGADES
FT                   ELKEHHENVFMGESMGLVPIWSVVASDDDWDEYEGLYAMSMEKYCYENPNDPDCASMLN
FT                   KIRSWKRTYLTWGRDTLGFGLYLFQNQ"
FT   gene            43863..44597
FT                   /locus_tag="BMQ_pBM70051"
FT   CDS             43863..44597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70051"
FT                   /product="methyltransferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70051"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72593"
FT                   /db_xref="GOA:D5E468"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5E468"
FT                   /protein_id="ADE72593.1"
FT                   /translation="MKQNKYDVEKFFFAYEQMPRSIKGLEGAGEWHVLKALMPDMKDKK
FT                   VLDLGCGFGWHCQFAHEQGARSVIGVDISEKMLEKAREKTKDPSISYIQMPIEDIDFKK
FT                   SEFDVVISSLAFHYIKSFGEVAKKVGSFLKPGGTFLFSVEHPIFTSRNEQDWYYDHDGH
FT                   PMHWPIDHYQEEGIRHTSFLTEDVIKYHRTISTYMNDLIRTGFTINAVKEPMPSDEMLE
FT                   SIPQMVDETRRPMFLIILAEKN"
FT   gene            45294..46943
FT                   /locus_tag="BMQ_pBM70052"
FT   CDS             45294..46943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70052"
FT                   /product="reverse transcriptase/endonuclease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70052"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72594"
FT                   /db_xref="GOA:Q848Y1"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:Q848Y1"
FT                   /protein_id="ADE72594.1"
FT                   /translation="MNTSLRASAHVSHKDWYSIDWSIIQKYVAKLRQRIYRAEQQKQRR
FT                   KVRKLQRLLLRSKANLLLSIRRVTQQNNGKRTPGVDGYTASKPNERIKLYQQLVKCNVF
FT                   RHRPKPAKRTFIPKKNGKLRPLGIPTMRDRVYQNVVKNALEPQWEVKFEPTSYGFRPKR
FT                   STHDAISNLFNKLNTNSKKKWVFEGDFLGCFDHLNHNWIMEQTSMFPGNTLIKRWLNMG
FT                   YIEQDMLHTTTEGTPQGGIVSPLLANIALCGMEEEIGIVYKKTYKSNGGYKIDPKCKIG
FT                   RVLYADDFVIVTETKEQAESMYQNLTPYLRKRGITLSKEKTRVTHIEDGFDFLGFSLRQ
FT                   YNTGQGKKLFIKPSRDSIKKAKNKIKDTFSVMRGRPVKELIRVLNPIIRGYGQYWKHVV
FT                   SKKTYSYMDNYIFLKVRKHLKQLHPKKSRKWISKRYFKKPHHGGNNKWILTCPLTNIQL
FT                   LKMSWIKIERHVMVAYKNSPDDPSLREYWEKRDRKVFNTENTLDRMKLARKQGYRCALC
FT                   KQTLQNGETITVRNLKVSTGKFAKLVHVPCIK"
FT   gene            47207..48202
FT                   /locus_tag="BMQ_pBM70053"
FT   CDS             47207..48202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70053"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70053"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72595"
FT                   /db_xref="GOA:D5E470"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D5E470"
FT                   /protein_id="ADE72595.1"
FT                   /translation="MKLLKKVLKRKTTWFVFLIVIAFIYLNNSSLLAQKRENQPFLLAH
FT                   RGVAQTFKMKDIQNDTCTAERIYKPQHNFLENTIPSMEAAFEDGADMVELDVHITKDNQ
FT                   FAVFHDWTVDCRTNGKGVTRDYTMAELKKLDIGYGYTADGGKTYPFRGKGVNLMPSLNE
FT                   VMEHFPHQAFLIHVKSNDPKEGRQLAKYLSQFSKKRLKNITVYGGDEPIDSLKKEMPNL
FT                   KVMSKATMKDCLIPYIATGWTGYVPKACENTELHIPEKIGPFLWGWPSRFLNRMDDVDT
FT                   RTIIVGGNGSEFSTGFDSIQDLKRLPDGYSGGIWTNRIDKIGDYYKTNEE"
FT   gene            complement(48512..49753)
FT                   /locus_tag="BMQ_pBM70054"
FT   CDS             complement(48512..49753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70054"
FT                   /product="transporter, major facilitator family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70054"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72596"
FT                   /db_xref="GOA:D5E471"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D5E471"
FT                   /protein_id="ADE72596.1"
FT                   /translation="MDQVIKKENKGRISTVGKYSVLIMIVGIVFIAANLRAPLTSVGPM
FT                   VGFIKDDINISNTMAGMITTLPLLSFALFSPIVPKLGQKYGVELIILGSIVFLTVGIAI
FT                   RSLSGVASLYIGTAILGLAISVGNVLLPGLIKREFPKRIGLMTGVYSISMNLFGAIASG
FT                   VSVPIALGWRFGWKGALGIWGVLSFISIFFWLLQMKHSNVRRDTVHKEKADSHVNLWSS
FT                   ALAWQVTLFMGLQSMFFYVLVAWLPEILKQQGLNSSQSGLMLSVMLLALLPFTFIVPVI
FT                   AGRMSGQRSLVTITAILFLIGTFGLLYGSSNLIIFWIIALGIGGGFAFSLSMMFFGLRT
FT                   RNAQQAAELSGMAQSVGYLLAAIGPTLFGFIHDATNSWTIPLLILVGASVLLFIFGLSA
FT                   AKDRYIGSTNSQNI"
FT   gene            50227..51393
FT                   /locus_tag="BMQ_pBM70055"
FT   CDS             50227..51393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70055"
FT                   /product="transporter, major facilitator family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70055"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72597"
FT                   /db_xref="GOA:D5E472"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D5E472"
FT                   /protein_id="ADE72597.1"
FT                   /translation="MKGQGRLSLSVGWITLFLMGTDLFVVSPLLPFISQAYKISSATAG
FT                   WMVTVFAITYAISAPFFGWLSDKKGRRSFITLGLLLFAASNILTACAPSFLWLIVSRIL
FT                   AGFSVASITPLIYAIIGDIAPPSRRGTWLSIVVSGHLTALWAGTPLGTLLEHFLGWRSV
FT                   FIVMAILGVILIFVNFKAWKSVPSNELTTNLLKGNLARILGSVSVTAIWAISMYTLYIY
FT                   LGAALHFNNGFSSAEIALTVTFYGIGAVLGSLSSGQLTDKFGERKISINTLIVLTLILL
FT                   CLGVFFSSGDWLYFFMFIWALVGYAGFTSYQARLAVEYPLERGIVMAWNNTALYIGITL
FT                   GSMLGGYVISNWGYSTLPYACSIAAVLSFIISTQKRKLLKEKTTFISR"
FT   gene            51669..51887
FT                   /locus_tag="BMQ_pBM70056"
FT   CDS             51669..51887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70056"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70056"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72598"
FT                   /db_xref="UniProtKB/TrEMBL:D5E473"
FT                   /protein_id="ADE72598.1"
FT                   /translation="MNCTQNEKLNQVTPHTLIVGVDIAKSKHIARAQDNRGKILSQAFQ
FT                   HRMNCSHLKLTIINFSTYKPNDLFLLI"
FT   gene            52608..52934
FT                   /locus_tag="BMQ_pBM70057"
FT   CDS             52608..52934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70057"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70057"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72599"
FT                   /db_xref="GOA:D5E474"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D5E474"
FT                   /protein_id="ADE72599.1"
FT                   /translation="MDKQHSQCPVEFTVNMVGGKYKLVILYQLATHEVRRFNELRRELP
FT                   NITPRTLTRQLRELESDGLINRQVYPEIPPKVEYSLSETGKSLNSILLQIENWGLKHIV
FT                   NKPK"
FT   gene            53129..53701
FT                   /locus_tag="BMQ_pBM70058"
FT   CDS             53129..53701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70058"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70058"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72600"
FT                   /db_xref="GOA:D5E475"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR032551"
FT                   /db_xref="UniProtKB/TrEMBL:D5E475"
FT                   /protein_id="ADE72600.1"
FT                   /translation="MRHKDENKNENIFNATIQLINEIGLAETSMSKIAKKAKVSASTIY
FT                   VYFENKEDLLNKLYLNVKKMMTEAIFNNFDASLSLQEAFENSLRKFVEFTLANKDYFLF
FT                   IEQFQNSPLLNKISRDEITDICEPLYSLFEKGKKQHVFKQVDTNLLAIFTLQPLMQFVK
FT                   EHFNGTTTINEANLNKVIQMSWDAIKA"
FT   gene            complement(53717..53947)
FT                   /locus_tag="BMQ_pBM70059"
FT   CDS             complement(53717..53947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70059"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72601"
FT                   /db_xref="UniProtKB/TrEMBL:D5E476"
FT                   /protein_id="ADE72601.1"
FT                   /translation="MHYIKSSSSLDIRHNLSFFKIKERSFILYSKKTNLKHLTKLDSLY
FT                   NKRSFDYLRVIHIQRENFFNKPLLLLLSPSV"
FT   gene            54125..55258
FT                   /locus_tag="BMQ_pBM70060"
FT   CDS             54125..55258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70060"
FT                   /product="NADH-dependent flavin oxidoreductase, oye family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70060"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72602"
FT                   /db_xref="GOA:D5E477"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5E477"
FT                   /protein_id="ADE72602.1"
FT                   /translation="MNKKYNNLFETFTFKNGVTLKNRVVMAPMTTWSSNDDYTVSDEEL
FT                   TYYQKRVNGVGLVITGCTHVQPNGIGFTNEFAAYDDKFIPSLRKLAGAAKSGGAPAILQ
FT                   IFHGGNKALPALTPNGEVVSSSALETEASDFAPSVLPRELSHDEILEVIHAFGETTRRA
FT                   IEAGFDGVEIHGAHGFLLQNFFSPFFNRREDEWGGSLENRLRFPLAVVQEIKNVIKKHA
FT                   TKPFILGYRISPDEHQTGGLRMKDTYELINRLIEANVDYVHASLANALSSKPVDSKDDK
FT                   TYLELIAEHVNNRVPVIAAGSMVTADDVKTALDKGLSLAAIGHTLIMNPDWVEKVQNGK
FT                   EGEIETALKASKINEIEIPEKLWNVIQASGPWFKVEE"
FT   gene            complement(55796..56728)
FT                   /locus_tag="BMQ_pBM70061"
FT   CDS             complement(55796..56728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70061"
FT                   /product="transcriptional regulator, LysR family/ LysR
FT                   substrate binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70061"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72603"
FT                   /db_xref="GOA:D5E478"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D5E478"
FT                   /protein_id="ADE72603.1"
FT                   /translation="MDMRLFEYALEIYKTKSFTKAASNLHIAQPSLSKQIAKLENELGI
FT                   RLFHRKPGTVEPTSDGLCFVKQAEKILQMRDDLKREIQERKEGIRGDLKIGSTAITGGH
FT                   ILPSLLKNYEKQYPNVHIQLIEEATEKLIDLTAKGLVDISILSLPIEDSRLETKIILTE
FT                   PLYLALPQEQKNWTPKKVKNLIASSKLKEQTILSIEDFANCPFILLKKGYGFRRTVLEL
FT                   CARGKFEPQVPYETSSIETAQSLVANGLGVTVVPEMVIHKNLQQNSVMYIKLDSNPTRT
FT                   LVFTYNKDRYLSMNAKALIEIHEGESRLT"
FT   gene            56854..57615
FT                   /locus_tag="BMQ_pBM70062"
FT   CDS             56854..57615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70062"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70062"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72604"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5E479"
FT                   /protein_id="ADE72604.1"
FT                   /translation="MNVWNADLYDDKLSFVSNFGKGVVELLHPQKGERILDLGCGTGDL
FT                   TYVISKSGANVTGSDFSEEMIEKARRKYPEIPFVIENGEDFQTDEKYDAIFSNAALHWM
FT                   KQADKVVESVQLALNPGGRFVAEFGGEGNVQTVIRGIIETLSQDYGMDVEERNPWYFPS
FT                   IGQYSTLLEEHGFRVSYAHHFDRPTSLADGEKGLNHWLDSFADDFFPEFSRKEKMKIYE
FT                   KIKNKIKTNLYKDDTWIADYKRIRIVAIKKK"
FT   gene            57643..58452
FT                   /locus_tag="BMQ_pBM70063"
FT   CDS             57643..58452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70063"
FT                   /product="methyltransferase, UbiE/COQ5 family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70063"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72605"
FT                   /db_xref="GOA:D5E480"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5E480"
FT                   /protein_id="ADE72605.1"
FT                   /translation="MEGNIARNRAQLSGKLTNVLDSRSLTYSHKRLASILKKGMTVLDI
FT                   GCGTGAITRGIAEVVGPNGRVIGIDSNPILIEKARQTHGETPGLTFETGDIYNLTYKGQ
FT                   FDIVTSARVLIWLSDPLKALQMMKDATKIGGRILVADYNHKKISWKPQPPPSMISFYSA
FT                   YLKWRSDAGMNNAIADDLAHMFREIGIQNIIVTSQHEVSNRTDFNFETNIGIWADTASS
FT                   RGIQMERDGYITEIEYTTTEKEYREWVTKEAQSLTMYMLAVEGVRTL"
FT   gene            complement(58671..59261)
FT                   /locus_tag="BMQ_pBM70064"
FT   CDS             complement(58671..59261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70064"
FT                   /product="1-acylglycerol-3-phosphate O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70064"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72606"
FT                   /db_xref="GOA:D5E481"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:D5E481"
FT                   /protein_id="ADE72606.1"
FT                   /translation="MYTIATRILQLLLSLMNGRMNVINKEKLPQNEPFIVVCTHKSWID
FT                   VVCLGIALHPIPIHFMAKKELFNKIFIKNLLTKLNAFPVDRSNPGPSVLKIPLQLLKKK
FT                   QVVGIFPSGTRNSEEKALKNGAIHIASRASVPIIPAVYIGPHTIKDLLGRKRRTIILGD
FT                   AIHVPKMTKDKEAVTEATNEVISKAFGDLKSNI"
FT   gene            complement(59269..60258)
FT                   /locus_tag="BMQ_pBM70065"
FT   CDS             complement(59269..60258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70065"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70065"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72607"
FT                   /db_xref="GOA:D5E482"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D5E482"
FT                   /protein_id="ADE72607.1"
FT                   /translation="MKSTARITAIGTYVPEKRLTNDDLERIVDTNDEWVVKRTGMKERR
FT                   IADENEYSSNLAIKAIENLVAQYQKELSDVGCIIVSTTTPDYAFPSVATQIQNHFDIPT
FT                   TGALDFNATCAGFTYGLHIANAFITSGLHHKVLVVTAETLSKVTDYTDRTTCVLFGDGA
FT                   AAVLVENDAERPSFIATHIGTNGKGGKHVYRTNLSTTMHGQPLSSSGKMVQNGREVYKW
FT                   ASRTIPLGISELLEQANLQKNQVNWFVPHSANLRMIESICERSDFPIEKTLTSVEYMGN
FT                   TSSVSIPLALQIGINEGKLRNGDVLLLYGFGGGLTHAGHIIKWDLGKE"
FT   gene            60325..60441
FT                   /locus_tag="BMQ_pBM70066"
FT   CDS             60325..60441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70066"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72608"
FT                   /db_xref="UniProtKB/TrEMBL:D5E483"
FT                   /protein_id="ADE72608.1"
FT                   /translation="MNLYGKIVNQAYVDLRIKIKSFKTIDFKGFLFLINYIM"
FT   gene            complement(60586..60714)
FT                   /locus_tag="BMQ_pBM70067"
FT   CDS             complement(60586..60714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70067"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72609"
FT                   /db_xref="UniProtKB/TrEMBL:D5E484"
FT                   /protein_id="ADE72609.1"
FT                   /translation="MKKGKIYTLIDGSERTITIDKGMVLREDVYIVGIRKGDLLNI"
FT   gene            60796..61548
FT                   /locus_tag="BMQ_pBM70068"
FT   CDS             60796..61548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70068"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72610"
FT                   /db_xref="UniProtKB/TrEMBL:D5E485"
FT                   /protein_id="ADE72610.1"
FT                   /translation="MNREQVIEIYQHVLERKRKRFPNYFFVGKEGKKYMSYMTRYLLEQ
FT                   HLMIRVHEIPLQVGANTLWSHRLRPPAMLYGWNYYEVIDNAYPGRFKPWQFQQVPDKYW
FT                   DGEEGKKRAIEAVKYVIEKKLKIPLNEIPIQVNIHFFNQHSLGGVFSLFGQSPFQVIEA
FT                   VYPGVFRPWQFAHVPMNCWKNEKYIREAMEDFLFKQLHFSSYKDALLKLKRNHFTDFQL
FT                   TGLFQMAFDSRMNNVKKWIKNQLINIGK"
FT   gene            complement(61662..61892)
FT                   /locus_tag="BMQ_pBM70069"
FT   CDS             complement(61662..61892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70069"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70069"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72611"
FT                   /db_xref="GOA:D5E486"
FT                   /db_xref="UniProtKB/TrEMBL:D5E486"
FT                   /protein_id="ADE72611.1"
FT                   /translation="MKIMGISLLMLGCLIAFSLGIDIFQGFDVSQALYNAVSPFRVMEV
FT                   AELFVLFFLLFLFFAESVYLFIKERKGNQSK"
FT   gene            62025..63647
FT                   /gene="gerUA"
FT                   /locus_tag="BMQ_pBM70070"
FT   CDS             62025..63647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerUA"
FT                   /locus_tag="BMQ_pBM70070"
FT                   /product="spore germination protein GerUA"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70070"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72612"
FT                   /db_xref="GOA:D5E487"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:D5E487"
FT                   /protein_id="ADE72612.1"
FT                   /translation="MPSFFKDRKSKKNRQKDAKNQATDQSAEHIQDSLSANLNIIKQKT
FT                   GNSSDVVIRHLKMGSNSNIRVAIVYLEGIVDNQSIQEFLLESMMKDNEKEKVNEHNALE
FT                   LISEDMMAVGNVTFIHNWDDLFSALMVGDTLFLVDGIDQALGAGTQGGEKRSIAESTTQ
FT                   MVVRGPKGAFTESIGTNTAMVRRIIKTPDLWTESFKIGRVTKTDVTLMYIHDIANDKVI
FT                   NEIRQRLNKIDIDSILESGYIEQLIEDETMTSFPTIYNTERPDVVAGNLLEGRIAIFVD
FT                   GTPFVLIAPAVFMQFFQSAEDYYARFDIATSIRLLRIFMFLISLIAPATYVAVTTFHQE
FT                   MVPTTLIVAIAAQREAVPFPAFVEALLMEVTFEILREAGIRLPKAIGSAVSIVGSLVIG
FT                   QAAVQASIVSPAMVIIVSITAIASFATPSFDMAISARLIRFLFMLGAATFGFYGIILVL
FT                   LMMVVHLCSLRSFGVPYMAPFAPFIPVNNGDTVMRLPWWTLRQRPRLISTNTVREGANQ
FT                   RPQPPASRGMVNRDFEKGDNNEA"
FT   gene            63637..64866
FT                   /gene="gerUC"
FT                   /locus_tag="BMQ_pBM70071"
FT   CDS             63637..64866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerUC"
FT                   /locus_tag="BMQ_pBM70071"
FT                   /product="spore germination protein GerUC"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70071"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72613"
FT                   /db_xref="GOA:D5E488"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="UniProtKB/TrEMBL:D5E488"
FT                   /protein_id="ADE72613.1"
FT                   /translation="MKRKWAVLLLMILVTALLSSCWSKKELTDLAIVSAVGIDKTKDGK
FT                   YHLTLQIINPGNVAGGMQGGGGGTQSPPVTIYSASGDNIVEASRRASSRISRRLYYAHA
FT                   NLVVIGEKLARESGLNPLIDVLDRDPEFRTTATMVIANHSTAADLVQTLTPVDKIPANK
FT                   VLKTLEFTERKWGENVKLSIQDVIIGLESPGGETIVGGFRLVGNPKQARMLENLQESAP
FT                   EATLRASGIAVLKQGKLVDWLYGKPARGTVWILDKIQGTDINIDWAGKKEAIAYQTVRQ
FT                   KTSVSAQVKNGQPHISVHTRVEGDIGDMEVPVDITNPKVITKIEQFVRKEIKKELKTAI
FT                   EQAQKNKTDIFGFGEVVHRTRPNQFKKLKTEWNDVYFPKLDVDITVEAYVRRAGLRNKS
FT                   FLSGVKENQK"
FT   gene            64888..65988
FT                   /gene="gerUB"
FT                   /locus_tag="BMQ_pBM70072"
FT   CDS             64888..65988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerUB"
FT                   /locus_tag="BMQ_pBM70072"
FT                   /product="spore germination protein GerUB (amino acid
FT                   permease)"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70072"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72614"
FT                   /db_xref="GOA:D5E489"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:D5E489"
FT                   /protein_id="ADE72614.1"
FT                   /translation="MEKAKISASQLFILMVLFELGSALLVPLAIRAKQDAWLAILLGMI
FT                   FSFVLFFVYHKLYTYYPNLLPTEYMQKILGKVLGTILAFIYILYFMYDASRVLRDFGEM
FT                   LLTFAYPDTPLFIANALLMLVIIYTIRKGIEVIARSGELLFIFMYILAVAGFILIVSSG
FT                   LIEIKNLQPVLEEGLLPSLKVALSETLYFPFTEAIVFTMILPYLNDSKKAKVTMLCATG
FT                   LSGINLAITMLINVSVLGVNLTARSQFPLLSTVESIQVADFLERLDVFFMLAMVIGIFF
FT                   KVSVLFYAAVIGTANLFKIKSPSRMSYPLGIIILFMSMTIASNFQEHLHEGLYAAKFVL
FT                   HIPLFTVIPSLLLLVSFLKNRKRHGG"
FT   gene            66201..67301
FT                   /gene="gerVB"
FT                   /locus_tag="BMQ_pBM70073"
FT   CDS             66201..67301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerVB"
FT                   /locus_tag="BMQ_pBM70073"
FT                   /product="spore germination protein GerVB"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70073"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72615"
FT                   /db_xref="GOA:D5E490"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:D5E490"
FT                   /protein_id="ADE72615.1"
FT                   /translation="MEKAKISASQLFILMVLFELGSSLLVPIAMDAKQDAWLAILIGMV
FT                   GSFVLFLVYHKLHSYYPDLLPTEYMQKIMGKGIGTVLAFVYILYFMYDAARVLRDFGAM
FT                   LLTSAYPETPLFIAHTLLMLVVIYTIRKGIEVVARSGEILFIFIYIFAIMGFVLIVCSG
FT                   LIEFTNLQPVLEEGVLPVLKVAFTQTIYFPFAEAMVFTMILPYLKDQKKAKMTMLCATG
FT                   LSGINLTITMLINISVLGVDLTSRSQFPLLSTVQSIQVADFLERLDVFFMLALVIGGFI
FT                   KISVLLYAAVIGTANLFKIKSPSRLSYPLGFVILFMASTIASNFQEHLHEGLKVEMFIL
FT                   HMPILAIIPSLLLLVAFLKNRKKQRG"
FT   gene            complement(67580..67753)
FT                   /locus_tag="BMQ_pBM70074"
FT   CDS             complement(67580..67753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70074"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72616"
FT                   /db_xref="UniProtKB/TrEMBL:D5E491"
FT                   /protein_id="ADE72616.1"
FT                   /translation="MDLSQHTGHVSQREKFNSTVNEVAFFIKSFLSGVTPFLAQLNILS
FT                   LSTFYKAHEIDH"
FT   gene            complement(67805..68116)
FT                   /locus_tag="BMQ_pBM70075"
FT   CDS             complement(67805..68116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70075"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72617"
FT                   /db_xref="UniProtKB/TrEMBL:D5E492"
FT                   /protein_id="ADE72617.1"
FT                   /translation="MSRTSRFKMQIYSPQWGDKDLYHFKKTKRGWEFENYRCKGEVDKG
FT                   GNPLFYKALITESLSYPNHLEEYLSIVWGKVEVLNKEQVQNIFDEISEWVSASENDLN"
FT   gene            complement(68498..68968)
FT                   /locus_tag="BMQ_pBM70076"
FT   CDS             complement(68498..68968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70076"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72618"
FT                   /db_xref="UniProtKB/TrEMBL:D5E493"
FT                   /protein_id="ADE72618.1"
FT                   /translation="MILIKNQEEVIREAKYQLHTTMDDYQTKIISTFDKHHIPMSKRIN
FT                   LMILLSDIKEQAVLIGKQAAIKGKSEHQGQNQLITEVVDEVPFQYSEKTVTDLENNIQI
FT                   IKKKIEDLAREYELDSELVNLKALLLNLKVTSYINGHYEMYVKDNTLSSKRS"
FT   gene            complement(69264..70109)
FT                   /locus_tag="BMQ_pBM70077"
FT   CDS             complement(69264..70109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70077"
FT                   /product="anti-sigma-factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70077"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72619"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="UniProtKB/TrEMBL:D5E494"
FT                   /protein_id="ADE72619.1"
FT                   /translation="MDNLHFLGEKILEKKYEIAQMVHTNRMADLKEIKDVNLTNEEIIE
FT                   LRANFISYFGQALMEKIDQKTIFDQIVKWAKESGEFASNLGISLSEALEDTTYYRKFIW
FT                   EVLKEEIRNHNIPTDTIFELITIIDPLLDKAVYVFSLTYVNIHQETLKKAKSAFLELSV
FT                   PVVPITKGIAILPLIGEVDTERATLLLEETLAKANKLQLSHLLFDLSGVMIVDTMVAQQ
FT                   IFNIIDALSLLGVKTMLIGIRPEVAQTMIHLGINFNEITVKANLEQALLGLNLTIDTLE
FT                   "
FT   gene            70505..71065
FT                   /locus_tag="BMQ_pBM70078"
FT   CDS             70505..71065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70078"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72620"
FT                   /db_xref="InterPro:IPR025847"
FT                   /db_xref="UniProtKB/TrEMBL:D5E495"
FT                   /protein_id="ADE72620.1"
FT                   /translation="MKTINSISSSKKFDKGHVFYRFEDKQFYINNLISFIRSGLESKEH
FT                   ILIIESMRTLPQIKANIDEEFSHQQKKSIRLVNNFDYYLANGDFHTKTILAHFQEDLST
FT                   LNKKNTLIRTWAHVEWASEEPDVFLLEEFESTADNFVKGKGMISVCAYAAESLSSTLDT
FT                   TLQQLHQYIMTDDNFFISPLYNG"
FT   gene            71695..72273
FT                   /locus_tag="BMQ_pBM70079"
FT   CDS             71695..72273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70079"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72621"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR021617"
FT                   /db_xref="UniProtKB/TrEMBL:D5E496"
FT                   /protein_id="ADE72621.1"
FT                   /translation="MLSKGIYDRPPMITYPEKVEYVKKQSYIVAAVGKKRPLNAVELTE
FT                   MFFNIERNYFSILLCIGLLQVVKDKEIKNYIKNGMEISEKQINFFNDLLKKEDLLGTVP
FT                   VSMEVTNSTVSPFSEKLIVALFHFLNSIDVTLIGHALSLSMRLDLATYYSKLIGEILLY
FT                   AEKGFNIMVERQWLEQPPQAPNRKGLKRT"
FT   gene            complement(73390..73539)
FT                   /locus_tag="BMQ_pBM70080"
FT   CDS             complement(73390..73539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70080"
FT                   /product="glucose starvation-inducible protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70080"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72622"
FT                   /db_xref="InterPro:IPR019626"
FT                   /db_xref="UniProtKB/TrEMBL:D5E497"
FT                   /protein_id="ADE72622.1"
FT                   /translation="MTTNKNNDKMSREEAGRMGGKATAKNHDKEFYQEIGEKGGKSNNK
FT                   RNDD"
FT   gene            73822..74013
FT                   /locus_tag="BMQ_pBM70081"
FT   CDS             73822..74013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70081"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72623"
FT                   /db_xref="UniProtKB/TrEMBL:D5E498"
FT                   /protein_id="ADE72623.1"
FT                   /translation="MSKQMKDINEIKLLDSEIYLCNQIKDLLKKRDRRNRYSKRHYTEH
FT                   EVLQIALNRLMSELISRQ"
FT   gene            74347..75381
FT                   /locus_tag="BMQ_pBM70082"
FT   CDS             74347..75381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70082"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72624"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR021617"
FT                   /db_xref="UniProtKB/TrEMBL:D5E499"
FT                   /protein_id="ADE72624.1"
FT                   /translation="METIKPIKIGSKKSYPHEKLTSAEVGKLWATYMGNSMSTRILSYF
FT                   LQHVEDQEIKTLLEHALNLSEEFQCTIKEIFVKEKIPVPHAFTEEDVNLGAPRLFEDEF
FT                   YVHYLKYVGKAGMSIYNVAVPLMYREDVRNFYLHCMNSTMELMEQIKTILMNKGFIIKP
FT                   PIIPIAENVKIASPGYLKGFMGDVRPLHALEIAHLYDNIESNVTSKTLIMAFGQVAKMD
FT                   KVREVFKKGEEITLRSVDHYMEKLRDDNLPAPSLLSHLVTTSTFSPFSDKLMLFHKVDM
FT                   FSMKIRAFGNSVAVNGRHDLVALYGKSLADIFMFVEEASKLMMENGWMEVPPEAADRED
FT                   LASN"
FT   gene            complement(75527..75778)
FT                   /locus_tag="BMQ_pBM70083"
FT   CDS             complement(75527..75778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70083"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72625"
FT                   /db_xref="GOA:D5E4A0"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4A0"
FT                   /protein_id="ADE72625.1"
FT                   /translation="MDIIKIILLGILLFVITIFALIIFLKNLNMLAKLYTNSTQAYHNA
FT                   SHRKEVRNILLIKFTLINGGTILTLIIMYFIITIYVFQ"
FT   gene            complement(76279..77811)
FT                   /locus_tag="BMQ_pBM70084"
FT   CDS             complement(76279..77811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70084"
FT                   /product="BCCT family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70084"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72626"
FT                   /db_xref="GOA:D5E4A1"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4A1"
FT                   /protein_id="ADE72626.1"
FT                   /translation="MNKNISKHSVFYISILLIVVFIIWGGFFTKNFTNITTITYNFIID
FT                   DLGWIYIGVAFFLVLFSVYLLFSKYGHIRLGKETATPEFKTGSWLAMLFGAGMGVGIVY
FT                   WGVAEPVTHYVNPPHGEGYTAASANTAMKYSFFHWGLQPWGIYTVISLALAYFQFNKGL
FT                   PAAISSAFYPLLKNRIFGPIGQTIDILSVFATVFGIATSLGLGAMQISAGMHALFGIPD
FT                   TILVQMIVIGLGTILFIASISTGLEKGIQYLSNIAILLSFLIMFLVLVLGPTSTIFGTM
FT                   FNSLGSYLTDYVQMSLHLTPFGDNTWLGDWTLFYWAWWIAWCPFVGMFIARISKGRTIR
FT                   EFVIGVLFVPTLGTCAWFAIFGGTALHIIQNLGHPELAKQITANVSLSIFNFFDYLPAS
FT                   STLSMIGFAVVVIYYITVADTSSYVLGMLSERGNLNPSTKIKITWGIIQSATAAVLLLA
FT                   GGLTILQTASLVAAFPFAIILVLICWSLVKALRADANSRETKLTKQSKYVEK"
FT   gene            complement(77804..77998)
FT                   /locus_tag="BMQ_pBM70085"
FT   CDS             complement(77804..77998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70085"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72627"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4A2"
FT                   /protein_id="ADE72627.1"
FT                   /translation="MEEDDLNKYFAPEYYRATSNVLEVEMENWIMNKGMLNYVLIYIPT
FT                   IPIFGQSKNKKGAISTYYE"
FT   gene            78770..79444
FT                   /locus_tag="BMQ_pBM70086"
FT   CDS             78770..79444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70086"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70086"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72628"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4A3"
FT                   /protein_id="ADE72628.1"
FT                   /translation="MKLYQVRKGQFVYYNNELHRVYSVKPLYKQSVHLIRLRDLTQHLT
FT                   KAARVERYKPQNLDSFVFNRQAFTLCNDRKAEEGDYILITNPHPDSLDYYSLNEIEIVS
FT                   TVEKNGVITTKSNGIRHSEYLLMVPGRKEDSRPIDYQDGGNMVDEDLNTFESNQLETNN
FT                   LDLEMPNIGDVYKKNNSDILIKTMVVSIHGETIFLGGDLQLSKEELADTTKWQFLYNLQ
FT                   DK"
FT   gene            complement(79820..80092)
FT                   /locus_tag="BMQ_pBM70087"
FT   CDS             complement(79820..80092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70087"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70087"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72629"
FT                   /db_xref="GOA:D5E4A4"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4A4"
FT                   /protein_id="ADE72629.1"
FT                   /translation="MKATGIVRKIDNLGRVVLPIELRRTLNIKNDESVEIFVDNENIVL
FT                   KKYSPNLACKVTGEVSEDNLILAKGKVILSREGVKQLLRELEVKL"
FT   gene            80861..81001
FT                   /locus_tag="BMQ_pBM70088"
FT   CDS             80861..81001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70088"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72630"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4A5"
FT                   /protein_id="ADE72630.1"
FT                   /translation="MSVYKQVFSTFVNEERFDLHSYLTYLFINECQEDVVNQLEQEHVN
FT                   Q"
FT   gene            complement(81281..81688)
FT                   /locus_tag="BMQ_pBM70089"
FT   CDS             complement(81281..81688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70089"
FT                   /product="universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70089"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72631"
FT                   /db_xref="GOA:D5E4A6"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4A6"
FT                   /protein_id="ADE72631.1"
FT                   /translation="MYRKILLAVDGSEHSKRAAKHAINVASLVPGAKVEIISVIDLSKV
FT                   KTEVLHGELRQKRQQALEGIKSTFEKENVSYELKIERGDPGPTIVSYANKHDFDLVIIG
FT                   SRGLNSLQEMVLGSVSHKVAKRVHCPVMIIK"
FT   gene            complement(81703..83169)
FT                   /locus_tag="BMQ_pBM70090"
FT   CDS             complement(81703..83169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70090"
FT                   /product="inorganic anion transporter, sulfate permease
FT                   (SulP) family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70090"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72632"
FT                   /db_xref="GOA:D5E4A7"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4A7"
FT                   /protein_id="ADE72632.1"
FT                   /translation="MLNKLKMEWFGNVKGDILSGIVVALALIPEAIAFSIIAGVDPMVG
FT                   LYASFCIAVVMAFVGGRPAMISAATGAMALLMVTLVKDHGIQYLFATTILTGVIQLIFG
FT                   IFKIARFMKFIPRSVMVGFVNALAILIFMAQVPHFVGISTMTYVFVALTLVIIYGLPRI
FT                   TKAVPSALVAIIVMTVAAIVGGFNLRTVGDLGEITKSLPMFSIPNVPLNMETLSIIFPT
FT                   ALGLSIVGLTESLLTATIVDDMTDTPSNKNKESRGQGIANIVAGFFGGMAGCAMIGQTV
FT                   INVKSGGRGRLSTFVAGVFLMFLILVLGDWVVKIPMAALAGVMIMVSIGTFDWSSLRTL
FT                   TKVPLTDTVVMLVTVITVVATHDLSKGVIAGVILSAIFFAAKISKLEVSSKESEHRTVY
FT                   NVKGQLFFASVQDFVNSFAFKGQQDLILIDFSEAHIWDDSAVAAIDKVVLKLKEQTSAE
FT                   VKLTGLNDVSDELVQKLATYNKPNAKPSNH"
FT   gene            complement(83395..83604)
FT                   /locus_tag="BMQ_pBM70091"
FT   CDS             complement(83395..83604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70091"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70091"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72633"
FT                   /db_xref="GOA:D5E4A8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4A8"
FT                   /protein_id="ADE72633.1"
FT                   /translation="MDKETIKLIRKSYNLNQRNFAKMVNCSFSLIALVEVGKRRVTENL
FT                   ENKIREAFQLNEQKINEMNSLFYQ"
FT   gene            83836..84378
FT                   /locus_tag="BMQ_pBM70092"
FT   CDS             83836..84378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70092"
FT                   /product="resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70092"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72634"
FT                   /db_xref="GOA:D5E4A9"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4A9"
FT                   /protein_id="ADE72634.1"
FT                   /translation="MIIGYTRPYSEDENLDKQLQALQAYNCEKIYQEKTNSLKKRVEFD
FT                   EMLTSLQEGDIVVVYKFYCIADSTRHLIELIEYLSENHIHFVSILDDVDTSTLEGKTFF
FT                   NTIKRIGQFQHDVISERTKAGLEEAKLKGKSGGRPKKPDYNVHRALDMYWSKKYTIAQI
FT                   TEATGISKTTLYRYLDN"
FT   gene            84929..86089
FT                   /locus_tag="BMQ_pBM70093"
FT   CDS             84929..86089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70093"
FT                   /product="transporter, monovalent cation:proton
FT                   antiporter-2 (CPA2) family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70093"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72635"
FT                   /db_xref="GOA:D5E4B0"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4B0"
FT                   /protein_id="ADE72635.1"
FT                   /translation="MEFVLSLALILFATKIAGHLSVRLGQPSVLGKLLIGIILGPAVLG
FT                   WIHNDQFVHYFSEIGVLLLMFLAGLETDLEQLKRNWKAAFAVAVLGIILPFIGGFGVGE
FT                   LFGLGATYSLFIGVLLCATSVSITVQVLKDMNRLNSREGSTILGAAVVDDVLVVVLLAI
FT                   MISFLGTGEEVSLGLLVGKKLIFFIGAVLAGWLVVPKVLDWLTNLKVTEPVVSIGLAIC
FT                   FGYVYFADLMGMAGIIGAFAAGIAISQTSYRHTIESKVEPIAYAVFVPVFFVSIGLNVS
FT                   FEGVGDQIGFILLLSVIAVITKLVGGALGAKVTGFSTRSSLLIGSGMVSRGEVALIIAA
FT                   TGLQESLLLPEYFTSAVIVIIITTLVAPPLIKYIIQSESKITQMEK"
FT   gene            86216..86401
FT                   /locus_tag="BMQ_pBM70094"
FT   CDS             86216..86401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70094"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72636"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4B1"
FT                   /protein_id="ADE72636.1"
FT                   /translation="MKRINKSAYLIKTDDDITIIDKYLSTCFEKEERYFLVNITDQPNR
FT                   HSGMSTLSIDSWMDNI"
FT   gene            86619..87026
FT                   /gene="crcB"
FT                   /locus_tag="BMQ_pBM70095"
FT   CDS             86619..87026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="BMQ_pBM70095"
FT                   /product="crcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70095"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72637"
FT                   /db_xref="GOA:D5E4B2"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4B2"
FT                   /protein_id="ADE72637.1"
FT                   /translation="MNYLLVGVGGVIGSLLRYYLGVFTHSWWAYDFPLGTLIINLIGSF
FT                   VLGWLTTHIIKMKLLHPSILAGIGTGIIGSFTTFSTFSVETVTLIQHGLWLFALLYVVL
FT                   SLFGGLLMSWLGYKVGNHAARNLQRKEEHTS"
FT   gene            87023..87376
FT                   /locus_tag="BMQ_pBM70096"
FT   CDS             87023..87376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70096"
FT                   /product="CrcB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70096"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72638"
FT                   /db_xref="GOA:D5E4B3"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4B3"
FT                   /protein_id="ADE72638.1"
FT                   /translation="MSVLLVGIGGFLGAIARYVLGTWMNKKSSKGLPIGTLFINLLGSF
FT                   LLGWMVGQGVTSGLYSFLGIGFIGSFTTFSTFKLESVQLHQNKKHSMFYSYLAYSYIGG
FT                   ILLAFVGISLSVL"
FT   gene            complement(87400..87537)
FT                   /locus_tag="BMQ_pBM70097"
FT   CDS             complement(87400..87537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70097"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72639"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4B4"
FT                   /protein_id="ADE72639.1"
FT                   /translation="MKDFLRGIGKERMHKKAVFYTYARPHKNSLYESSIPFKGCCFFDV
FT                   "
FT   gene            88016..88972
FT                   /locus_tag="BMQ_pBM70098"
FT   CDS             88016..88972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70098"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70098"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72640"
FT                   /db_xref="GOA:D5E4B5"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4B5"
FT                   /protein_id="ADE72640.1"
FT                   /translation="MTIKKTISQLIEKRRTWGYGAAIAVTPYLLIKIAWTFGLFMPTEQ
FT                   MGDISWRTANAITMVLAAVGILLAFAFSMPWGEKLPAWLVVFPVWVGTGLLIPMLLLAP
FT                   VLGPAAMIRDQKMGAANVWVYEQIFVIISLVGVGICLPFALAGYAKTRWPEAFVGPIDI
FT                   DLLPGNSQKLYIALARLVASGCILLGFIKLFWAAGGTIGINPSMLDNRDLWWHLLSLST
FT                   GVWAFAGSWGLLVLTTRRGSKSFFPPMATAWIASGMLFSYNLFNRLSATRPDTQPAPEY
FT                   PLAHVLTTELGSVLGVMMIMIILMVLHDRRRAMRSAA"
FT   gene            complement(89263..89664)
FT                   /locus_tag="BMQ_pBM70099"
FT   CDS             complement(89263..89664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70099"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72641"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4B6"
FT                   /protein_id="ADE72641.1"
FT                   /translation="MKRSLFILSIVIIVLIINGCSNNSVKGIKADYVDIGLGQSLYEGY
FT                   NKVEQESVQSLVNSYNQLQYIGQTNQQLNYDKAISIIFVYQDKISGTLMIDDKGIFHTD
FT                   DSTKNYQIASNNDTYEQALKIYKDLKQKY"
FT   gene            89984..90538
FT                   /locus_tag="BMQ_pBM70100"
FT   CDS             89984..90538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70100"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70100"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72642"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4B7"
FT                   /protein_id="ADE72642.1"
FT                   /translation="MKSVKNIVFFVLLLFIISACSNSKDIKLSKADAIITNNKDLVGET
FT                   VRTIGEGKSQTTVDTALYYTFVVKNNSNKSISNEDLNQIKLKIKPNQELLSVVEDTVGS
FT                   NIYNVNKSKIGGGQGIEEIPAHGTGKFTIYYNLSTDKQGNKLPSIPTKEELKRIKENAL
FT                   KSTLIVSENGEEIAHFNLNKN"
FT   gene            90852..91190
FT                   /locus_tag="BMQ_pBM70101"
FT   CDS             90852..91190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70101"
FT                   /product="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70101"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72643"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4B8"
FT                   /protein_id="ADE72643.1"
FT                   /translation="MEISREILKGHIDTLILSLLYQRDMYGYELAKIVREKSDEQFELK
FT                   EGTLYLSLKRLEKNNWISSYWGSEQGPGGRRKYYKLTSLGKQGFEDKRLEWQFIKKMMD
FT                   SFLWGGTK"
FT   gene            91187..92029
FT                   /locus_tag="BMQ_pBM70102"
FT   CDS             91187..92029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70102"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72644"
FT                   /db_xref="GOA:D5E4B9"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4B9"
FT                   /protein_id="ADE72644.1"
FT                   /translation="MKRIEAFVDSMYLNVDGDKQEIDELKAEMKNHLFESVQELKEEGK
FT                   TEQQAITIAIQRFGEEKEMRAVIGQLFEIQKIFAKRVLYIAIVCLILTISMGSFLWKID
FT                   DSTAQGLSETSTLISKELENKDVMTFSMKRKIETLVEDTNYISEVTIYNSKDIRSVSQN
FT                   SGEYHWKSQNPDFQYQRTIWAPKWLGVDSSTSGNGNEQWFVLIESRSFDQLQVIVIFMG
FT                   GAIYWTLFTIWAIINAHHQKRLRIRWIFIFVGLNVLGYLLYYFTGIRSVSSKEHENLY"
FT   gene            92136..92426
FT                   /locus_tag="BMQ_pBM70103"
FT   CDS             92136..92426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70103"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72645"
FT                   /db_xref="GOA:D5E4C0"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4C0"
FT                   /protein_id="ADE72645.1"
FT                   /translation="MSYGVSVFFILVLMCIIASQSYLPKWLKWLVGVYYSLGILLFSYL
FT                   QTRLADKWYVHTPVPDEYWDANSRLTDLFAAVFFIPVCILFSYYIITGSKN"
FT   gene            complement(92807..93220)
FT                   /locus_tag="BMQ_pBM70104"
FT   CDS             complement(92807..93220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70104"
FT                   /product="hydrolase, NUDIX family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70104"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72646"
FT                   /db_xref="GOA:D5E4C1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4C1"
FT                   /protein_id="ADE72646.1"
FT                   /translation="MDFNRVDVAYSLLLDKSESKILMVLNRNNSWSLPGGGVEKGETLK
FT                   QAAIREAKEETGYDIEVDGIVSLNEAFIDNNHIFFVVFKARLIQEPSQIPKEENILKVE
FT                   WIDLKTADNLMPYYPNGISSLINNSNAQYIIQR"
FT   gene            93405..93926
FT                   /locus_tag="BMQ_pBM70105"
FT   CDS             93405..93926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70105"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72647"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4C2"
FT                   /protein_id="ADE72647.1"
FT                   /translation="MDKQIIIENYTSDWALSFHEEKKLLKDIISDIAISIEHIGSTSVK
FT                   GLGAKPIIDIMIGVYKLEKVGGFIEPLSNIGYEHVFHKEFPNRRFFRKGLWRAGTHHLH
FT                   IYKYESEEWNRNILFRDYLRKHPDVRNQYKQLKIELAQKYSCDRVGYTEAKAPFITDVI
FT                   QKAKGETKGR"
FT   gene            94041..94610
FT                   /locus_tag="BMQ_pBM70106"
FT   CDS             94041..94610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70106"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70106"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72648"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4C3"
FT                   /protein_id="ADE72648.1"
FT                   /translation="MKTFILVRHCKAEGQEEGAILTEEGKKEAINLITYLNKVNCKITK
FT                   IISSPYERAVKTIEPYAKEVGLSIQIDNRLSERRLSNKSLTNWLELLKQTFDDIDLVIE
FT                   GGESTREATERAINLIREEIEYSKEQNTLLVTHGNLMSLILRYFDESFGFNEWANLTNP
FT                   DVYRIDIEDNQISIKRLWDPMAYHSI"
FT   gene            94772..95506
FT                   /locus_tag="BMQ_pBM70107"
FT   CDS             94772..95506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70107"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70107"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72649"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4C4"
FT                   /protein_id="ADE72649.1"
FT                   /translation="MLKNRKIIVTGAGSGIGKDIVRLCLDEGATVIACDINKHSLDELN
FT                   SNLDNSNSLYTYQLDVSKYENVVEFFNYIDSRHSDVNGLVNNAGIYLAKNILDYLEHDI
FT                   DKVLDINIKGFIYFSQMFGKRVIGKEANGVIVNMSSVSGMEGSSDAIYGLSKAAILGLT
FT                   KSCAMNFSPYIRVNAVAPTMVNTKMMNTIPDWRKEEYLDHQLIKSPVTPQDVADTVVFL
FT                   LSDKAKHYTGSTFDINNGGYLR"
FT   gene            95659..96198
FT                   /locus_tag="BMQ_pBM70108"
FT   CDS             95659..96198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70108"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72650"
FT                   /db_xref="InterPro:IPR025075"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4C5"
FT                   /protein_id="ADE72650.1"
FT                   /translation="MHRWKFDNGSKKKTRGIKRKSRTFAKSITEYTTSLPSPEDNSYLG
FT                   YWHLHMPFNESFIDSKNTSNSVRKLCMQTMINRMQHLIDIRTELEKDYRIYILISLPKL
FT                   FDSQIVVLFDKEDLKGFFDRDTDEQRWIPLSPERSIEKEWGLEIPKELVIKGYKEIIND
FT                   EDYFHEGELWFIGELG"
FT   gene            complement(96385..96666)
FT                   /locus_tag="BMQ_pBM70109"
FT   CDS             complement(96385..96666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70109"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72651"
FT                   /db_xref="GOA:D5E4C6"
FT                   /db_xref="InterPro:IPR025434"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4C6"
FT                   /protein_id="ADE72651.1"
FT                   /translation="MAIMYMIVIFTVTCLLLLSSRMSKKVSSLKYIIPLIIGVISLGIV
FT                   IISSFYGGLTGFGIGVINFAILIGSILSIIIILISEIIKSKILKKTYQ"
FT   gene            96844..97515
FT                   /locus_tag="BMQ_pBM70110"
FT   CDS             96844..97515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70110"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70110"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72652"
FT                   /db_xref="GOA:D5E4C7"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4C7"
FT                   /protein_id="ADE72652.1"
FT                   /translation="MLQSLIFDMDGTLFQTDKILEMSLDDTFNHLRTLNQWDTSTPIDK
FT                   YREIMGVPLPKVWEALLPTHSDEIRKYTDDYFLKRLVENIRNGKGALYPNVKEIFSFLK
FT                   ENNCSIYIASNGLKDYLEAIVDYYELNNWVTETFSIQQIQTLDKGNLVKTIIKKYGIKS
FT                   AAVVGDRLSDINAAKDNNLLAVGCNFDFAQADELAQADVVIDDLIELKTIVLKINNSSL
FT                   I"
FT   gene            97546..97860
FT                   /locus_tag="BMQ_pBM70111"
FT   CDS             97546..97860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70111"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72653"
FT                   /db_xref="GOA:D5E4C8"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4C8"
FT                   /protein_id="ADE72653.1"
FT                   /translation="MSTFSKIIPSILILLYIVIFFLDISYHYGVPYLYSFFLFLFLSLI
FT                   SLLLCLLIWFKNKRSLFLIFAGVSLLQLIFTVFVYLLPEAGTKPLIYEKVIKKEDFSNK
FT                   "
FT   gene            98290..99894
FT                   /locus_tag="BMQ_pBM70112"
FT   CDS             98290..99894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70112"
FT                   /product="Polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70112"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72654"
FT                   /db_xref="GOA:D5E4C9"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4C9"
FT                   /protein_id="ADE72654.1"
FT                   /translation="MDTKFIRGTFFLTASTLISKILGFIYIIPFTALVGNSGYALYKYA
FT                   YGPYTLMLSISTMGLPLAVSKFVSKYNGIGNYRAGQDLLKFGLYLMIFTGVLSSIILYS
FT                   LAPFLAEMVISKQDSTGNKLEDVIYVIRLVSFALLIVPPMSLLRGYFQGNQSMGPSALS
FT                   TILEQVVRVIFIVLGAYIVIKFSHSVTKAVGIGTFGAFVGAIAGLSFLTFIYYKRRNLI
FT                   KKQMTDSNFNQRIKPLPMFKELISYAIPFVLVGLAIPIYQNIDTFTINVLFQSIGYKQD
FT                   QAESINSVIGLAQILVMVPVSLATAFGMSLLPGITSSYVKGNLKEVKEKMNKTFQILMF
FT                   FTLPAAIGLCLLGRPIYIMIFGMNNSPVLGGVILQWYAPMAILFALFTVTASILQGINQ
FT                   QKKVIIGMFLGIVIKLILNFILLTNFKEIGPVLATYGGYMVSVLYNFYLIKKAINYKLF
FT                   PLVRALALPVSLVIVMSIVVLIANYLVTTYLATKLSMYHLAITTSLFCVFVGGIVYIGM
FT                   SLKTKMLREVLVRRKNA"
FT   gene            99921..100310
FT                   /locus_tag="BMQ_pBM70113"
FT   CDS             99921..100310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70113"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72655"
FT                   /db_xref="GOA:D5E4D0"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4D0"
FT                   /protein_id="ADE72655.1"
FT                   /translation="MNKIKKVLVLFLAILISTIIVLSVIFINWEHIFGDTRPIANAKAM
FT                   YQLEFKDKDIAETTDVDNNIMYVVPKGHLDTYIEMMKKKGYTLTEKDDKHHTLLLKKRN
FT                   NFTEISYKSLTSRYTIISSPFLKEV"
FT   gene            101256..101441
FT                   /locus_tag="BMQ_pBM70114"
FT   CDS             101256..101441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70114"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72656"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4D1"
FT                   /protein_id="ADE72656.1"
FT                   /translation="MQNLTELEVENLRHLIGAHGTLINKLEQYAQECNDPQLTAMLQKD
FT                   ARDARNTKQQLISFLG"
FT   gene            101455..101703
FT                   /locus_tag="BMQ_pBM70115"
FT   CDS             101455..101703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70115"
FT                   /product="Coat F domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70115"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72657"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR012851"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4D2"
FT                   /protein_id="ADE72657.1"
FT                   /translation="MNEKDIVNDYLAGLNASLTGYANIISQTNNQQLYETLIQIRNQDE
FT                   TRQRSVYEYAKQKNYYQPAAPANSTIVQQLKNQLQQG"
FT   gene            complement(101989..102504)
FT                   /locus_tag="BMQ_pBM70116"
FT   CDS             complement(101989..102504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70116"
FT                   /product="DinB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70116"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72658"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4D3"
FT                   /protein_id="ADE72658.1"
FT                   /translation="MTHHSLELYDYHVWANHKIFDRLKELSEDIYEKEIQSVFPSISKV
FT                   MAHIYVSDNIWLDFISGEKFDEVYASADQLREQMETKRIEEVETMFFDLSDRYKAFLDH
FT                   QEDMEMAIVLETRFAGRLETRLSDLVQHVVNHGTYHRGNITAMLRQLGHPGVMTDYVLY
FT                   LYERDTKE"
FT   gene            complement(102525..102794)
FT                   /locus_tag="BMQ_pBM70117"
FT   CDS             complement(102525..102794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70117"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72659"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4D4"
FT                   /protein_id="ADE72659.1"
FT                   /translation="MHKTCSLYTSNSTHLSKEIPLYQGCIKSYIFYKSDPGRTLTPIRI
FT                   LFWDVFLKEVLRKQETPLGKRSGGYFYRIIVKLTTDTLYYVDSE"
FT   gene            complement(103516..104370)
FT                   /locus_tag="BMQ_pBM70118"
FT   CDS             complement(103516..104370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70118"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72660"
FT                   /db_xref="GOA:D5E4D5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4D5"
FT                   /protein_id="ADE72660.1"
FT                   /translation="MNDKTRLEALSTFLKAKRAQIKPESIGLPAGTRRRTPGLRREEVA
FT                   QLAGVSTTWYTWLEQGRDIKVSSIVLDCISTALQLNSDERDYLYNLALETKLEIVHPKK
FT                   DQLELSPSLKRILAELTYCPTIVTDRHCHIVGWNPAAAHVFLDFEQIPNDQRNLIQLVF
FT                   ARKELKALAVNWEHFAKGFLAIFRTYYGHYLGDEWYNQFISQMSHLHPEFQALWNESQV
FT                   SKAPEMVIEFRHAKAGKMLFNLTSLQVQGDMDLRCSIYTPVEETDTENKLKRLMKRASI
FT                   EKL"
FT   gene            104492..105727
FT                   /locus_tag="BMQ_pBM70119"
FT   CDS             104492..105727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70119"
FT                   /product="Beta-ketoacyl-acyl-carrier-protein synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70119"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72661"
FT                   /db_xref="GOA:D5E4D6"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4D6"
FT                   /protein_id="ADE72661.1"
FT                   /translation="MERVVITGMGVVSPIGNNIRTFWNNLIKGESGISSIDTFDITDHK
FT                   AKIAGIVRDFDADEILGKKEARRLDRFSQFAIAAAEQAWADSKLDLNHIDPERLGVYVG
FT                   SGIGGIETLIENIDALRQKGPRRVSPTLVPGMISNAAAAQISIKWNAMGPSMSPVSACA
FT                   IGNTAIGEAFRLIRSGEVDAVFAGGTEAAITDLSVASFGNATALSTRNDAPTQASRPFD
FT                   EDRDGFVMSEGAGILILESLSHALRRGAKIYAEVIGYGASSDAHHMVATHPEGKGAYLA
FT                   MKAALKNANIPLEEIDVISAHATSTKVGDISETKAIKELFEKQAYQIPITANKSMIGHM
FT                   LGAAGGVEAIALAMSLKEGIIPPTINLENPDPLCDLDYVPGIARQVKINTGVSNSFGFG
FT                   GHNAAIVLKKYE"
FT   gene            complement(106001..106132)
FT                   /locus_tag="BMQ_pBM70120"
FT   CDS             complement(106001..106132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70120"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72662"
FT                   /db_xref="GOA:D5E4D7"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4D7"
FT                   /protein_id="ADE72662.1"
FT                   /translation="MYRLNPHKYGPWALELSYIKVSIAAVISLVIAYMVSFGFKRHK"
FT   gene            106392..107612
FT                   /locus_tag="BMQ_pBM70121"
FT   CDS             106392..107612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70121"
FT                   /product="impB/mucB/samB family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70121"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72663"
FT                   /db_xref="GOA:D5E4D8"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4D8"
FT                   /protein_id="ADE72663.1"
FT                   /translation="MRSCFASVSSVIRGLDPLKIRLAVVGDIKRSGSVVLAATPLLKNE
FT                   GIKTGSRLFEIPKRKDIHVVNPSMERYIKTSNYISSLVLQYVAPEDFHAYSIDELFIDA
FT                   TASLHLFARTPEELAHKIINEIYRKTRLTATAGISPNLLLAKVSLDHEAKHSPTGVAYW
FT                   RYEDIPFKLWSIHPMKDFWGISSATERRLHRLGIHTIKELALSSKEKLQKEFGILGEEL
FT                   HQHANGINYSRISDVYIPSSRSFGKSQILFRDYTNRKEVELLLLELLDDVCFRLRMHQV
FT                   VAQTIRLSIGYSKQTGGGFSRQKKMGRASNLSQDIFPYCLTILHTYDNGMPIRSIGISL
FT                   SNTSIEEEEQMSLFDDIDQRERAYTLAKTIDDIRLRYGKNSVLRASSHLPYSTARYRKG
FT                   LMGGHKA"
FT   gene            complement(107867..108847)
FT                   /locus_tag="BMQ_pBM70122"
FT   CDS             complement(107867..108847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70122"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /EC_number="1.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70122"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72664"
FT                   /db_xref="GOA:D5E4D9"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4D9"
FT                   /protein_id="ADE72664.1"
FT                   /translation="MKYVKLGNTGLDVSRLCLGCMGFGDANKWLHQWVLNEDDSRIVIK
FT                   EALDLGINFFDTANVYSLGTSEEYLGRALKDYANRDEVVIATKVHGQMHKGPNGSGLSR
FT                   KAIMSEIDKSLKRLETDYIDLYIIHRWDYDTPIEETMEALHDVVKAGKARYIGASAMYA
FT                   WQFQKALHVAEKNGWTKFVSMQNHLNLIYREEEREMLPLCKEEKIGVTPYSPLASGRLT
FT                   RDWSVTTHRSETDQIQKSKYDATADSDRLVVERVASIAEKHGIPRTHIALAWLLQKEPV
FT                   TAPIIGATKTSHLENAVDALSIKLTPEEIAFLEDPYVPHPIVGHN"
FT   gene            complement(108934..109688)
FT                   /pseudo
FT                   /locus_tag="BMQ_pBM70123"
FT   CDS             complement(108934..109688)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70123"
FT                   /note="4-carboxymuconolactone decarboxylase, frameshift"
FT   gene            109929..110831
FT                   /locus_tag="BMQ_pBM70124"
FT   CDS             109929..110831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70124"
FT                   /product="transcriptional Regulator N/C terminus, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70124"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72665"
FT                   /db_xref="GOA:D5E4E0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4E0"
FT                   /protein_id="ADE72665.1"
FT                   /translation="MSNTPYKQQYELSRLIERLCKQDGVHPTTIPSLFLIRESIITEPI
FT                   SRVNEPSFCIILQGEKEVLLGEERFLYGPGHYIVASVDLPVTGQVIKASADSPYLAFKL
FT                   EFTSSQVLEVLNGTDFKTGQGKNAKRAMYVSEIEPSLLNAVVRLASLLGTPKHIPVLAP
FT                   LLKKEILYWILQGPHGEALEQMALEGSNASRIREVIDHIINNYEESFRIEELAEIANMS
FT                   VSSLHRHFKDVTAMSPIQFQKRLRLQEARRLLLAESLDVADVAFRVGYESQSQFSREYS
FT                   RMFGFPPRVDIKRMREHYV"
FT   gene            111876..112268
FT                   /locus_tag="BMQ_pBM70125"
FT   CDS             111876..112268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70125"
FT                   /product="cold shock domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70125"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72666"
FT                   /db_xref="GOA:D5E4E1"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4E1"
FT                   /protein_id="ADE72666.1"
FT                   /translation="MKLLKVLFSLFAINPTTCYTADNLFLFGILRKEKTLIRSFYLEIV
FT                   CLGKIGNTFVEYSTAGGNIMTQGTVKWFNADKGFGFIEIEGGDDVFVHFSAIQGEGFKS
FT                   LEEGQKVTFDIEQGQRGAQAANVHKS"
FT   gene            112322..112513
FT                   /locus_tag="BMQ_pBM70126"
FT   CDS             112322..112513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70126"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72667"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4E2"
FT                   /protein_id="ADE72667.1"
FT                   /translation="MIRKPLFTYKEIDVEKEAFLCVNGIGMLLFSTDVGYTYTFSFTIQ
FT                   HIKPYYGIKLKIRWEMLV"
FT   gene            112510..112722
FT                   /locus_tag="BMQ_pBM70127"
FT   CDS             112510..112722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70127"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72668"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4E3"
FT                   /protein_id="ADE72668.1"
FT                   /translation="MRAKIEKANHVVMFETTGEFYAHEVTQGPKVGFFACPSCGVKVYH
FT                   KQDHFFSHDHARTCTYVQEQSKIKF"
FT   gene            112827..113111
FT                   /locus_tag="BMQ_pBM70128"
FT   CDS             112827..113111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70128"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70128"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72669"
FT                   /db_xref="GOA:D5E4E4"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4E4"
FT                   /protein_id="ADE72669.1"
FT                   /translation="MKGLSTLRKIDAVGRIVIPIELRKLLDIGKDDEVEIILEDDHIEI
FT                   KKYKESNECLITGEITPQSRRYANNLVLSPLGAKILYNEIKDKQKTFES"
FT   gene            complement(113133..113777)
FT                   /locus_tag="BMQ_pBM70129"
FT   CDS             complement(113133..113777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70129"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72670"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4E5"
FT                   /protein_id="ADE72670.1"
FT                   /translation="MRVEEKKRKIRSDKKRDVKPSLPIDLKECIYRLSYITNTPVKSVV
FT                   ESICIAGLASSKVMDYLSNYFRRGFSLGSTVYMGDMSKEPIRHLYKNIEKERVSTRLKD
FT                   GQGETYDVLKRLAYALDCSPALAASFLIEASIRNSDFVDEYMTRHLEEELDQGRIKELK
FT                   EVLKFINKNNPYKEEYSLHNLISYIMDELKVGATSLGSSVQNWLESIQHKK"
FT   gene            113912..114037
FT                   /locus_tag="BMQ_pBM70130"
FT   CDS             113912..114037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70130"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72671"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4E6"
FT                   /protein_id="ADE72671.1"
FT                   /translation="MRGVFCMKMTKKEAQEIAKKIKENSNKYGLPVKKKKNASAT"
FT   gene            complement(114294..114977)
FT                   /locus_tag="BMQ_pBM70131"
FT   CDS             complement(114294..114977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70131"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70131"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72672"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4E7"
FT                   /protein_id="ADE72672.1"
FT                   /translation="MQLLDPHFNKENQEDKRSILDVHAQLEDGSRVNIEIQLNNKHDME
FT                   KRTLYYWSKMYSSQMKEGMDYGELCKTITINIVNFRYLSHIHNYHSTFQLYEREQKLLL
FT                   TDMLEIHFMELPKLLIKWRNREVDPREDQVLKKAMDEWERVSQDPEVLLAYEARRKALL
FT                   DEKSALKRAEKLGEEKGKQIGEEIGEKKGIIKVALSMIQKGLDNQTIAEFMNLTPEEIN
FT                   KLRRQ"
FT   gene            complement(115427..115801)
FT                   /locus_tag="BMQ_pBM70132"
FT   CDS             complement(115427..115801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70132"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72673"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4E8"
FT                   /protein_id="ADE72673.1"
FT                   /translation="MSERQNAFTIKTNQLSDEVYDILAKYAKSRKLGDYISSLIVRDLH
FT                   RSSNDQVDSGHRTEELLEHINSELKELKQLAKTNGFVVKQEDIEDKPSESQTLKEGKIA
FT                   DLEQVSGSLDDDDLEEYSDF"
FT   gene            complement(115819..117000)
FT                   /locus_tag="BMQ_pBM70133"
FT   CDS             complement(115819..117000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70133"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72674"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4E9"
FT                   /protein_id="ADE72674.1"
FT                   /translation="MKISRFNKDCGNSVDMNIMDGYLFDFPTNVVELQKEAADSFFTDA
FT                   VTAPEEFKKRILLSTTIGDEETERYFLVGDIAASQQLANNHINHLHNKITSHIPYVTFL
FT                   AAIAYYHALHAKDPKDNNIQIDYFSTMLPIWLLKKESTFGEAQKAMATRFLGDHTFRIH
FT                   TPGFEKELKVAVDESACLKEGEIARFALKKDLTLQDREDANEYVECETVMVDIGGGSID
FT                   VVILPEGLKAANSRESFQSIEGIPYLAHIDKLRKEKFPELFTDLRAFDQFILDNYSKQK
FT                   FELKNENTGAAIDLTAQITSSLKEYVEILLAKLNDVAPPPANKIRKYVYSGGVAPTLEV
FT                   AIMKSMSEKIGEERTEKYHKVPEDSRHLNLFGLEIRSIGYLQKKQAEKKAVKS"
FT   gene            117710..118066
FT                   /locus_tag="BMQ_pBM70134"
FT   CDS             117710..118066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70134"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72675"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4F0"
FT                   /protein_id="ADE72675.1"
FT                   /translation="MKLVCKSCEIEISNVLTELNDISLIKEEMEEDYIPQGYFLIVNEE
FT                   DKVDEKGTIIINMKDLINSNHHPDGDRLNGCCGLDGLDGMNRVCINDHEIGTENSDCWM
FT                   PHYIAINPNMVNFT"
FT   gene            complement(118239..118604)
FT                   /locus_tag="BMQ_pBM70135"
FT   CDS             complement(118239..118604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70135"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72676"
FT                   /db_xref="InterPro:IPR024984"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4F1"
FT                   /protein_id="ADE72676.1"
FT                   /translation="MKRFIVATALVLCLTGRMATCTEAAPKPSITQKHTDFYDAFLMLL
FT                   NPYAEKAIRTKYPDRSYSLWNANILSLKRVSGGFSNYDFVMKVKYHTFTGPHNPPEGPL
FT                   VITFSVSNEVKILKVEG"
FT   gene            118962..120248
FT                   /locus_tag="BMQ_pBM70136"
FT   CDS             118962..120248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70136"
FT                   /product="transposase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70136"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72677"
FT                   /db_xref="GOA:D5E4F2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4F2"
FT                   /protein_id="ADE72677.1"
FT                   /translation="MNCTQNEKLNQVTPHTLIVGVDIAKFKHVARAQDDRGKILGKALT
FT                   FTNTKEGFEGFFAWLEEMQHKHEKSDVLVGMEPTGHYWLNLAYTLKERLVSFGVVNPLH
FT                   VKRSKELDDNSPTKNDIKDARVIAQLIKDGRFSYPRLPMDQDAEVKAGITIRNQIVGDL
FT                   QALQGRIHNWLDKYFPEFLTVFKDWSGKMALATLEHIPLPVQLNQTTPERVAEIWSTYG
FT                   GVQRPSHKRIQRLQEAAGRSVGLTVGLQMAQREIATNIKRYKMLKEELHALEKQLEDLV
FT                   LTLPGIAEMLTVPGVGMVTVIELYSELGDIKNFENPRQILKYAGLNLRESSSGKHKGQT
FT                   RITKRGRAKLRALLFRTVMPLVRHNRAFKALHQYYTTRQENPLRKKQSLIVLCGKLVRV
FT                   LHTVGQKQCPFDEERMIRDIPHLSLALGA"
FT   gene            120743..121279
FT                   /locus_tag="BMQ_pBM70137"
FT   CDS             120743..121279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70137"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70137"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72678"
FT                   /db_xref="GOA:D5E4F3"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4F3"
FT                   /protein_id="ADE72678.1"
FT                   /translation="MSKKTALLLIDVQNIMFSYEGGSLWNEQQVLQNITSLREKAYQSN
FT                   VPIIYIQHTDPSSGSMLSEGKVTWEIHQDVRPLPTDIVIQKSSWDAFYQTTLHKKLQEL
FT                   EIEKLVIAGMQTEFCLDTTCRRAYSLGYKENILVKDAHSTFDTAVLSASKIVEHHNNML
FT                   GGRFVTLREVNEIIF"
FT   gene            121581..121655
FT                   /locus_tag="BMQ_pBM70138"
FT   tRNA            121581..121655
FT                   /locus_tag="BMQ_pBM70138"
FT                   /product="tRNA-Cys"
FT   gene            121680..123101
FT                   /locus_tag="BMQ_pBM70139"
FT   CDS             121680..123101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70139"
FT                   /product="peptidase, S8A family"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70139"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72679"
FT                   /db_xref="GOA:D5E4F4"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR008357"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4F4"
FT                   /protein_id="ADE72679.1"
FT                   /translation="MKKTSMTIITTLLICFCFTNYGHAKTETNQYYTVILKDRSKWTQS
FT                   IKKIKKSQGEITYTVPEIGLIQFKGNQKVAKTNASLFKSLSPSLKLEKPSTSTSKSFKK
FT                   PNSSVNSIKGLDSTLPALWDMQWDMKEITHNGESYNIESGSSNVTVGIVDSGIDIDHPD
FT                   LVDNLKSGSKNLVPKGGLRGTEPEETGDINSINDINGHGTMVAGSIAANGEIKGVAPNT
FT                   GIKVYRVFGNKSADAVWIIKAIIQAAKDDVDVINLSLGSYYIDGNIYKDGELLDNKWAD
FT                   VEGYKLAIEYANKLGSVVVASAGNDSIDVSNKSELNDFLKKKYAEEGKTFNGVGIEAPG
FT                   ELPGVVTVSSTGPTQQLSLFSNFGKNYIDIAAPGGDSRLLEKYGQEAWWDGGLFRQEQV
FT                   LTTFNTGRYLFASGTSMAAPKVSATLALIIDQRHYKNRPSNSIDYLYKNGVKKDIEPNL
FT                   AYWGNGQLDVYNAVK"
FT   gene            complement(123137..124564)
FT                   /locus_tag="BMQ_pBM70140"
FT   CDS             complement(123137..124564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70140"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70140"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72680"
FT                   /db_xref="GOA:D5E4F5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4F5"
FT                   /protein_id="ADE72680.1"
FT                   /translation="MIKRLSLKNQFILTFASVIFLSLISTICSLVLLYYFLSVYNEKSV
FT                   QPANYYEKKVPSIEKFVELKGEKILEVSFQKNLEKVIPMEGITYQVINLRGNKIYGTLD
FT                   DQLIENNKSIYEKVNRSDQKGKVITKYLPILDKNRMEGVLAVRYVLASSIDYYIKYIFL
FT                   IILLIPFLFLTLYSYVFARRFGKELNKPIKELSAASQKIKNQDLDFEIKYESENEIGVL
FT                   IDSFNSMKEELKTSLYLQWKLEQERRDMVASIAHDLRTPLTIILSHVEVLMDPSLNGQK
FT                   RLPQYLQTIKNNTQRVLHLTEEMKRVSEVDNPDFTLDIEGVIPIEMLPEMLEEFKKWAE
FT                   DEEIKFTYSLNRKPGEGNSEFALDPKRLHQILTNLISNSIRFTPVNGSIDVQVQIEKDM
FT                   MSFSISDTGKGFDTKDLPFLFSKFYQGDPSRNDQLHHGLGLYIVKELVIKHGGEIHARN
FT                   NEPQGACIEFTISSINK"
FT   gene            complement(124564..125244)
FT                   /locus_tag="BMQ_pBM70141"
FT   CDS             complement(124564..125244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70141"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70141"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72681"
FT                   /db_xref="GOA:D5E4F6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4F6"
FT                   /protein_id="ADE72681.1"
FT                   /translation="MQESILVVDDELEIVDIISDIFEDRGYRVLKAYNGEQALDQLKTN
FT                   VDLIILDVMMPQMDGFDLCKVIREQIYCPILFLSAKHSEMDKVKGFTLGGDDYITKPFQ
FT                   VKELIARVEAHLRREQRDRVSTQNQRLLGNLTINYSQHDVLLDGKKIDLTSKEFKILEL
FT                   LTVNLGQIFSKEQIYEKIWGIDAMGDLNTIIVHINNLRAKLTSGMSTYHIKTVWGVGYK
FT                   LEKR"
FT   gene            complement(125328..127169)
FT                   /locus_tag="BMQ_pBM70142"
FT   CDS             complement(125328..127169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70142"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70142"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72682"
FT                   /db_xref="GOA:D5E4F7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR027022"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4F7"
FT                   /protein_id="ADE72682.1"
FT                   /translation="MISMWKYITKNITRNLSHYTVYILSSILSVAIFYMYAAFLLYPKV
FT                   SGTEQLLIACEIIILLFSCFFIAYSHEHFLRERKKEMGIWKTFGASRKQLFNVLVLENA
FT                   VVGTFSILVGILFGMLLSKIFFNFMSDILFSNQSFVYTFSPVAVFVTVILFGIVFLLVS
FT                   CRSYFKIKRIAVLELFQEEKKPKPSAQFSRVKFILSICFLLVSYIFISYASLPMLLFAF
FT                   LPLLALLLVGTYLFCSNGLVGVISYLNNKEKRQLNGIKMLTLISLRKRLYYNAKIIFIV
FT                   SILLSAIMISIGAIQLYIEKNSQRMQSTHPQGALFVASKGKENKIEDIIAELKRQGIKD
FT                   LHMNKWKGLKISSESGKKQFLVIQNDPSFIKDEDSLKNNNYIFNNKKTDDITNEILKLK
FT                   SEKGERDLKVKNMNGKRVLNPIDGIEGIISVPKNTFSEIYKTTISEKRLSLYKLDFKED
FT                   AKIYNILKKLSDTTLFKSDNLHSIRLLDYENTVQLSSILRLTGLFICLVLFLALASLLW
FT                   FKLYEDMNDDKKVFHSLRKVGLTAKEIKRTLYIQISVIFFVPLSLGGLNLFIATNALQN
FT                   ILEGITIYSIIVIFLIFGVSQFIIYLISSYFYSKKVL"
FT   gene            complement(127141..127920)
FT                   /locus_tag="BMQ_pBM70143"
FT   CDS             complement(127141..127920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70143"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70143"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72683"
FT                   /db_xref="GOA:D5E4F8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4F8"
FT                   /protein_id="ADE72683.1"
FT                   /translation="MAILEAREITKVYKTKYRTYPVLKNISLDIEEGDFVAIMGPSGSG
FT                   KSTLLNVLSSLDIPSEGDIKVGGTTLTGMKEEQLGIYRREHIGFIFQNYNLLDHLTIKE
FT                   NILLPAALKKGDKKGVQNKLQKFAEELEVTKFLTKYPYEVSGGQQQRAAIIRALINNPA
FT                   LLFADEPTGNLDSKSAQNVLHTLKMLNEKYKTTILMVTHDSVAASFCNRVIFLKDGQIV
FT                   HEMKRSKLEDTSKFNQRILSFIAKEVEDNDINVEIYN"
FT   gene            complement(127945..128706)
FT                   /locus_tag="BMQ_pBM70144"
FT   CDS             complement(127945..128706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70144"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70144"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72684"
FT                   /db_xref="GOA:D5E4F9"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4F9"
FT                   /protein_id="ADE72684.1"
FT                   /translation="MKALFISEWERLWSQRKSKWMIGIFTVIVLLQAWFLRYYGVGIYN
FT                   NDQQVPLNTWNFPWFLLKESSFLLTLIFMPVFFLNSLNVEYNSGAYRLFLIRPFKRKSF
FT                   LISKWFSLALMVLVHLLIILGISIAFGFIFLKPDNDFTFYGQQKNAIEAILYTVQVYGL
FT                   FFIIQMCCLALASLISVIISNAVISFFLLIGLYVGCLYVSSQLSFFLLSVQSIFHTLST
FT                   TSNSLYVFAFVIMLVGFGACVRIWSKKEFTS"
FT   gene            complement(128724..129554)
FT                   /locus_tag="BMQ_pBM70145"
FT   CDS             complement(128724..129554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70145"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70145"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72685"
FT                   /db_xref="GOA:D5E4G0"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4G0"
FT                   /protein_id="ADE72685.1"
FT                   /translation="MKGLFTSELERLWSQKISWIILFFIPLMSLGSVKYYLNWNERVSP
FT                   GQPDYVTSLNFPIISISEHLVVSFNIIAIILISTVIANEIENGQLRMILIRPFSTTQLF
FT                   LAKLATILTTMFLYLTLFWILNTVAGYIFFPKVNTLITFLDEQKLSLAAALLYNVKYFF
FT                   ACFVTMISVVSVFTLLGSISRSTMITLGAGVGFIFLAIAIPQLLEFSTQTIIGHSTVVH
FT                   LMYMSIVKIQHTGIAFLLSSTNNLNSYIILVQAVYIALFGLIGYWTFVKRDYFI"
FT   gene            complement(129551..130285)
FT                   /locus_tag="BMQ_pBM70146"
FT   CDS             complement(129551..130285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70146"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70146"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72686"
FT                   /db_xref="GOA:D5E4G1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4G1"
FT                   /protein_id="ADE72686.1"
FT                   /translation="MKKEIVLEANNITKTVSGKNIVSQFSTKVYKGDICGFLGPNGAGK
FT                   TTVMRMFTGLIRPTQGTIMVGGKDVNKDRQQALRNVGAIIESPIFFPYMSGRKMLQNLA
FT                   RLYPDLSRKEQLEQVEAALSVVRLTEDADVKIKNYSLGMRQRLGIAQALLGEPDVILLD
FT                   EPANGLDPMGMRELRELILELREKKNLTFFISSHLLDEIQQMCDHLVIIRNGKLVTQGS
FT                   KEELIKDPSKRLEDVFVEMMTS"
FT   gene            complement(130372..130977)
FT                   /locus_tag="BMQ_pBM70147"
FT   CDS             complement(130372..130977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70147"
FT                   /product="lantibiotic biosynthesis protein, HFCD family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70147"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72687"
FT                   /db_xref="GOA:D5E4G2"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4G2"
FT                   /protein_id="ADE72687.1"
FT                   /translation="MDVKNIVEKKILVGVSGSIAVAGIFQYLAMLKANFSEVKVVMTKG
FT                   AVQLIPAETVKLYCDEVFIDEKLSISGTIGHVELARWADLMAVLPATGNTLSKAAHGLA
FT                   TDLLSTVILAHDKPVIFFPNMNKLMWEKKVVQHNVKLLQQYDHIVVPPVKTTAFEIATM
FT                   SLRPNYVLPNPQNILNIISKQLEERNRLANICEKVEVQ"
FT   gene            complement(131002..132360)
FT                   /locus_tag="BMQ_pBM70148"
FT   CDS             complement(131002..132360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70148"
FT                   /product="lanthionine synthetase C-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70148"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72688"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR033889"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4G3"
FT                   /protein_id="ADE72688.1"
FT                   /translation="MPSTTDQKTYWLKGIDNETRNKALKLVLSIAEKLKDPSGIEKIVM
FT                   APDNVSLAGNLNPWDPITLSHGFPGTILLFGELDRQFPDSGFDLVAHNHLVEVQKVIER
FT                   QGVNSISMFGGITGVAYATLYISHNYERYSRFLQVLNNFILMQLEKILNEPEKELGVHP
FT                   LKYDVIQGMTGIGRYLIENTKHKENHEALKKILTYFVDMASDIEVNGEKVPGWYVSKAN
FT                   QLLEKDRIMFPEGNFNCGLAHGIPGPLSFMALSIQKGIEIPGQREAVLKITNWLMKWKQ
FT                   VDSGWPSRLSFQEVATSKISHSYPKRQGWCYGDPGVARSIYLAGKALGDTAAIRSAVGA
FT                   YQDIIVEPKEEWELVSPTFCHGRAGLLQMLIRMAKDEENQISVQSIVELVHYIEESYDP
FT                   NAPFGFRDIESNGEKSHQLNKAGLLEGVTGVLLPLLSLSSVEEPWWDGAFLLS"
FT   gene            complement(132385..134268)
FT                   /locus_tag="BMQ_pBM70149"
FT   CDS             complement(132385..134268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70149"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70149"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72689"
FT                   /db_xref="GOA:D5E4G4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4G4"
FT                   /protein_id="ADE72689.1"
FT                   /translation="MKNTLDPTMENEKVSFVSILKSFRYWPSLFKLLWETHRGYFFCVL
FT                   VLNFLNGLLPASLILAIKYLVNMVQNLYIQGYKDNYFYDILPFFIFFSVVTLLTSATGS
FT                   ILETHKQLYRNLLSNKINVKLIEKAKRLPYASFENPEVYNKLQRARQDSTYKPFAIFEE
FT                   LMGIVKGAITLISISIILMVWNWEFTLILILLPLISAWSIVNVGKEIFLVSHKRAEETR
FT                   KQFYYYYLMTTDITVKEVKIFGLGSLLLRNYSDLFSKFYNQDRHLLLKKMRIDLSFQLI
FT                   SVIFVIFVQFMIVKDTIQGLIAIGSLIAYFQAVNTTQKTSNELMYMVFNMHQNNLYMTQ
FT                   LFSFLNVPESTDKPNVSEEKTLENVSSTEEGIQFLNVSFKYPGQENYTLKNVNFHIKPG
FT                   ETLALVGSNGSGKSTIVKLLTRLYTDYEGIILLNGKRIEDYQPQDWQDRISAIFQDFVR
FT                   YELDVKENIGYGDYKRSNHLVAIQAAAKRSGALTMIDSLPDKMDTQLGKTFANGIQLSG
FT                   GQWQRIAIARAYMRRASLYILDEPTAALDPAAEEEVFQDFQEIAQKSMGLFISHRYSTV
FT                   KYADRIIVLDKGEVAEYGTHVELLDTNGIYARLFNLQAKSYIEASATQASS"
FT   gene            complement(134234..137512)
FT                   /locus_tag="BMQ_pBM70150"
FT   CDS             complement(134234..137512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70150"
FT                   /product="Lantibiotic dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70150"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72690"
FT                   /db_xref="InterPro:IPR006827"
FT                   /db_xref="InterPro:IPR023809"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4G5"
FT                   /protein_id="ADE72690.1"
FT                   /translation="MLFPLFSSFELYYKRKGRLTLILQKEKFNHKSSVTTENNLFEPLP
FT                   FFMLRAPFLPTHTFDQLKDEAVLVEKLRAYAEKDYVKEAIAIASPSLLNSLHYIHGDLN
FT                   NRKTQQVLSSMLRYMLRMTTRPTPFGAFSGVAAGQFKKNSSLKIDHFKEFKKRARPDME
FT                   WLLGVISVLERSNILPSLIVDKNRASYVVGDRLHLPFSTECGQLRKKGMEKRENISIIY
FT                   SEVVEKVLNLAEERITVREITQRLHTIYPNTDVTIIQRFIIQLLEQEYLITELRPPLTI
FT                   DNPFNYLIRKLEEKDEKIELYEELLKVRELINTYNQLPLGEGLSLYSDLISQMRHIYEV
FT                   TTPLQVDFSLNATDLTIGEKVGEDISKAAQILWSIADEGVGFPHLQKYHVDFLEKYGTS
FT                   REVPLLELLSEELGLGAPASYQNPHGKRGGDTTTSSINQERNSQLSYLLIKAIHNQEKE
FT                   IEITEEIAQRMSKEKDRRYAPDSLEVYGELHAASQEDLDQGNYTFCLSPNPGSNALGST
FT                   FGRFLDILDPDVSLKIQQYQQKIDLEFNEDTVMVEGSFLPATGRSANVAIGKTTRKVNV
FT                   TLGTNGDEETIQLPIDDIVVGASLENFYMKSKKLGKRIKVVAGNMLNYQSAPNIYRFMR
FT                   EISLNDLDQWRPFNWGSMAHSPYYPRIRYKNIVLSPSIWKLNKEVFGMREKPQNEEEFF
FT                   KAFGEWREKWSVPRNVFMTYGDNRILIDLENTLHLRELKNELFKQGRLQLRETLQDRDQ
FT                   NCLNSPLGRHAVEIVVPLKKTENTERRKKIGAIGEAKKDIVSNKIIYKLPGSEWLYVKL
FT                   YAPNARENDLILKYLTPFASEMVKSDMASSWFFMRYRDTDEHIRLRFQGDPSKLSGLVL
FT                   PRLREWADKLMDLGLLQKITIDTYEREVERYGGPMLIEKAEDYFHYDSQSVAMILSTLN
FT                   QQNHLPAYVMASLSIIDIMDNFGLNYAQQVASIENNTEKYEYIDEFRPLRKELSLIGDS
FT                   RNDWENLRNYNSGVGKSIYESFLIRKESLTRYVTEIKELQKRDMLWNEHQMIMGAIIHM
FT                   YCNRLLGANRELEKKALAFTRHILSSQKYWRNKNEEYARSYNGK"
FT   gene            complement(137538..137678)
FT                   /locus_tag="BMQ_pBM70151"
FT   CDS             complement(137538..137678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70151"
FT                   /product="antibiotic protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70151"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72691"
FT                   /db_xref="GOA:D5E4G6"
FT                   /db_xref="InterPro:IPR006079"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4G6"
FT                   /protein_id="ADE72691.1"
FT                   /translation="MNNVKNLFDLDVQVTTASSDVDPQITSVSLCTPGCGDTGSWNSFC
FT                   C"
FT   gene            complement(137753..137893)
FT                   /locus_tag="BMQ_pBM70152"
FT   CDS             complement(137753..137893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70152"
FT                   /product="antibiotic protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70152"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72692"
FT                   /db_xref="GOA:D5E4G6"
FT                   /db_xref="InterPro:IPR006079"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4G6"
FT                   /protein_id="ADE72692.1"
FT                   /translation="MNNVKNLFDLDVQVTTASSDVDPQITSVSLCTPGCGDTGSWNSFC
FT                   C"
FT   gene            138118..138291
FT                   /locus_tag="BMQ_pBM70153"
FT   CDS             138118..138291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70153"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72693"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4G8"
FT                   /protein_id="ADE72693.1"
FT                   /translation="MTKTLWNFLMEMKKNNLTFENYELCPSLNALSPEEKVVLNEYARS
FT                   LVLENEVGNEWV"
FT   gene            138278..139240
FT                   /locus_tag="BMQ_pBM70154"
FT   CDS             138278..139240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70154"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72694"
FT                   /db_xref="GOA:D5E4G9"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4G9"
FT                   /protein_id="ADE72694.1"
FT                   /translation="MNGFRSDLIDHINQHLSSYKQSGRAEVDLLALKHLSKRGKLLNQE
FT                   LSGFSWGELYLTLSYFLKRRKMTEEDFEKAFGIECIFLSADIVDDICDLDDPNLPTFQN
FT                   EDRYLILISQYLLAKGFFYLRPVSDSYEDNCLFSLIMDSGCGEWKDLHFRFSINKRVIP
FT                   TEEEYFKLIKQKSGKLTEIISQAIDPSQLILKKITYYIGIAGQLRNDAADVLNDKKSDL
FT                   RDLKAYLPFLKAYEYSCEVQDEFFHKLKDEEIMASPLKRQLIREYIEQSGSIDYCHILS
FT                   RFYYMRAFKLLEEHFKLSKKEMNYFKSLFLQRSQQHEQA"
FT   gene            139227..141377
FT                   /locus_tag="BMQ_pBM70155"
FT   CDS             139227..141377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70155"
FT                   /product="ATPase, histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like domain protein; putative sensor histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70155"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72695"
FT                   /db_xref="GOA:D5E4H0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4H0"
FT                   /protein_id="ADE72695.1"
FT                   /translation="MNKHNLLICLPLGTLYIIIFMANGYYLYLSDFRRFVDSATLNSFY
FT                   VTSVISLIFFSIGLFSFFKKQKSIVIKNFFLLTSVSGIAISTSVLSSQDIPVFKTIEII
FT                   SVFMLSYLLLSFFAHFPVSTKPNYVKIIIFSSLLFSTLSSVVYLICNYLGYVEHSKFFY
FT                   IYRVLLIGNLFFSIVGCIFLISLHLKTNSLKVRNQLYILIFGIVFSFGPLFLFNLIPGM
FT                   IFGESQIPFVYCLPSIIVFPLTTSYLLVKHEIIEVELEISKWINILIYYILNFLLFSIL
FT                   IKQFMHLSNRELFVICSVGLLSAWASIFLYKIGINTFIQKKTKNRENTDLNEIELFQTL
FT                   SKEKHAKNLAKIIGKVIHQKFDINGLCIVWNSNNIYHSLHETGIFQTMNQFNFLNEINK
FT                   LEKDILLVEDQTPSIHMHFEKYHLICFPIAINQLVQGVIVIGEKNNHTLFQGKEFIELK
FT                   ELICESADILSSAAILNINDKQIRRTKTRVQNWNQFNHQVIQSLEKERKRLSIFLHDEI
FT                   LQSLILQLNEVRIMQTKRNFSVTLLDEMDDQLEGMIYNIRKMCHDLHPIIVEDLGLEPS
FT                   LQSLKREFELNYSILIHVQFNCEFKIISKNHEIQVYRIIKELLNNAVKHSKGKNIKVLI
FT                   LEENGFYQCSVKDDGIGFDVPDNFFDFSKGNHLGLLTIHRQIAELNGSMRISSDKGQGT
FT                   FVTFTIPLDWEDKNEYTYATSG"
FT   gene            141349..141957
FT                   /locus_tag="BMQ_pBM70156"
FT   CDS             141349..141957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70156"
FT                   /product="DNA-binding response regulator, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70156"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72696"
FT                   /db_xref="GOA:D5E4H1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4H1"
FT                   /protein_id="ADE72696.1"
FT                   /translation="MSIRTLLVDDHLLVMLGIRRLLESEEDIEIIDTVSDPSSLIEVVA
FT                   TTSPDVVVTDVRMKEFNGIELTKELLSKFPEIKVVILSGYDHEEYYNAAFKAGASAYIT
FT                   KERSAFDLANAIRQSNMGYILFSKNQISTKDFETLTSAEQKILLLISKDKTNYEISMDL
FT                   SISKRTVEYHISSIIRKLDVDSRVGAVVKGIKKGLIEDF"
FT   gene            complement(142311..142430)
FT                   /locus_tag="BMQ_pBM70157"
FT   CDS             complement(142311..142430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70157"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72697"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4H2"
FT                   /protein_id="ADE72697.1"
FT                   /translation="MYEIGSGWILPAIVGGLARVGISKVNYGEKLFSVTRVKK"
FT   gene            complement(143159..144325)
FT                   /gene="dxr"
FT                   /locus_tag="BMQ_pBM70158"
FT   CDS             complement(143159..144325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="BMQ_pBM70158"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70158"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72698"
FT                   /db_xref="GOA:D5E4H3"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4H3"
FT                   /protein_id="ADE72698.1"
FT                   /translation="MKKISILGSTGSIGKSSLEVIKNNLDKFKVVGLAANNDISTIESQ
FT                   VREFSPKIVSVGDKQLAEKLKINLNNSNVKVVYGEEGLIEVATYSEADQVLVSVSGAAG
FT                   IKPTIEAIKSNKSIALANKETLVAAGHLVMDLVKSHKSTIIPVDSEHSAIFQCLNGENP
FT                   LSMSKLIITASGGAFREKSREEMEKLKAREALKHPNWSMGNKLTIDSATMLNKGFEVIE
FT                   AKWLFDVDFNDIEILIHKESIVHSMVQFQDGSVIAQLGIPDMKLPIQYAFSYPSRINKS
FT                   YTTLSLSDIKSLSFEKPDLIRFPCLDYALNAAKEGGTLPAVLNASSEIANELYLKDKIT
FT                   FLEIERIIYEALNAHSLTNNPNLDEIVEADNWARRYSLNLYKSIIATS"
FT   gene            complement(144351..144959)
FT                   /locus_tag="BMQ_pBM70159"
FT   CDS             complement(144351..144959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70159"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70159"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72699"
FT                   /db_xref="GOA:D5E4H4"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4H4"
FT                   /protein_id="ADE72699.1"
FT                   /translation="MIKSLFDWANLITSLGLIVGTSSIILSINSHFILAMLTMLVAVCC
FT                   DVFDGMVARKFRKKKSNFQDMLGVQLDSLADLIHSGVAPGVFVYTILDSNDLFTLSLVF
FT                   YIVFCCFLRLAYFNCVGLNDKGFFYGLPVFYSPMILSITFLINISLNSNIFFYIFSLIV
FT                   PSLMVITSLRVKKLTQGLAFYLFTIALLSLVTIYGFMVF"
FT   gene            complement(144982..146805)
FT                   /locus_tag="BMQ_pBM70160"
FT   CDS             complement(144982..146805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70160"
FT                   /product="nucleotidyl transferase/aminotransferase, classes
FT                   I and II"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70160"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72700"
FT                   /db_xref="GOA:D5E4H5"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4H5"
FT                   /protein_id="ADE72700.1"
FT                   /translation="MINQAILLCAGRGSRLGINTENKPKPLTDVNGDTILENSIKNLIE
FT                   FGVNRLVIVVGYKNEMIEKVLKEYEDTVDIVVINNKEWDVTNNLYSLYLARQYLKNETL
FT                   LIEGDIFFDSKILKQVDMEEKNLLLASPLNELMEGAFVTAQNNKVTGFYSTKSNEHHNI
FT                   DDPLKTLNIYKLSNDLCVYVKTELEKAVSQNKVNIYYETIFKKALKEGFSFEISKVEPE
FT                   LWMEIDDQYDLSLSEYIFSKTPHEQLKSQHGGYWRYPITDHALIYNFHFPPQELKNKMI
FT                   DRFDNLLLNYPSSSKYFVKHLSKFLKVSEEQLLIANGVSEIIKVLPRIISGKVVLTRPS
FT                   FNEYFNCFSNEQIINFDILEQNNFELDKEGLISTIKSANAKALVLITPDNPTGKLINKT
FT                   DIIDIYEETEQIGTNIIVDESFLDFSSKANETFLNELDKYPRIIVLKSMSKTFGIGGIR
FT                   LGYAATANKELLENLYSEIPIWNINGFAEEFILNLPRYFKEYSKSCNLVRQETDELVDN
FT                   LSDIKQLKVFSTDSNFILCKIKDCLINSNDFAEKLLINHSIYIKECSGKEMIDSEYFFR
FT                   VSSRTAKENKELVSAIHYEIQKVAEQREVLI"
FT   gene            complement(146808..147557)
FT                   /locus_tag="BMQ_pBM70161"
FT   CDS             complement(146808..147557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70161"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72701"
FT                   /db_xref="GOA:D5E4H6"
FT                   /db_xref="InterPro:IPR003679"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4H6"
FT                   /protein_id="ADE72701.1"
FT                   /translation="MNCIGEEIYHAVNQLINDEEIILIHSSLSKLGYKKSKEYQEGIMS
FT                   FLEKLLNENKTILLPSFTFSFTQKRSYNIRKDKSETGILSELAIEFLGFKRTFNPMFSF
FT                   AVKGRKESLFLNSNSQSGYGKGTAVSKITNEKVAIVMLGADWNSCTTIHAIEEEMQVPY
FT                   REYVSWEYPVDFGSGFSNRRFELFARSKDINTVRRFDRIKNELMKDKLLRKSHLNQLEL
FT                   EAANALDVANIAIKKIEEDSYFFVERG"
FT   gene            complement(147572..148843)
FT                   /locus_tag="BMQ_pBM70162"
FT   CDS             complement(147572..148843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70162"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70162"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72702"
FT                   /db_xref="GOA:D5E4H7"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4H7"
FT                   /protein_id="ADE72702.1"
FT                   /translation="MERQVYNLAICGCGPAGISPLVYLEENKLLEKYLDEGICLIDEKE
FT                   NIGAGKLINYNITANSLGKVFLEIFQKENSSLYKHLMSKESYKNISSKLESAPYLKEVG
FT                   NLLQDIGSYFIDKIRDRNNGEVYNNHKILEVKRNKKNIFEIKLQSFDNKFKTILARHVI
FT                   FNIGGKQNELFEKEKTVIYSDDFISGLHDDFVNEFSNSENKTVISIVGSSHSAFSSLYR
FT                   LKNNFNFLNRNNIKIQVFNRSNIKLFYNSVEEAINDNYQFNMDQDVCYLSNRVNRYSGL
FT                   RYDSFILAKECMSHKYKNVEIKNKEFTESDFLDSSLVICATGYTNKSVEILDSNHEEII
FT                   FQLEQGQLLTDHYCRPYIHNSNNVFEKFYTYGLGSGIKTNPKNGGELNYTGRIDGVWVY
FT                   QHEVSKRIVEDISYSIQAENKVNI"
FT   gene            complement(148856..150043)
FT                   /locus_tag="BMQ_pBM70163"
FT   CDS             complement(148856..150043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70163"
FT                   /product="phosphoribosylglycinamide synthetase, ATP-grasp
FT                   (A) domain protein"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70163"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72703"
FT                   /db_xref="GOA:D5E4H8"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4H8"
FT                   /protein_id="ADE72703.1"
FT                   /translation="MNVVILNRFPLDKIKYHEWFDSSHKIFLFSKVQDEVHKSDYHYAK
FT                   FYEDYDSSNLVTQDIINLNKSIKIDKIIALSEKDILRAGNLRTFLHVPGMNKKTSWLFR
FT                   DKVAMKNILFESNIPVTNFKEIDDITDIITFFDKYGKSVVKPRREAGSRGVTIIKSQED
FT                   LQALLNSNYFSPDDNNKWMIEKFVDGTLFHVDGLFGSGKVQNFFISEYLTSCLDLINGK
FT                   PLLTTTLQENDNNYWDIFSITERALRALSNGFPCLFHAEVFISNQGKPFINEIACRIGG
FT                   GKIYPAIKRKFGFDLMKQYIEFEMGKEPLKFSIKAKGYAGHAQLFIEKGIVSYVDQIPN
FT                   KNWMLDCEINFKLGETLHAKNKKDFSIIIEGDSKEQIDIRLNEALKWFYESIEIK"
FT   gene            complement(150040..151263)
FT                   /locus_tag="BMQ_pBM70164"
FT   CDS             complement(150040..151263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70164"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70164"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72704"
FT                   /db_xref="GOA:D5E4H9"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4H9"
FT                   /protein_id="ADE72704.1"
FT                   /translation="MSNSVALLIETPRTGAGMDFVKACEKLDIKPIILISSPESQPKWV
FT                   MDDYYKNGIEIKKVNTYNYEELLSFVKRMQESYKIKAILSLYEYSTYIAAKLAKELNLK
FT                   SPNPEIVNILRDKSKFRSLVSKLKVDNTDFKVLSNGDLADYHLNYPVVVKPVNLTGSAF
FT                   VRLCKDSQSLQEALKEIKGIGQYTGQTVAKDVLIEEFIDGEEYSVEIMNASIIAIIRKH
FT                   TTSPGFIEVQHELPANISDEKIKRINNYIYDFLDLIDYKFGLMHLEIKLDKNDIHFIEA
FT                   NPRVAGGRIPELIRQVYGYDIILEYLKSLVEKGEPAPLNITGKKAVIKFFVARKNGILN
FT                   QYPDFKLNNFPNVLEVKFYKNLGEHFTINFSNKDRILHVMAIGESIDAGINTINDFYES
FT                   INLEECIK"
FT   gene            complement(151285..151569)
FT                   /locus_tag="BMQ_pBM70165"
FT   CDS             complement(151285..151569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70165"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72705"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4I0"
FT                   /protein_id="ADE72705.1"
FT                   /translation="MFSYYKKSYKVVHSKPQDGSWIRFDGLSFEDIEEQAANFKIMPPT
FT                   ITRFIIKFRVLNLNVPITVLRGNNQNDWLDFIKRKEHARVYDQPVVNFN"
FT   gene            152172..153422
FT                   /locus_tag="BMQ_pBM70166"
FT   CDS             152172..153422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70166"
FT                   /product="transporter, major facilitator family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70166"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72706"
FT                   /db_xref="GOA:D5E4I1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4I1"
FT                   /protein_id="ADE72706.1"
FT                   /translation="MKFKNLKKNLKVRIVTGFFQRIISQMIVPFISVYLASFYGATIAG
FT                   FLTIIIIITGILSSFLGGYVSDNKGRRPVILIAEFTSFLALLLMALFNSPWIINPIITY
FT                   MLFLVSNALTFFSKPALDAMVIDITTPKERKYVFSINYWSINLSISIAAIIGSIFYQNY
FT                   FFEVLVSCSIGTLVIFIVFLLFIKESKPDIIPKLINENLPRNNFIKDYKNIIMDPIFLK
FT                   FFIASVLMLGIESQLMYYISVRLTENFPTTKLFHQWSLSGLEVYSFLRFENTIGVVILA
FT                   LCFKSVLKNYSDKVKFYAGIILFTLGFSILGFSNSFWILVTSMFVLTFGEIIYIPIKQA
FT                   ILSILVVDNHRTKYMAVYGLHQRFGMIIASLTLTISPFLNPYFISFFMIIMGIGSLFFY
FT                   RSVINEKETKQLLEKIS"
FT   gene            153529..154179
FT                   /locus_tag="BMQ_pBM70167"
FT   CDS             153529..154179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70167"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70167"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72707"
FT                   /db_xref="GOA:D5E4I2"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4I2"
FT                   /protein_id="ADE72707.1"
FT                   /translation="MGKAIIFDMDGTLFQTEKILEISLHSTFNDLRNKNLWKEETPIEK
FT                   YRNIMGVPLPVVWETLLPNHAQNIREHANHIFHIQLIKSIKNGKGALYPNIEETFEKLS
FT                   QYFQLYIASNGQKEYLREIVEYYGLNRWVQQTYSIEEIQSGNKSDLVARIRANHQITEG
FT                   IVVGDRLSDIKAGKDNNFFTVGCRFDFSQENELKQADIIISDLSELLNCFQLI"
FT   gene            complement(154445..154915)
FT                   /locus_tag="BMQ_pBM70168"
FT   CDS             complement(154445..154915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70168"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72708"
FT                   /db_xref="InterPro:IPR032693"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4I3"
FT                   /protein_id="ADE72708.1"
FT                   /translation="MKKSVSIVLIFILSLMLNACSLEQDAASLYKQEAPLESQIIIPKS
FT                   FSNNEKETIKVILTQSGKRVKNPDYVHFEIWKQDGSVKYNMEAAENEGNGTYSLSKELD
FT                   HDGLYYVKVHASNDNSIIMPQKQFIVGKLSKSELELLQKGVQKQTEAHEHHH"
FT   gene            complement(154943..156331)
FT                   /locus_tag="BMQ_pBM70169"
FT   CDS             complement(154943..156331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70169"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70169"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72709"
FT                   /db_xref="GOA:D5E4I4"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4I4"
FT                   /protein_id="ADE72709.1"
FT                   /translation="MKNKNEENLVRYSEKSAKASTSNSFYRTVWRWHFYAGIIFAPFLI
FT                   ILAFTGSIYLFKPQIEQVLYKDYYNVNPQGYAMSASQQIEEVKKLYPQAEVTKYWPGDN
FT                   ATRSSEVSILSNGKSLTVFINPYTGKSLGELNDKDRIMDRIEEFHGELMAGKVGDRIVE
FT                   LAACWAIVLIISGIFLWFPRKKTSLSGVLFPRIHKGKKIFRRDLHVVPAFWITGGMLFL
FT                   IMTGLPWSGFWGNNFQTLTTNSGVGYPPSIWIGSAPQSITKTKDIADVPWAAENLEVPV
FT                   SKIQGLTPLSIDDVVHIANREKINSSYTVYIPQKKEGVYTLSAFPPRAQDEVTMHIDQY
FT                   SGAVLADYRYDNYGLIGKIVALGITLHKGTQFGFINQLISLLICLGIIFVIGSGLYLWW
FT                   KRKPKKELGAPKATSIKNIKSFLILLVGLGFLFPLVGLSLIIVCLVDLLIIQRLSVVKN
FT                   FMNA"
FT   gene            156694..157230
FT                   /locus_tag="BMQ_pBM70170"
FT   CDS             156694..157230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70170"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70170"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72710"
FT                   /db_xref="GOA:D5E4I5"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4I5"
FT                   /protein_id="ADE72710.1"
FT                   /translation="MGISLFFLLGLIGIMFLLIFKGKILSRIKQEGRWVQTLQKKSWFE
FT                   SPYSSGIILFLWNTLMTGVVAFFIFILTKVNIPFLHLVILGIGTIISIWAWSIFNIAWI
FT                   GSRKNRFKMASIGSSFYAILGVYALYRYLTLKPSYPGEDLFMAALGLMAVLIIAVVALL
FT                   TCFVFTGFPKKEQLY"
FT   gene            complement(157320..158189)
FT                   /locus_tag="BMQ_pBM70171"
FT   CDS             complement(157320..158189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70171"
FT                   /product="peptidase families S8 and S53"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70171"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72711"
FT                   /db_xref="GOA:D5E4I6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4I6"
FT                   /protein_id="ADE72711.1"
FT                   /translation="MRSVKIKFIGLGIIIIILIGLCYSFMYSKELKVDKQVTKEEKKLS
FT                   NENWYFSYLGFDKNHYTGKHVKVGVIDTNIDTTLQKKVEKYVSLTPITKEEAHLHGSKM
FT                   LEVLYNVAPSADVYHYGISPSDEDVRPDFLVKAFKAALNENVSIINISLNFKKEIPALT
FT                   PLLEKAHKQGVTVITSTGNEGLNTVNFPAGSSYTIAVNSVEKDGVIADYSNYGINVDFS
FT                   LPGSATIDGKEEYGTSVSAILLTGMVARIMEKSDKNLNSDEIMRILQKMSGNKQKTLIV
FT                   GYGTPKIN"
FT   gene            complement(158170..159474)
FT                   /locus_tag="BMQ_pBM70172"
FT   CDS             complement(158170..159474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70172"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70172"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72712"
FT                   /db_xref="GOA:D5E4I7"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4I7"
FT                   /protein_id="ADE72712.1"
FT                   /translation="MWNKLYNVILYSLIIVLGFFSLKYFSTNYQVVAEVNGKEIHKKDV
FT                   NKLLEDKYFDNARDNYIDQQLIDLEKAKINPPTNKQLKESFRYYQLVDRKATDLESKKG
FT                   EVGNFYYNNALIKKYTVKNKELNSYVEEQEETLGDKVYNLYKLEGDHTLINDIDKAIKQ
FT                   GKSIEDIQKEKNISFKKDIVFSKDNIYDVDLSQYKKGDSIHIHSSMEDEHTSHDMEGMN
FT                   MDEHTSHDMEGMNMDEHTSHDMEGMNMDEHTSHDMEGMNMDEHTSHDMEGMNMDEHTSH
FT                   DMEGMNMDEHTSHDMEGMNMDEHTSHDMEGMNMDEHTSHDMEGMNMDEHTSHDMEGMNM
FT                   DEHASHDMEGMNMDEHTSHDMEGMKDMNAQDNDNNEENTETHTLLIISDIKDNYKLNLK
FT                   ENKQEITNNYIANNYYKEQIDLNNYLRAKYEIRKD"
FT   gene            complement(160488..160982)
FT                   /locus_tag="BMQ_pBM70173"
FT   CDS             complement(160488..160982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70173"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72713"
FT                   /db_xref="GOA:D5E4I8"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4I8"
FT                   /protein_id="ADE72713.1"
FT                   /translation="MNIKIIYTIAGIIVLGLILIIPITIIGSSQIEKYSYYKAESVNLS
FT                   KENLNGIKIDEDFEKIKKNIKDLNDKSDNWFTYKDGTRVKVSKKNIVNSVSTESNNTVT
FT                   QKKVGLNSSFKEITSLYGEKYYKREEQSFEIIGYPDKKLKINLEFWFLNDKLEKILLVK
FT                   K"
FT   gene            complement(162105..162272)
FT                   /locus_tag="BMQ_pBM70174"
FT   CDS             complement(162105..162272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70174"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72714"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4I9"
FT                   /protein_id="ADE72714.1"
FT                   /translation="MDLFLRNIDPIALKKIDKIRKEKRFLAKISLKVGLDRREVLREIK
FT                   DYDKGRKEKS"
FT   gene            complement(162519..162734)
FT                   /locus_tag="BMQ_pBM70175"
FT   CDS             complement(162519..162734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70175"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72715"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4J0"
FT                   /protein_id="ADE72715.1"
FT                   /translation="MVTAGSHKLEKDVVKKKIKNDGKANTESKIAIKKDAIQYSDESIQ
FT                   PYEDEQRSLQKKPKKLNEKQQDLAMK"
FT   gene            complement(162838..162969)
FT                   /locus_tag="BMQ_pBM70176"
FT   CDS             complement(162838..162969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM70176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM70176"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72716"
FT                   /db_xref="GOA:D5E4J1"
FT                   /db_xref="UniProtKB/TrEMBL:D5E4J1"
FT                   /protein_id="ADE72716.1"
FT                   /translation="MSPRGSLHFEVFFEKNKAEASDFFIFVHTFMSKTAIWFYLQYK"
XX
SQ   Sequence 164406 BP; 54403 A; 27678 C; 27374 G; 54951 T; 0 other;
     atgacaaagc tctttacctg ctatttagaa gatgtaaata ccttcaatgg acgattcaca        60
     tggttatgga aagaaaaaac gacccttcgt aaaaggaaag aagtgttttt agaaacactt       120
     cgtacttact ttaaacaaca acaagtagcc ctacataaag tattccctaa aaaacgtatg       180
     gaaatgttag attacgtgat ttataacctt gtcgctacag gcattcaagc cattcactca       240
     aaaacactca tgcaaaaatt tgatgtgtcc caaagtaccg tttctcgctt tgtaaaatca       300
     ttaaaggaaa caccatttat gatcgtggca cgttatatca aagaagatac aacaggtgct       360
     catcctgata gctatgtgtt tatccttaaa agccataaga actttgatca aatttgtgat       420
     gaaatctttt ttgaccatga cacaacaggt gttcaaacgc ttcaacaaga agaaatgaca       480
     actcctgtga caactcctgt gacaagtcca gaaagtgccg aaaacgttga tataacaagc       540
     tttgaggacg aaaaaacatc gtcccccttt attaaccttg atttacctgt aaatcatata       600
     aataatcatt taatatctgc ttcacagtca tttgcttata tcaaaggtgt gcctaagaaa       660
     gtaaatcatg tgtatgcaag taaatatggt catcaactaa aagattttta tgctcgtatt       720
     caaaatgcag caaaagctgt gaaacgagat acagagattg agattatcaa agagcaagta       780
     catgaagtcg cttatacagc cattgtaggc ttagataaat atgtccatga ggctaatcat       840
     aagggtactc ccctatcact ggatgacatg tgccgtcttg tttatcaaat tgcctacaat       900
     caatttacaa atctactaaa agggaataca gaagaacaat catctaagtc agacatacat       960
     actgaagcta aaacagcagc gttatttacg cctaaacata tcatccgtaa ggaattggtt      1020
     cctgcttggt taaaagctga acaggagcaa aaagagtcta cacaagaaac agctatttct      1080
     ttggatcaac agcttgaaat gattcaatta aagcaagatt tagggcaaga actaacgcca      1140
     gaagaagaaa acttactcca agagcacagt actacataca gttcgttaga aatggcgcag      1200
     ctgaaacagg atctaggaca agccttaaca ccagaggaac aagctttatt acacgaacat      1260
     acccaattac aggacaccgt ttcgtaatca aaaagtgaag aaatcccttg gaagctgatg      1320
     tttactaaga gtattattat ttagaacatg tttctaaata attaatatat aaatctatgt      1380
     aggaggagat cacgatgcca cataaaatga cactaacagg atctgcgaca ggtccattac      1440
     gagaatacga tcgttacgtt gcctttgata tgcgagaaaa aggttcacct tctgcgccta      1500
     aaggtctgaa gaagagtacg tttatttcgt ataccgtgtt tgttgcgaag aaagctttta      1560
     ataaaaccgg actgacaaaa aagagtatta tgcatgaaaa aatcttaatt caaggggaac      1620
     caaccttaga tattcccatt gacgagtgcc ctggggaaat tggtatcatc tgcttccaga      1680
     ttaccgttct cccgaataaa aacgataaag aaaccaatga ttcaaaagat aaaaaagaag      1740
     cgaaacagga ggtttctaag gcacaacaag aggttgcagc tactaagcag gaagaaaaac      1800
     aagctcctgt ttctcagcct gtagcaaaag aagagaaaaa ggctgcgcca caacagaagc      1860
     agctatcaac tcagccaaaa gggacacagg atgtcgtgag ctttgaggag attatagttc      1920
     cggaagcctt cttaaagaca cgcccaaacc ctgaaaaaac gcaaaaggtc attgattttg      1980
     tgaaacgtac aggatactta gatgaaccgt taacgattga gaaaggctct aagatcttaa      2040
     aagatggcta tcgtcgttat attgtggcca aaaccgttaa aatggataaa gtgccggttg      2100
     tatatgcgta tgagaaataa ttcgtttttt caccgtttat gactgcgtag caatgagagg      2160
     taatcttgta tcaatgttta ttggactagc agtgtctata tgtgtttctg catccaaggc      2220
     agaagaaaca ctttcaatat tgaaaaattt ataaactgac agaataagta acttgtgctg      2280
     ttgtagcttt aaaatgaaat ataaaccaaa cttttttata aaattaaatc gttacttcag      2340
     ataaatcagc atttaaagaa cccttttgat cccacttttc ctaaatcaac atataaagcc      2400
     taaaggctaa aaaaacacct aaagatgata taagtcatta agtgggttct cttgtcagta      2460
     tattgacatc taataaaaat tgaaaaacct ttaaggttaa tttgttgact gaagtcaacg      2520
     gatatttaag acagtgaaaa tttatatttt tattaactaa gttacctcat ttacagaaat      2580
     tccatttcta aaataggtag ctttattttg tgttgcttta atttacaaaa aatacagatg      2640
     atgttaaatg atctattgag ttgaacctac atcaaactaa aaatgctcgc tagttgaact      2700
     taagatgatc taatgatgga ttctcttgat cttttaaact tatatggaag aatgatagaa      2760
     ttaagtttat ctataattga acttaaatga taagattatc gtatttttta cgaaacgcac      2820
     gatctgatat atcagatgta attatctgat accttatatg tggaaggaat atctgatacg      2880
     atctgataca tagcgtgcgg attgattgca aagctgtttt tggtgtcttt agatatacaa      2940
     atgtgttaaa atcatctgat acataaagaa caggctatct gatacgtgta aaaaataaga      3000
     agatttgatt cctgttaggt aaaggttaaa aaaatatcga ttcttgaagg gtatcagatg      3060
     cgtgtcagat aatattaaag gggagagagg tggtttttta tggacaatgc ctttgaagtt      3120
     gaggtaggga agagtaaata taagaaaccc tcagaggtag caaaaatatt tgatatgcca      3180
     gaaagcacgt taagaaaata ctcaagggta ttagaggagg ctggctatgt ttttagaaaa      3240
     ggcgagaaaa gaatgcgcct atatagccct gcggatgaat tagtcctgta caagatgctt      3300
     aagaggatta aagaagagga tgagggttta gcgaaggcgg ctgcatttgc aatagaaggt      3360
     caagactcaa aggtaactga tacggatctg atacagagtg tatcagaaga agttgcggca      3420
     actgttcaag aagaatcttt aaaacccttt cttgaacagg tcataaacaa actgacatat      3480
     attgaagaaa atacagtgag caaacaggaa tttaatgagc tagtaaagct aatgcaaaaa      3540
     gcattggatg agaatgtaga attaagacgc caaaacaaag aaaaagaaga ccaactagac      3600
     tttatgtctg aaaaatttga tcgtgttata aatctcgtag aacgtaatga acgtgagaag      3660
     gacacaaaga aaaaaggttt tatgtcacgt tggttcagta gttaagtaaa cgtccaactg      3720
     gttcatctag ttcttatata aatggtggat atattataca ggcgaatgct atactaaaaa      3780
     aggttaagcg ttttaagaat ttcagcatac tgacatctac gttttttatc gttgtaaaga      3840
     agaagatcct gttttcaaac aggatcttct tctttttata taaaatgttt acaatcatag      3900
     catatccgca acaaagaccg cccattatgt attagtgtat aaggaggtct taactgtatt      3960
     catgctatat gattatgaca aaaatatcga cattattcta actcttacat gagtgatatt      4020
     catatactat ttattttata gtttattata tgttgtaaat gaattttctt gcggaatttt      4080
     ttccccaatc atttctatgg gtgtaattgt aactaattta atttacttat tgcattccat      4140
     ttaaaaccat taaattggtt tccttgccat attttacata gatagtttgt ttgataaaat      4200
     atagtttaga aacttcttca tgaggttttt ttcaatggga aaccccttta tccaaatttg      4260
     ttaaaagact cgcgctataa aatgtgagtc ttttcttttt tttatttttc agcatattcg      4320
     caacaaagac cgcccattat gtattagtat ataaggcggt cttaactgta ttcatgctat      4380
     atgattatga caaaaatatc gacattattc taattctgtc taagcaatat acatatactt      4440
     ttttgtttta tagtttagta tatgttgtaa atgaaatttt ttgcagtttt ttttctgcaa      4500
     aaaatgaata gtttttttga atgcgtcaat cctttataaa aaggagcgtg ttcatatgcc      4560
     taagataacc aaaaagagta aattaggaaa atacttaatt gaaaagggtt atacccaaac      4620
     gaaaaccgtt aaagcaacta atttagaaag aagtacagtt agtaagattt ataatgattc      4680
     aaattatatt ccatcaggtt ctacaataaa gaaggttatg aatatcctaa agaaacttga      4740
     tccgaaatta aaggcagagg attttttcaa tatataaaaa ggcacaatta tatatgtata      4800
     cctattagcc ccgataatta aaagaaatga ccctctatac taacaaatag aaggtcatta      4860
     atccgtgcct gcctgtcact agtcaaccct cggaaggtga catctctatt cttatccaaa      4920
     ataaacacaa tctaacctgg ctatataaac atatatcttc atttctagtt aacataaaac      4980
     atattatctg tagtctaaag agtaagattg ttagttcatt gataataata ttttcattta      5040
     aataaacggt caatttcttc tcggtcataa tccaaaatcc aatgattata ttcttcgtaa      5100
     agaaacttta tagatttctt attagaggct aatacatcac aaccccgatc atcgtacaaa      5160
     tgaaaaatga tttccttaga gagattaaca aaataaatat cataaccact ttgtgggttg      5220
     tttttaagga tagtagatgg atgagtaaaa tcttcataac aaatagcttt taagagttgt      5280
     acatatttta gttctggttt cttacaagaa agtacaaatc gatgagtgac agattgatca      5340
     tcatcatttt cttctccgtc aaatacactg ggtaaaagct gatgacttaa ttggtatagc      5400
     ttctctttat tttttatgta ttttgaatat acgtttaaag gccttttttg gagaaaaaga      5460
     tcttttttca tagagtgtac atctgtaaca aaaagaatct catcttcttc tctaaatact      5520
     gcttcaaata atctaacaga acgataaaat gcttgctcta aatgttccct tttataataa      5580
     ggtatcaacg gatttgatat ttcaaagcga atactatttt tccaagaata aaatagggaa      5640
     gggcttaatg ttagtctttc aaaatgtttt tctaaaaatg aatgtagaat atcatagttc      5700
     atatattttt ctccgtagtt tttgatttta ttttaacatt tttctaagtg aattctttgt      5760
     atgcgatata aatatctagt taccataatg tctcttaaag gaaccaaaca agcaaaagaa      5820
     cccttgcggc agtagggttc agctaaggat tcttttgctt gtttgtgcat ctttttatac      5880
     atcgttgata tgactacgtt ccttgggtag ttgaaagaaa cgagaatgta taaaaagcgc      5940
     tccttttata catatgccag tacggaaaaa tgtagtctat atggcaaaaa tgtgctattg      6000
     tttacttgcg gttatatttt ggtactttat aattagcagt cctaataaaa agctatctca      6060
     ttctacgaga tagcttttta cttttatctt ttacagcatg ctttcgggta ataaatccaa      6120
     agaaaaaatt agaataataa gagctaaaag aaaagaaata agattaatcc accatttatt      6180
     ctttgattta ataccccaaa tgccaactgg tattacaaat aaatattttg caacggtctc      6240
     atttacattc attacttcag ggagaaaaac acttgctaaa taaagacaaa cagctattat      6300
     taaagaattt ctaattatga ttaacaaaat aagtatcctc cgtaaaatag taccttttat      6360
     acaaacttta ctatattcct aatgataact aaattagaaa ttttgattaa cctaaaatag      6420
     tttatgttaa atttatcttg attccattag aagaattgtt ttttattctc gattcttttt      6480
     gttgtttgac aggaccctta tatttttcca ttaattcatg aatacttgat acctggataa      6540
     tcctaatgtg ctcagaagta acagcatatc gaacaggtgt aatcaccatg acggaaggga      6600
     agatggctgc tcgatcctcc ggttgccagt gcaacgtttt ccactcgtcc gaaaagaaaa      6660
     attcctcata taaatgaatc ttatcctgcg ttttctgttc tgaatactga tttcgttgaa      6720
     tttcgatcca aaacggagat cctttaaaaa tacaaaagag atcgggttca atgcctcctt      6780
     ttcttccagt cggcttatct tcgacaatga cctgtttagg tatactatac gtacacattt      6840
     gtttatagac atccaagata gaaaggaaat gtaatatttt ttgagagttc tttttgatct      6900
     ttgcatccac gggcaaatag acggtcggag aatactgctg tgtacgttca attagcccta      6960
     atcgatataa acgtaccatc acactattac acgcatttac gggcgattta agctgtttaa      7020
     agaataggtc aactaatgag tctcgatcca cggctctaaa ttgattaata aacgctatga      7080
     tgtctttatc acgttgagat aaacggaaac tcatcgctgt tcctccttct ctaataaccc      7140
     aaagatggat tgtggtgcaa cttctatatc cggctctgga tcatgtacca acgccttata      7200
     aggagaaagt atttccttac aagctccttc atctaagaaa aaggcttgaa actctttcac      7260
     ctcatcaatt ttaattttca tacgccccct ggctgcggca tcgatttctt ctgcgccgac      7320
     gactccggct actttcgcat ttatggcatc ggcctgcctt ccagagatcc gaactcttaa      7380
     atttgctttt agtgctgaat tcaacaaatc cgcatcagga cgctgcatgg caataatcgt      7440
     atgaacacct aacgcacgac cttgacttgc aaactgttga attatctcta cgagatccgt      7500
     ttctcgcttg ataatgctca tctcatctac aaccactaca atacgaggca gcttaaaagg      7560
     aagtctgctg atatgagtta caccatgctc taacagtaaa tcgcctcttc gatacatttc      7620
     agctcgtaat aaagcaaaag gttttctcat atccttggcc tcgaagcaaa gcgcatccac      7680
     atgctcaatc ccatgaaaaa gtcctaaatc agctcgttta agatcgacta atactaatcg      7740
     tagatcatca ggcgatgtat atttcaccca tgttgtgagg atcacacgca tgagactgct      7800
     ttttccggcc ccaatttcgc ctgaaatcag taatgtttct agatccgcaa aatcccatga      7860
     aacgaagttt ccatagatat cttgaccaat acatacggga agctccattt tctcaatatg      7920
     aggatgaatg acttcatacc tataattgag catcttaggt aagcttttgt gatgaacggt      7980
     aatgctaaag ttctttaagc tgccattcac ttcaatattg ctgcctaata cttgtcgtaa      8040
     ggcccatctt tttttattta gaagttcagg atcaatgcca tttagtaagg aaaaagcata      8100
     ccgagtatag gtgtgctgat gatcgatccg gtggatcttt ggaaattgat aggaggtatg      8160
     atccccacgc tttatgactc gataaatctc tgctgtacga aacgctttaa taagctttcc      8220
     acgcaatttt agcttttcaa acatctagaa ccctccttaa aacataaatg tcgcaaagaa      8280
     gtaaaataag gctccataaa aggtgacagg taagataacc cgcatcactt tttcaaactg      8340
     atcggcaaga tcgattacac ccaatcgctc taatatctgt tcaatgaatg ctactgctaa      8400
     gacaatgcct cctaggatca aaatagtggg gtcaagcatg gctaggggac taaaaggaac      8460
     aaaggaataa gccttgaagg gacgaggtct cgtgagagat aatttgtgag gtggaagaaa      8520
     gatttttcga aaggtaaatc cttttgttct tctcatgttg atacctactt tcatgctttt      8580
     tatttttttg cctttcatat atctgttatt tcagctcacc gcatccggtc gcccccttcg      8640
     cctcttcggc tcagctccct tacagattcc ataaatggct tcacgaagcg tatacagctt      8700
     gtataaccga ggtaacgata ctgaactaga tactaattag ggaatggagt tacaattctt      8760
     tagatactat gtagctactg cagtatgctt gcctgtccag tcgaaaaata aaaaagaacc      8820
     cttactgcag taggtaaggg gtagctgatt atgtaagaag taatggattt ttatatgcta      8880
     gggtttggcc tagtcgctta tatttttcat gaaatggacg agagatccaa agatgtccca      8940
     acgactagaa ctgaatgtaa tacaaaaaca tttaagctat tgcttttggc ataaaacatt      9000
     tagacgaagc tacttgttaa ataaaaataa tgttgattaa ctgttaaaaa atacttaaac      9060
     cacaaatggt caggttagtt gaaaacggat aaccaatcct agaatgggaa ctataactaa      9120
     aaaattatta taaaattaaa aggaagggaa gaatcctaca tattgttcag tcctccaaaa      9180
     aatataaaaa tacaaattga tgaaaaatat agaatgttag atgatgctca tactaagcta      9240
     acggaaattt gggtggataa tatcgtcttt tcttttggtt ggtggacatc attatttatg      9300
     actattatcc catggctaat atggtttatc tttagaaaca aagagagtaa aactcgttta      9360
     ttattgggag ggctttgggc tatgtttatc tccacgtggt tagattatgt gggggttaca      9420
     atgggcttct ggagatacta taataaacta ataccattaa tgccagatta tatatcatgg      9480
     gattttgctc tgatgccagt tacaataatg tttttcctgc aagttaaacc aaaggccaat      9540
     ccttttatta aagctttaat ttttgcaagt atgacagcat tcttagcaga acctttgttt      9600
     ctatggttag gttattatca ctatccaggt tggaattcaa ttttatcttt tccatttttt      9660
     atagtcatat atcttattgc tcactatttg gttaacagtg aggccactaa gccacttaag      9720
     tgattattaa gattgttatc aggggtaaat atcttttatg atgttaaaga ttctgaacca      9780
     ttaaaaataa aggataatga aatcatttag aacgttcctg gggatagagt aatatatacc      9840
     gcagtaggtg atcgttagat ggtcatagaa tatgtcctct ttttttatat gttggggatt      9900
     ggcctagtga cttatatttt tcatgaaatg gacgagagat ccaaagatgt cccaaggact      9960
     aaagttgaac gtaataataa aaaaggaact gacaattgaa tgtcagttcc cttgtattgt     10020
     ataagtgtag tcatttttca tcttcataaa taaataagcc atttaccaag gtctcgaaat     10080
     caggagctaa ttcaaaaata agtgtgtctg ttccccattc tagatccata taaattacag     10140
     gagggttatc ttttgtattc cgatagtcga atgcaaccca ccaatgtccc tctccacata     10200
     gtagaacaat atcctttggt aactcccatt cttctatata atagtcacta gataaaatgc     10260
     cttcttttcc tattccataa atttcaggga ggtttacatg atcgtctgcc caatttgttg     10320
     gaacaggggt agggtagtca caatatttta aagagcctcc attttgcatt ttacataact     10380
     caatatagga ttttggtaac ttcacaccca acttcttttc tgcatctttg accatttctt     10440
     ctgttaattt ctttgattga ctgtatccat catcccaaat atctctcatt tccccaaccc     10500
     tttcaatcaa taccaactaa atgcttttct tcatgccaca ttctctacat tcacgtaaga     10560
     aaacgccacc ttttacggaa cttttgaagt aagctgagtt gcaattgttg cacctgccac     10620
     taactttatc tggaaattca gcatagtcat acactttatc aagatcgatt tcttgctgct     10680
     ctttcgcttc catattgatc actcttttct aattgccttt tattagatta ccacaaaaag     10740
     tgaaggtgaa attattttat gtaaaatgaa catcaattag ctcacttaac ctcattttat     10800
     ttttcaattc aaatacttca tcgataaaaa caaacaaatt ccccaggaaa tcaacaaatt     10860
     ggataaatcc cttttctgta atacattgtc cctttttgta gtatgtaaga taaacttgtt     10920
     tatttgtatg taatgcttca atcaatatga aattaatttg ttccatttgc tcttctgcta     10980
     aaacaggtta agggatttct agttgtttgt ttacgacttt ttgtaagggt ccctgctaac     11040
     ataagactag caaaattgga caaaaagaag gccgattttc cccacgctaa ggaatcatcg     11100
     acctatactt ttataagttt tgaagctacc ataatcaatt aattgactat cgagtaaata     11160
     atggattctt gtctagtatt ctaatcacca aatccctcta aacattcact tagtttaagt     11220
     ttctggaata attgtaatag cgatggtgcg aactggtgct tctttttcgt ttcccttact     11280
     ctggttatgg tagtatttag tcattaattc gtttaattcg ttttgaaatt gtgtaaaatg     11340
     ttcctcatct atctgtaatt ccactacaga aaaagttgcc ccatcctctt ggctgttttg     11400
     ttcgcctaat tttttaaggt aactttgata ctgtgtcata agtgataatt gataatatga     11460
     aatgtagtct aacttttcct tgctagatag ttctctccac tcacttccgt caatttttgc     11520
     ctcttcctca tttatagcgt aatatttttc agaaacagat tttacttttt tttctttaat     11580
     cacacaaaca ataccagaat caaacataat ttgtagatgc ctatatagag ttgcttgggg     11640
     tacatcttta agaatcttta ccatctctaa tggtgttaac ccattttctc tatttctcat     11700
     taaagcttgg caaattttta ttcttaccgg atgcattaat atttcaactt tagtactcat     11760
     ccaatcacct aattatttat taaatttaat tcttattata aataatgaga ataatgattg     11820
     caacgaatcc atatttaact tatcattatt aataatgata atgagattag gaaggaatgt     11880
     tgaaaatgaa actacattat ggtttaaacg accttaaaga ccttgatttt atggcttttt     11940
     tgccagttat attaccagtt attgcattgg ggacgctttt agttttaatt gcactaattg     12000
     atttataccg aaatagaaag agaagagaaa atgtccttat atgggcccta attattcttt     12060
     ttgttaatac atttggacct attctttact ttgttatagg gagaaaagat ggtgagaact     12120
     cttgaaatta gagattataa atgtaacaaa atcatttaaa gagaaaattg ttgttaataa     12180
     tttctcgttg gagctgaaat cgggggaatg tgtaggttta attggaccaa atggagcagg     12240
     aaaatccaca ttaataaaaa tgatttcaga tatcatcgac ccgaatgctg gtgaagtttt     12300
     attgaatgga aagaaaatat ctaaaatgaa aagagaaatt ggttacttac cacagtaccc     12360
     caattttttt tattggatga cagcgagaga aactcttatg tttatgggac aactttcggg     12420
     agtgaaaaaa gaagttttaa caaactcaat accggaaatt ctgacaaaag ttgggctaaa     12480
     ggcagaagaa aactcaaagg ttggtacatt ttctggagga atgaaacaac gacttggtat     12540
     agcacaagcc ttactacata aaccttctct tattgtcatg gatgaaccgg tatctgcatt     12600
     agatccaatc ggtcgaagag aagttttaaa cctgattgaa gaaataaaaa aagatacaac     12660
     cattttatta tcaacacaca tattaagcga tgctgaagaa atttgtgaac gatttgccat     12720
     tatgaaagat ggaacaaaaa tagaagatac aaaaattacc gaccttttaa atcgcaatag     12780
     cgaaaataag ttaatagtgg aaattacagc gaaggatcga aagtgggtgg acactataaa     12840
     gaaattgcct tacgtgaagg acatagaagt tgttgggctt aaagtcaaag taaaggttga     12900
     aagtatcgaa gaaaataaag cttcattgct acaaaatgca ctcgaacata aagtggacat     12960
     cgttaaattt gaaatgaata acgatacttt agaagaaatc ttcttaaaat tggtggggca     13020
     gaaatgaaga atttgattgt actgataaaa aaagaatatg ttcaaatgct acgtgatttt     13080
     aaggtgattt ggctaccgat tgtttttata tttttagggg cagcgcagcc agtattaact     13140
     cattacttgc cagcaattct aaaagcatta ggcggtagtc agggaattac tattgatccg     13200
     agtatgacag cacaaaaagg aggcgaagta ttggcaagta ctttaggatc tcagtttgat     13260
     cagcttggtc ttatgattct tgcaatttct atgatgggta tcattcaaac agataaagcc     13320
     aatggtatgc tggcctttat tttaacacgt cctgttactg taccttcata tataggagga     13380
     aaaatggtat caaattactt aatggcagct tttagtgtaa caattggata ctttacttct     13440
     tacctatatg taaattatct ttttactgca gttccatttt cacaaatgat tactggatta     13500
     atattttatc tcgtatggat tctttttatc gtatctttca cgacaatgac aagtgctatc     13560
     tttcacagtc aaggcattat cgcattaatt tcaattgttt tccttatagg ctgcaggata     13620
     atcgttggtt tgaacccaat agtggatcaa ttaaatccag ccagtatgag taagcatgca     13680
     atggaaacac taatgacggg attagtagat tcaaatgcag taggtaattt actactgaca     13740
     ttcgtttgga ttttattgac actctttata acaaattatt ggatttctaa taaaaagttt     13800
     agtcatgaat aagtagagaa taatcgtgat gaggatctga gattttttta tctagtttgt     13860
     gccagggaat tcccttccgt ttttactgct ctactattaa cagtagtaat aatgagctta     13920
     cccaaaaata gggtaagctt ttgtattgga aaaaatcagg tttacataag tttaattata     13980
     ggaagatagg tataagcgtg tagagagatg atttatattc agacaaaaaa gattatctta     14040
     ttatactatg tctgaagctc atgtattctc tttcatcagt ctttttacta tcggaatatc     14100
     agcaggagca aaatcaaaat ttgctaattg ttttatagtg gtccatttta aatcatcatg     14160
     aacaaccggt gtcatctcac cattacttac ctctgcccaa tagaataata gatgaatatc     14220
     gtgatcctga gagctatata cactgttgtc atagaaagat ccaattttca cttctactcg     14280
     taactcttct cttatctccc ttacgagaca ctcttcaggt gtttcgccag gttcgacctt     14340
     acctccggga aactcccatt tgcctcccaa agggtccttt gaatgccttt tagcgattag     14400
     tattcgattt ttatctttta taatcgcagc cgtaactttt ttcataaata caccttcttg     14460
     gggttttttg tatacttctt cctttatttt atctgaacaa agtcctttct ctcaacaaag     14520
     aagggaacag taagttttaa gatgaatcga attcaatttc aatgcacgaa gatattatcc     14580
     ttagctaagt gttcaagaac tcttataaat aaaggacgta caattattta ttaattttcc     14640
     taataatttt ttaatgtata cttaacgaag ggaaattatt tctgaataca cgataatttt     14700
     gatttgatat agactgggga aatttattat gaactacttt cttgtcttcc aaaataaaag     14760
     ttatgaagaa gagcgaaaag gtggatattt atgggcacct caaaagaata agaacggtca     14820
     aacatttcat cactggactg atatgacact aattagaaaa ggggatatta tttttaatag     14880
     tttcaatggt aaactagttt ctgttttgac tgcgcaagcg aattgccaag agcacgagag     14940
     gccaactgga ttagagcaat tagacctttg ggaaagagat ggttggttag ttgatgtgga     15000
     gtacagtgat ttagagcaac ctattacata taagaaatat atggagggta ttttaaagct     15060
     tcaagataat aaatatgctc cattcaataa atccttacga ggtaatacag gttatctttt     15120
     tcgagtgtct aaagaattag caaacttctt ctttgaaata attgaggcga caaacccctt     15180
     tttgagaaag aaacttcaaa ctgaagacaa ccttcaacta gaaaacataa aacaaattga     15240
     aaatgattta aattctatta ttatattaga gaaaacagaa aaagaaacca ttattaagtc     15300
     ccgaattggt caatctgctt ttaaaaaagc acttttaaca attgaaaaga agtgtagatt     15360
     atgtggtgta agggatgagc gttttttagt tgcaagccat ataaagccat ggagtgaatc     15420
     caataaccaa gagaggcttg atgtcgataa tggattgtta ctatgtccga atcacgatgc     15480
     tttatttgac aaaagatata ttagctttga cgaaacagga aaaattatgg ttaagcaaag     15540
     tttagaggca acaactaaaa tgttccttaa tattaatgat accatgcgaa ttaaattgaa     15600
     tgagcgacag caaaattata tgaagtggca tagagagaaa ttttcggaaa attaatttta     15660
     gattttttta tgctcaaact tacagtccaa aaaataaaac atcctccctg gatgcaaaac     15720
     taaaaatcta ataaaagagg actccaatta gtcctctttt atatgtttat atttctatta     15780
     tttcgctaaa accgttcgta aaaccatatg aattttaaag aacgttcgta atttattttg     15840
     gagttttaac gaacgccaaa aataatagat ttcctatata aatgaaaagt ccgcaaatgt     15900
     atactttcgc ggacaaaata tttagatcta ttacaagatg gtaaaatatt tattatcatt     15960
     aacaaaataa aaagctgcat aattcgtcat cgcaaccttt ctcaaatcct ttgttttcaa     16020
     gggattcttt ttggtttgga ttccagaaag aatgatgatg gtaactaaaa aagtaatata     16080
     ttacttttct atactgatca tgtgattttt catgagtata aatcagctct taaaatcatc     16140
     taatctagtg aaaaattcct gaagaaaatc ataaaataac ttttccgttg gaagtagttc     16200
     tcgttctttt ggggtgataa cgcctacgct ccttgttaca tttggttcaa ccaatggtat     16260
     tttcactgtt gagcgtggca agctatcgac tagcgtgact tctggcatga gtgttacacc     16320
     taaaccagca gaaactaacc ctttcaacgc atcgatatca tccccctcaa aggcaacatt     16380
     tggtgtgaag ccaagattct gacaagcatt cacaacaata tctcgaaaga caaaaccctc     16440
     aggtaataaa acaaacggtt cttctactag ttcttgaagt tttacggagg attcttttgc     16500
     aaggcggtgg tgaattggca aaagagccac aatattttcc gtaaataata ttttttgttg     16560
     aagtcttttt tctttgagag gaagtggacc tatcagacca agattaaaat ctcctttaat     16620
     tacaccttca attaattcgt ggtaaagcgc ttgttttaac tgaaattttg cttcaggata     16680
     gcgcaatcta aatgcataga ttacggttgg taatgtatac gctgctaaac ttatcggaaa     16740
     agtaatgcgt attgttcctt tttcaggatc taaatattcc ttaacctcac gtctcgcatc     16800
     gtctatcaca ttcatggcat gtttcattcg ttcaaaaaat atttttccaa ttggcgttaa     16860
     atgtaccctt cttccttctc tgataaacaa atcaacttct aattcatttt ctaaatttac     16920
     tatttgtcga cttaccgagg attgtgctac atgtaaagaa tgggcggctt cagttacgtg     16980
     ttcgcgagta gcaacctcca taaaataacg gatttgtcta aagtccattt tatatcctcc     17040
     tcattaatta atgcataaaa cgcattaatg ttatcgtttc tttatattga ttcgattatt     17100
     atttcaatta taaaatattt tataataaca actctaaaaa attacgacaa atttttaaaa     17160
     ttttcattat aaatcaataa ataggagacg gataagtatg ataacaattg aaaaaaatca     17220
     atcgacgtat acagaaagcg tacagaatta tgttaatcaa gtatttgaaa cagttaaaaa     17280
     acgaaatcca aatgaaagtg agtttcatca ggcggtcaaa gaagtattcg attctttaat     17340
     acctgttctc gttaaaaacc ctcagtatat taaccaagct attctggaaa gaattgttga     17400
     acctgagaga gtcatctctt ttcgtgtacc gtgggtcgat gatcagggaa atgttagagt     17460
     aaatcgagga tttcgcgtcc aatatagcag cgcaattggt ccatataagg gtggattaag     17520
     atttcatcca tctgtcaacg caagtattat taaattttta ggatttgagc aaatttttaa     17580
     aaactcttta actggtcaac cgattggtgg cggaaaaggc ggtgctgatt ttgacccaaa     17640
     aggaaaatca gatggagaaa taatgcgttt ttgtcaaagc tttatgctag aacttagcaa     17700
     atatatcgga cctgatacag atgttcctgc aggtgacatt ggtgtaggaa gtaaagaaat     17760
     tggctttttg tttgggcaat ataaaaaaat acgtggcaac tttgaagcag gtgttctaac     17820
     aggaaaaggc cttggttatg gtggaagttt agctcgtaaa gaagcaaccg gatacggaac     17880
     agtttacttt gttgaagaaa tgttaaaaga taataatctt agctttgaag gtagtacagt     17940
     tgttgtgtca gggtcaggaa atgtctcaat ctatgcaatt gaaaaagcga ttcagctagg     18000
     ggctaaagtg gttgcgtgca gcgattcgaa tggttatatc tatgacaaaa atggtcttaa     18060
     cttagagaca gttaaacgca ttaaggaaat agaaaagaaa cgtataagta cttatgtaac     18120
     tgatcatcct gaagcgattt acgtggaaag ttgtaatgga atttggacaa taccatgtga     18180
     tattgcttta ccatgtgcta ctcaaaatga aatcgatcaa aactctgcag aattattagt     18240
     ttctaatgga gtaaaagcaa ttggtgaagg tgcaaatatg ccctctacat tagaggctgt     18300
     cgagattttc ttagagaaca atattttatt ttcccctgct aaagcagcaa atgctggtgg     18360
     tgtttctgta tcagcgttag aaatggctca aaatagcact aggctttctt ggacttttga     18420
     agaagtcgat agtaaattac atgcgattat gaaaagcata taccaaaata gcaagaaagc     18480
     tgctcaagaa tacaatgctc ctggtaatct tgtcgtaggt gcaaatattg ccgggtttat     18540
     aaaagtggct gatgctatga ttgagcaagg tgttatttga tacttcatta ggagaatata     18600
     ctagtatgga tatcttaaat ttaaaggctg ttaataatgg gtgacttatg catagtttct     18660
     ataattataa ttgctagttt aattgtactc tcatatgcac tcagtagaaa aaaacctact     18720
     attaaatata tagcacctct aattgtagga gtgattagcg ttggtggtgt tatcataagt     18780
     ttccttatcg gaggagggac tggtatgagt gtagggacaa ttagctttac cgcttttatc     18840
     tcatcactta tctccctact aattatatct atagctgaat ctataaaaag aaaattcagt     18900
     aaaaatattc accaataaag tatgtatagc gtatacaaag tcagtttata tagtgcgaat     18960
     gatcggtata aaaagaagcc gtcaaataat gcgaaatata aaagcccttt aaaactttag     19020
     ttctaaaggg cttttatatt tctttattat ttagaagtca catattcgtt ttttcctgct     19080
     cccatacccg caataaaaat aaggactgaa actaaaacta acatcagtaa aggaatattc     19140
     cagctatgtg taatgtcgtg tagccctcca aataacacag gccctacggc agacaaaaga     19200
     taaccgaatg attgagccat acctgataat tctgctgcct cgttagtact ttgtgtacgt     19260
     aaactaaaga acatcatagc taaactaaac acaaacccaa ctccaattcc aaccataata     19320
     atccatagtg ggataaggag tgtatttccg tacaagatgc cgaataatcc tccaataagc     19380
     aaaacagctg gaatgactat taataaacgc tgatcttgca aacggccagc taaaatagga     19440
     acgaggaacg taataggaag tacagcaagc tgcattaacg ataacatcca tccagcgtca     19500
     tgagtgttca atcctttttg ttcaagaatt tctggcatcc atgtaataac tgtatagaag     19560
     ataaaggatt gaaatcccat aaataatgtg acattccatg ctagtttaga acgccataag     19620
     ttaatagatt taaccttttg cgctgtttgg tcaggcttca tagacttatg tcgatttcgc     19680
     aattgcggta accaaatgaa aatggtaaga agagataaaa ttccccaacc tccaagggct     19740
     ccggtccacc ctaaacctga taatgaagaa ataggaatac ttataccaga tccaatagcc     19800
     ccacataaat tcatagaaac tgcataaatt cctgtcatca tgcctatctt ttgtgcaaag     19860
     ttatgtttaa ttagactagg taacaataca ttcccaatag caatagataa accaattaag     19920
     atcgttccta taaataatgt ttctactcca ccaaaagagc gtattccaat tccaattgtt     19980
     aataagatta aggaaatgaa tagcgtaaac tccatgccaa aacgccgagc taacttggga     20040
     gcaaaaggag ataggaatgc aaaagctagt aaaggaactg tagttattgt tcctgctaaa     20100
     gtattagata ttcctaaact gtcacgaata gaagctacca atgggcccac agatgttaaa     20160
     ggggctctga gattagctcc aattaggata atgcctataa tcagtaatcc tattttaggc     20220
     tttatattta gttttggttg ttctagttga tttgctgtgt gtggaatacc catgatagtt     20280
     atagaccctc cgtatttaat cctaaagttt ttaaatttga gtaatatatt cattcactgt     20340
     gtagattgcc atgatggcat ccacaagttt acagtgtagg ttcaaataaa aatcagcatg     20400
     agaacttact tcaactatat gatgacaaga agtatgtaaa gaatctatca tatggtcata     20460
     taaatcaatt aacatactat tatgtgatgc ttctaaaatt gctttatgca actggatgtc     20520
     agctttttca taagtttgcc cctgctttgt ttgtagtcga ccagtatgta cgagaggttg     20580
     tatagcctct ctcaatatat ttcggctcac ttcaaattat tgcatcaatt tcgtttcagg     20640
     aaggatctgt cttccaattc cccatatact ctatattcat ttaaggcttc gacttgagaa     20700
     acaacttgtt ctaaaagtga catacgattt gcctttaata tatcaactgt acatacctct     20760
     aattttcagg aggattggtt cattggttat tttagcatat atatatgaga gtataaatat     20820
     ggctgcggta ttagacagct caatgtataa atactaatac tttgagcaaa ctactcaaga     20880
     tacctaaacg gcatcttctt taatacatat aatatacaaa acaaagttaa cataatgcag     20940
     attctcccta gttaattgtt tatataatgc tcctgttaaa aatctaatgc catgaataac     21000
     accttaaaca ctttgtacgt tattaattta atttccaaca taaagaaata aaaatcttag     21060
     agaatcaact gagtgtataa atctatacat tacattcatc cgggctccaa gagagaagaa     21120
     gattctaatg aaaggagagc gtaaagtgga aatcatcgaa gtaagctggc gtacaatatt     21180
     attatatgtt gttattatta ttatttttcg ttttattggc caacgaggca taaatcagct     21240
     aaatgtcatt gaccttgttg ttgtgcttat gataagtgaa cttggagttg ttgcaattga     21300
     ggatacggga gattctctat tttatcaact tatacctatt cttatattaa cacttatcca     21360
     aataggtctt acctacatcc aattaaaaag tcaaaagtta cgcagagtac tagatgggca     21420
     acctattatt gtaataagac aaggaaagat tgatgaaaag cagatgaaga aatcacgtta     21480
     taatttagat gacttacttt tacaacttcg ggataaaaat ataggagata tccgtgaggt     21540
     agattatgca atattagagc cttcgggtac attatctgta tttaaaaaat cagaaagcaa     21600
     agatgactca ggatctatat ttttacttcc ccttgttatt gatgggataa ttcaagaaaa     21660
     gcatttaaat ctaataaata aaaattcttc ttggcttttc aacgaattga aaaaaagagg     21720
     atacaaagac gtgaaacgta ttttatattg tagtttttta aatggtcatc tttttgtgga     21780
     tataaaaaat gaataataag tacagatatg aaggcatggt aattaatgaa tgataaagaa     21840
     agtttgagac gaaaatgggt ttggacatgg ccaattcttt agaaagtcat aaattgctgg     21900
     agctagtgaa aatatgattt tttaaaatct ttaatacccg ttatcatact ccgtgcaatt     21960
     gtactgattt ctatcttaaa aaatgatggc gttttgttta aaaatcttaa atataaaaaa     22020
     acagacatta aatagtgtct gttttttatg cttttacggg cggtgtatta aggaaaatga     22080
     atttacgtta attttataga ttagaaaacc agacttaata ataaagacac aattcaattt     22140
     tccccattaa tttcctcgac atgatacaaa tattatacaa tataaaaaga ctgataattt     22200
     agggggaaga ttatatggga agacaaaatg gaacaattaa gtggtacaat tttaataaag     22260
     gatatggttt tattacaaga gaagatgaaa ctgagatttt tgtttcttat cgctctattg     22320
     aagggaatgg ttatgcagat ctgagagaag gtcaaaaggt ttcttttgac gtagaaacag     22380
     gtcaaaaggg tctagaagca gtacgtgtac gggtcctaga ctaatatcct aagatcatct     22440
     gttatttaaa aggcaacagg ttactccgtt gccttatttg tgctttataa agctattttg     22500
     acaattagtc taaaataggt cgcatactat tataaattgt agaaaaaata aaaagctccc     22560
     ccgacattgg caagcgaggt agctttttat caggattcgc aattataaag taccagaata     22620
     taaccgcaag taaacaatat catattattt ccataaagac tatattttac cgtacaagca     22680
     tatgtataaa acgtgcactt tttatacatc aaatcctatc cacttatcca aggaaacccc     22740
     gttatatcaa cgatgtataa aaagctgcat aaaggagaaa caaggctcca tcgagaaccc     22800
     ttttcccaat aggggttctc ttttttatgt gtgttccgga aagagtgttt atgtaaacta     22860
     gcgatgtata tcatatacaa aatttaaatt ttaaaaatta acgcttgaac ctccagttac     22920
     gtcaggtatt atgatgaaat taattagatt aataatagat tgtaaggagg ttatataagt     22980
     tgagtaatga tttaagtttc tcaattggta aattttccaa gaaaacaggt gtttcaataa     23040
     ggacattgca ttattacgac gaaatagggc tactcaaggc tcaaaaagac ctcagttctg     23100
     gccatcgact atatggagag gaccatatag taaaacttca aaaaatcata gcattaatcc     23160
     tatttcttct aggttataac ctagaagaaa taggattaat gctaacgaat acaagtctca     23220
     acttaaactt aaagaacact ttaattcaac agcaaaaagc atttgagaag aaaaaggagc     23280
     atttagacaa agttctgaag gcaattaatc agacgatttc tttgttagat ggtcaagaga     23340
     atgttccaag tgaaatatta attagtttga ttaataacat tcaaaatgaa gaagatcaac     23400
     gtacatggct tgaacatttc acttctaaag agattacaga taaggtttat aataaatctg     23460
     acgaggagaa tttgtcctta gatagagaat ttattgattt atcgagagaa gtgaaaaggt     23520
     tagttggaaa accagttcat gatccagaag tacaagagtt ggcaaataaa catttgcagg     23580
     catctcttaa atacgttggt gaggaggcta tgcatgcttt tggacaatta gaggacgagg     23640
     aaataagaga ttttcaaagt atgatggcat ctccttatac agaggaagaa gaaaaatggt     23700
     tagaccaagt gatagaatat tatatggttc aaaacggaat gtataatccc aaccaaaata     23760
     atggtaaata atttctttta agctaactta ttagtcaaga tagttaaaga aacctataga     23820
     aacttctata ggtttctttt gctacctaga acgatgatta tgttaactaa acatgtatag     23880
     gatatacatt aactcatcat tcgtaagtat catctttaag agacgttacg ataagaaata     23940
     aaatatgaat tggtacttaa ttgatgactg taaatatggc gggtttattt cttaattgat     24000
     tactgcattt tatatattct atatactcta taaactatat aaagtaaaag ggactattaa     24060
     tttcataagt cataaaggta cccagtatcc aatcataaat gaaaatgaaa ggagcgagtt     24120
     tataaatgac tgtagtaaaa aatgggacat tacaaatacc tgaagcaatt ctctattacg     24180
     aggtacgtgg atcaggtcca atcctccttt taatccacgg tggaggcggt gatgctgaca     24240
     aattcaataa tatcgctgat catcttgctg ataagtatac agttgttact tacgatcgtc     24300
     gtggccattc gcgcagtaac cttattggta agacagagga ttataaagtg gaaacccata     24360
     gtaaagatgc tcacttattg ttagcagaac ttacagataa acctgcgtac gtattcggaa     24420
     gcagctcggg tgctgtcatc ggacttgatt tgtgcatacg ctactcggga caggtacgag     24480
     gaatgattcc acatgaacca gtcttattgc aacttttatt tggaaatgag ttaaaacaag     24540
     cagagcaatt catggaagac cttcagaata atcatcgaag tgaagtcatt aaattattgt     24600
     caaatttaga aatgaatgat gccaagccca aacaatcaat agatgtacta acagagcgtc     24660
     ttctcagcaa ttcaacgtat ttcactaagt atgaaattcc cgggattctt aattatacat     24720
     tagatattaa taaattaagc accttgttaa aatcttcatc aattaagata tttccagccg     24780
     gagggagtgc ttctcgggat cttttccctt atggttgcgc agccacctta gcagaacaac     24840
     taggcacgga atttgttgag tttcccggac accatgcagg gtttgacaca acgcatcctg     24900
     aagagttcgc tgagaggttg cacaacgttc taatcacaaa aatatttaaa agatataacg     24960
     aataatctac ttcttataaa aggttttatg ttgactaagg ttttatatca tatatagtcg     25020
     aaaaatagaa aaatctactg ctcctgtaca gtaggcttcc catgtttaga ataggaaatt     25080
     tggtgtgaag ccttacggcg tcttgggtag tttgctcaaa gcttcaataa taattcctta     25140
     aatttacttt cttctacatt aaattctaat tagttatata aaaagacttt tgttgcaggg     25200
     aattacaaga aatatgttga ataaatagta tcaatttcca aacttttgtt attaaatatt     25260
     ggaacctaat taattcctat taagaaaatt ggaggaatta tgagtgtcaa aggaagatag     25320
     taagtttgat caggaatgga taagtcttat gaaggaagcc tatcaattag gtctcttaat     25380
     cgtagaagta aaagaattta tatatttaaa ccaaaaagag cctgtttcca aatgattcag     25440
     gctctttttg gttctaataa aaaacattat gaaattttca taggtacagg gatttaatat     25500
     gtttatttta aggctgattt attatataaa aaattataca tattgatttt ttatataata     25560
     aattatatga tttatatgta aatcaatgtt tgtatgtgaa gttaaatgga aatgaaatga     25620
     gttgagtata tgcgaactga agcagaagca gtattaaata gttatattcc aatagctaaa     25680
     acaattgcta aaatgtttgg accacaatgt gaggtagtca ttcatgattt gacacaaccc     25740
     cagtcgtccg tcatgtttac tatgaataac catgtgacgg gaagagaagt tggtcaatct     25800
     tttgatcatt tagtaaaaca ggtattgtta tctgaagatt ttaaagaaga tcatttagca     25860
     ggttatgaga ttgaaacgga cgatcatcga cttgttaagt catccactac tcttatcaga     25920
     gactttcaag gacaggtaat tggggctctt tgtattaact atgatatgaa tttaatgctt     25980
     caaatgagaa aaatgttaga tgggttaatg cctgttaatc acacagacca acaatcatct     26040
     gatgaagtaa aagaggaaga agattcaatt caaaatgtag aagatattac tgaccaatta     26100
     attcaacaaa ttattgctaa cagctcacat ccttttatga aacgtcgtga aaaaattgaa     26160
     ttgattcgat tcatggatga gaaaggaatt tttcttatga aaggagcagt agataaagtc     26220
     gcagatcaac tgggcatttc aagagtaaca gtatatagct acttagatga agttaaaaaa     26280
     aatactaaat gaaagagtga aataaatgga gagtattttt aaagtaggaa atttaaaatc     26340
     taatggccac tatgcattag caactattca taaggataca gtttatgtat ctggccaatt     26400
     ttccattgat ccagtaacac aagaaaagaa atttggcatg attgaagagg agactctaca     26460
     ggcattggag aacgttgagt atatattaaa agaagtaggg agtaggaaag atcagatttt     26520
     aagaatgact ctttatgtct cagatattca attgtgggat cgtgtagata gtgtttataa     26580
     gcgctttttt ggtaaccata aaccggcgcg atctgttgtc ccaacgaaca agttacacta     26640
     tggattccaa atagaagttg aagctattgc ttatatttaa tttataatgt gaaagtaaag     26700
     cccataattt ttttaccttt agcatataaa aaagtatata aaatataaaa aaatatataa     26760
     agggaggcac aacatatgaa agagcagtac cgatgccact catgtggtac aacatacaat     26820
     gttacagact ttgtatggaa gtgtacatgt ggtggagtgt tagatttagt aaaagaaaaa     26880
     gtaacaatcg atgtaactaa gttacaagaa aaaatgccta caatgtggcg atatgttgac     26940
     gtcatgccat ttgaaaagga ttctaatgta tggaaggaag ttacaatggg tgagggcaac     27000
     acacctttaa ttggattaga taattctgaa cctcatactc ttgttaaagt agattatatg     27060
     atgcctactt tatcttttaa agatcgaggg gcggcagttc taattgctaa agcaaaagaa     27120
     ttaggcgtta aaagtgttat agctgatagt agtggaaacg caggaacagc cattgcagct     27180
     tatgcaaaac gagcaaatat agcttgtgat attttccttg gaaagggcac ttcccctaaa     27240
     aaaattgctc aagtaaaagc tcatggtgca aatgttcgag aaatagatgg tacacgtgaa     27300
     gatgtagctg cagcagccca aaaagctgtg aaagaagaga agaaattcta tgcaagtcat     27360
     gtatataacc cttatttcta tgaaggtact aaaacgtatg cttatgaaat ttgggagcaa     27420
     atgaaaggtg cgccagatag tcttatcatc cctgttggga atggtacatt attgttagga     27480
     gcctattatg gatttaagga attaatggag aatcaactta ttaacaagat gccaaagcta     27540
     gttgctattc aagcagagaa ttgtgctcca ttagcacaag ccttcgtaaa taatgaaata     27600
     gaagctaatc aaattgaagg taaccctact ttagccgaag gaattgccat tgcatcacca     27660
     gctcgctctg ctcaaatttt agaagctatt cgtgctaccg agggagaaat tcttactgta     27720
     aatgaagagg aaatcttaaa agcacgaact ctactagctg gaaaaggttt ttatgtagag     27780
     ccaacaactg ctacaaatta cgctggatat ttaaaatata agcgactacc ttctgaaaaa     27840
     attatcattc ctttatgtgg agcaggaatt aaagcaaatt aattaaacgt tattcaaata     27900
     aagaacaagc agaggtattg tagtaaaaag ggatctttaa atgatccttt tttactgccg     27960
     agaaaatcca ttatgttaac taaagatgta taacatatac ggcctagaaa cagaaaaact     28020
     ccccgaatgc gttaaggaag tttttctgtt tttaggagtt agctaaatga tgattcatcc     28080
     ctcttgagta gtttgctcaa tttgctattt attatccgtt tatattgggg aagaatataa     28140
     attaatttct tttactggtt attcgtacca aaaggtcgtt aagaaagata ataactgttt     28200
     attccttaat aacgacgagc tcaatactat tttctttagc gtaatcttga taactgtcat     28260
     ctaggcaatc atccgttatt aagtaatcaa tctcttccaa tccgcaataa gtgaccatag     28320
     catacttatc aagtttagta tgatctacca ataaaaaaac gtctgcattt ccctttacta     28380
     ttgtttcttt aattccactt tcaatgggcg atgaatttgt gactccattt actattgaaa     28440
     cacctgttga agccataaat accttatcaa aattatattt cttaaaagaa tctgcatggc     28500
     tataactaga aaatgattta gtgtcacgtt cgagaaaacc gccagttgaa atcacattca     28560
     aattttcgaa agctaaggct tcaattataa tatccaggtt attagtaatg atagttattt     28620
     gtttgttttt tagaaatgta atcatttcta atgtggttgt acctgaatct ataaatatta     28680
     cgtctccatt ttctacataa tcggctgcag ttttagcaat taaccttttt tgaagctgat     28740
     tccgtgcctt tctctcgtta aatgattcaa gttttgcatg gcttatagct actccaccat     28800
     atactttttg aatcatccct tctttaatta actttcgaat atcacgtcta atcgtggtct     28860
     tagagacacc aaaaacagta cctagatcat ctaacgagac ggattggtgt tttaaaacat     28920
     attcctgaat ttgttgaatt cgctttgttt ttaacattcc cattcccatc ctcatcctta     28980
     acttgtaaat ctaaaacctt ttctggaatg aatctctagt taaatttgct aaaggtttct     29040
     aaacttttat taattaacac tgtattttat cgattcagga aaatgagttg tgaagataat     29100
     actcgatttt tccagagaat aatagattaa aaaagtactt taccccttaa ttgaagtaaa     29160
     gcagagttag atgttgtttc ttctgatttg tttaacttcc gtcagaaact taagattttc     29220
     acaatgtata taacccgtta tatctaataa ttttttttgt cagatggttg cattgccgcc     29280
     ggacgtaaat ctatttaaat tttaattgag ctctctataa atcaggtata tatagaatta     29340
     attaaattac ttttaaaagt cattgatact ttacccaaac agcaccatta tcagcagtac     29400
     gtacacattt ttctaccgat tgaacccttt caatcactgc tttagtattg agatgccaca     29460
     tattcctaat atttccccgc attctgcagc atccattgca aatgcagaat gcgcatatag     29520
     atttagcttt cattttctct ccgtacatta tttttttata tcactttttc tttaaatccg     29580
     tttccgatca ataaccaaca ctttttaagt aatcgacgct ttgtttaaca tcaggtaaac     29640
     ttgtgtcaga gtttctagga tctcgctcct gctcaattgt gatgtaccca tggtaatcga     29700
     tttcttttaa taatttatga atcgaattat agtcaatgat accttgtcca attgggcaca     29760
     taaccccttt accacaagca tcgaaaaagc gaatacgttc ttccattact tgtttatata     29820
     cattaagatc aatatcttta aagtgaatgt aatctagtcg atttgcacac ttttgaagcc     29880
     actttattgg atccattttt gaatagtata aatgccctgt atctaagcaa aggccagcta     29940
     tttcgtaagg tatatcttct aaaagttttt caatttcatc ttcaaattca atgtatcctc     30000
     ctgcatgggg atgaataaca gagcgtactc catatttatc ccatgccttt actgctagtg     30060
     cacgaatatg agccatcata ttatcccagt ctctttcaga caatcgtact gctttttctg     30120
     gatgccctgc atcataatct ctctcatcgt gcccccaatc aataatgact aaataaggag     30180
     tgggaaactt ttgtcctttt tcttggagag ttgaaggcag ctttgttatt aatgaacaaa     30240
     tatcatctac ctgatgtagt aaattttcta aattagactc tgttactaaa tcatcaaaaa     30300
     tcgttcctgc cattatagtt aaatcattct tagaaagctc tgcttgtact ctttcaatgt     30360
     tcattggtat atatccataa gggcctaact caatcccctt ataaccggct tgtgaagctt     30420
     catttaaaac cctttcccaa ggcggtaggt aaggattttg aggattatca acaccccagc     30480
     aacaaggcgc tcctgaaatt ttaatactca tctataacac tcctagttcc cataaaataa     30540
     acattcttaa atgaaattaa aaaattgtac tctaaataaa ttcatgtctt attttctata     30600
     attcttctgc tcttttataa actaaaattt aaaatgtgta gagctttgat cacaatatag     30660
     ataaaatagc catctattaa tcctcgtatt ttatttagac taactgcgcg ttgtccttaa     30720
     tttttaccgg tgtatttgtc ttgactgatt caatgcaagc aagtgcaatt gaaagagctc     30780
     tacgagcatc tctccctgtc aaatatggta tatttccagt gcgtatacat tctacaaagg     30840
     aagttaattc agcgacgtaa gcatcatgga ataattccgt atcttgtcgg catgtatcgc     30900
     tacttattcc ctctgctatg taacggatca tatttgtttg ctgtgcactt ccagctgaac     30960
     caaatacttc actacgcaca tcatagccat aaactgcttg gaaatttgct tcagctgttg     31020
     caatggctcc attgtcaaaa cggatattta caactgccgt gtcaagaagg ccattatcct     31080
     taaaatctgg tcgtacaagc gcatctgcaa cggcatacac ctcagttggt tccgcacctg     31140
     ggtttaaata aagtaacgca tcaaaatcat gaatgagagt ttcgaggaaa attgcccact     31200
     ctggaattgg agttgggtca cctaatcctg gatcacgagt tagcgatctt aataactggg     31260
     gagttccaat tcgtccttcg acaatatcat tatgagcagc cctaaaacct gcagcaaaac     31320
     ggcggttaaa accaatttgt aagggaacgt ttgctttttg tgctgataaa atagctttat     31380
     ctgcttcttc taaagttatt gccattggct tttcacaaaa aacggctttt ccttcattcg     31440
     ctgcagcaat aataagttct gcatgtgaac gggcgggagt tgcaataatt actgcatcaa     31500
     cagatggatc ctgaaacatt tcccttgggt ctgtatatgt tttggacgct ccaagctctg     31560
     aagcaagtct ctctgctggt ccagttctag gggcagcgat tgcagtaagt ttagctccgt     31620
     gaattttatg agcaatagac ttaccatgaa aacttcccat acgtcctgca ccaacaagac     31680
     ctattctaat ttctcccatc tttctttctc cttaaaatcc ggtattaatt ctttcctgct     31740
     tataattcaa ctataaggaa agtacttcct tatgtgaata ttcatctaaa aatcataaga     31800
     tttagaaatt acactataaa atatttgcat tttgttcaat tcgttgttta cttagaaacc     31860
     ttcaaatcct ctggcgaaac atttataaaa gcttcctttt caacagattt aaagcatgca     31920
     tcaatagctt tcatattatt gattgtattt tccgtaaaat aggatggtat ttctccctct     31980
     aatatacagt tagataaata ttcaacttga agtttatact gatctccaag agcttcttct     32040
     gttctataat ttccgtcctc tgtatatatc aggatggaag ctttaccctt aaatacttga     32100
     ggtgcgaagg ctcttggtaa ttgaatgctt ccctctgttc caataatttc ataataatct     32160
     gtacgtgttc gatccatagc agcatcaaat atagctgtca ttccattatt aagctccaac     32220
     aagcctgtta cagaaatatc tacttgtcta tcatggtctt tttgcataga ggtaaaaact     32280
     cttttaggct ccgaatttaa aatatttcga atggcatgga tacagtaaca acccatatca     32340
     tataagctac ctccccctaa ttcgccattc atacgaatgt ttccgttctg atttttaagg     32400
     taggatgaaa gagttgcctt cattgttttt acgtttccaa tttcaccaga agctataatc     32460
     tcttttactc tttgatgttg gaggtgaaaa tgatacataa atccttccat aaacatcacg     32520
     ccattttccc tacatgtctc aatcatttct ttagtttctt taaaggttaa tgctgctggc     32580
     ttttcacata atacatgttt cccttttttt gcagccttct ttacccaatg tgaatgaagt     32640
     gcgttgggca acggaatata cacagcatca atgtctggat cttccaataa tttgtcatag     32700
     gactcataaa ttttcggaat ctcaaatttt gaagcaattt ccttaacctt tatattcgaa     32760
     ctagcaatgg cagtgactgc cgcatttatc gccttcatat aagcaggcag taattcatct     32820
     tgcgcaactt gtgcagtact taagactccc caacgtacgt gagttttcac ttattccaac     32880
     cccttcagct attatttttt tacctatacc tatctattaa aaaagcaaaa ctccacggta     32940
     aggtgaagtt ttctcgagat tgattggtat atatgtaacg ttttttgagc tcttttatca     33000
     gctttctttt ttaaagttag cctcgatttg ttctaatgaa agacctcttg tctctggtaa     33060
     gaatttcgct acatatatta ttcccacaat accaaatgcg gcgaatagga aaaatgttga     33120
     tgacaaacct attacatcta gtagaagagg gaagaataat cctactaaaa aattgcaaaa     33180
     ccataaaaat aatacagcga atcccatacc aataccacgt aaacgaacag ggaagatttc     33240
     agcaagtatg agccatacca tcgggccaat agctccttgg aaaaaggcta agtatactac     33300
     tgtcattgat aatactacat atggcagcac cggagatccc gtaagtatta gagcagaaat     33360
     tccaatcgta ataagtgcga ctgtaacacc tgttaaacct gtaagtaaca tgggttttct     33420
     gttcacttta tttagtaatg acatacccac aataactgct acaacagcaa ttaatccgtt     33480
     tgctacattt gcaattaatg ctgtttttgt accaaaacca gaattttcaa gaatttgtgt     33540
     tccataatac ataatagagt tgatacccac tagttgtgat atagagccaa taaaaatacc     33600
     aagaaccaca atacggcgaa tccaaggtgt ccttaaatct ttgaaactca ttttttctat     33660
     tttttgctct tctgaaatat gtgcttttat atccttcaat tcttgctgag cgatactctc     33720
     actacgaatc ttttgtagga tcttcaatgc gtcggtcatt tttccttttg atgctaacca     33780
     tcggggactt tcaggtaaaa taagtactcc aatccaaagc gccaaggctg gcaatgtcgc     33840
     aatcaccaac atataacgcc aagcatgtcc tgcatctcca aaaacattac caataactgc     33900
     attacatata taagcaagga actgtccagt aacaatcatc agttcatttt gtgtaaccaa     33960
     aataccacgc ctgtccgttg gtgctatttc agcaagatat gaggggataa ccacagaaga     34020
     accgccaaca gcaagtccca atagaaaacg aaaagcaacc attatggttg tatttggtgc     34080
     tatgacacac ccagctgcag aaaagaaaaa taatatcgca aggtacaaaa taaccttcct     34140
     acgtccttta ttatcggata agcgtccgcc aaatatggag ccaaacgcag cacctaatac     34200
     gagagaactt gctactaaac cctcagtgaa aggatttaag tttaattggt caggccgggc     34260
     cataaatgga agcgccccat taataacccc tgtatcatat ccgaataata gtcctccaaa     34320
     cgtggataca atggtgacca attttaaaaa cttttttgag tccttttcct tgacctgttc     34380
     cgtttgagct gagtaatcat taggcaactt gagattttcc acgttaaatt ccccctttat     34440
     tgatcgtatt tgttttaaca taatacttat ccatcaagct ttttgctaaa tatgattgca     34500
     aaggaaatgc ctccttttaa tgaagatagg taacctaagt ccttacatct gcataaaggt     34560
     tatcaattga ggcttattgt aaataaaaac ttaagcgtcg agttatcgat ttaaaagcgc     34620
     tttcatttat tcccttttga ctatgccttc cactatccct ttaaagatag tgaaattctg     34680
     gataaaagat cggaacaaca tagttttgga ttaaatttca atatagaaga tagtatataa     34740
     ttttatttct gtttatcttt attaaagtta tttggttaag ttatcttaat taacgcctgc     34800
     aaagttaaat catgtttttc attctcataa ttgaatagac atatttagaa ggaacggata     34860
     tcctttgcta tatttttaat attctgaatt ttaaactcca actgttggtt gatttttaac     34920
     acatctggat ctgagaaacc tttattcttt gctaattcgt acatatccaa acgatagttt     34980
     gctatacttt tacttaaatc cagtacctcc ctcaaaatca tcaggactct ttcccttcta     35040
     gtactttaaa ttttccaata atttaataat caaaaatcca catgattctt aacatatccc     35100
     tttatttaaa agccgtgaca ttagctttca caaccaaccc cacggcttta attcactttt     35160
     tggtgctttt tgatccaacc taaatttaaa gagtttttcc tactaatgca gcttctttgt     35220
     tactctcaaa atctacccat gcggatcctt gatctgctga gcgtacacaa ttttcgatcc     35280
     agcgaacacc ttctagtcct gcattaatgt ctgggtaaac aagtgtatcc aacgtttctt     35340
     gatccccacg catttttgca tcaatcgcaa ttgcaaactt caggtaaata tttgaccatg     35400
     actctgaaag tccttcctgg tgtaaagcgc ctaaacgctc atccgcatta cagctttcat     35460
     ctaaataagg cattgatcga atcaatgttt gaattggttg tccttgcact tcatatcgta     35520
     attcatttgg cttgctgtcc caccattcta agcttgcctt agaaccaaca atgcgaattc     35580
     gatgaccgtc catacaaccc gcatcaatag aggatgtcca cagtctaccc acagctccat     35640
     tttcatagtg cattagcacg taagcattat cctctagagg agcacgactg ccaataaagc     35700
     tctgacgatc acataataac tttttaattt tcatttgtgg catgattagc tgtgacatat     35760
     agtacgtgtg ggtagaaaga tcccctaaca cataacttgg tcctgcaatt ttaggatcca     35820
     cgcgccactt ttgtgcagcg ttcactttgt ctccatcatc agtagcatta aatccatgcg     35880
     tatactgtag ttcaactact cgtatatcgc cgatttctcc tttttcaacc attgctctca     35940
     tttgaagcag caactgatta ccagagaatc catacgttac cccaacgatt ttcccttttt     36000
     cttcagctag tgctttaatc tctactacct catcacttgt aaaaaacaaa ggcttttcgc     36060
     aaattacatg taaacctgcg tgtaatgccg ccttacaaat ttcataatga gtaccattag     36120
     gcgtggcaat tgatacaact tcaagtccat cttttcgctt cgcttcttct gcaaacatcg     36180
     tttcataatt tggataacaa cgtttctcag agaccccaat gttgacacca aagtcttttc     36240
     ctctagcagg atcaatatcg aatgccccgg ctaccagttg aaaagctgtg ttatctctaa     36300
     gtgccccaat tcggtgctta tagccaacct gccctagtct tcctccacca accatacccc     36360
     atcgtaacgg tcttgcaatc tttttctctc catttaacat agtagaattc ctctctttca     36420
     agtagtattt attttggata gttctgattt aactagaaaa tattttaaat attcagaaat     36480
     atatagtctt aagtaactaa agcaattcag ctcttttaat taaaagctaa gtgtttgttt     36540
     taatgcatca attgaagttc gaacccctgc ttcaactgac attgttaaat cttccatttc     36600
     taaagaaact tcttcatcat agcccatcat cttaacaaca gagaagaatt ctttccacca     36660
     ctgtaaatct tgaccacaac ctactgctac gtaattccaa gctctatttg ctacatccgt     36720
     cacttctttt gtttccatta ccccgttaac ccctgataaa tggcgttcaa ggcgcacgtc     36780
     ttttccatga acatggtgga tagctgctcc taattctcta gctgacaaaa ttgggtctgc     36840
     gcccatccag attaagtggc ttggatctaa atttagtcct acaataggtc ctaccgcatt     36900
     acgcagttta aataatgttt cagggttata gactaattgt gaactgaagt tttcaagagc     36960
     aattttttca ataccgcagg attctgcttt cttaactagt tctttccagt agggtatggc     37020
     tacttcattc cattgataat ctaaaatatc ttttaacact ggaggccagc ttaccgtata     37080
     ggtaatccag tttgggattt tatcttcagg acttccagct ggtaatccac tcatcatgat     37140
     tactttcttt atacctaata atttggctag ttcgaatgtt ttatctgtca cttctcgatg     37200
     ctctttaccc aactcacctg gatccaatgg atttccagaa caatttaatg cacaaagttt     37260
     aatattgcgt ttttccaatt catttaagaa ttcagctctt ttataatcgc tttctaaaag     37320
     ttcatttaat ttcaagtgag gggctggtga ccaaccccct gtggtcattt cgattatatc     37380
     aattcccatc tctgttatca catctaacat ttcttcaaaa ggtaaatgtc ctaaactgtc     37440
     tgttacataa gataatttca tgtttttctc ctcctaaaaa gtctatgtac aatcactcat     37500
     taagattata attataggac aaatctatcc aacaattttc attactttac aaccttgttt     37560
     ataacttagc aatatcgttg ttggttaaca tttcgctttt aaacttatcc atttttacaa     37620
     gataatctta atatgttgaa aaataagtaa ttggaaacgc ttttatttaa ttgagtattc     37680
     aataaatttt gtttctatag tgattagtat aaaatatgaa atcctaatcg tctttgtttt     37740
     aagaggacta ctttttatct tttaaggaca attttatcga acattactaa ttttatttaa     37800
     taaaattaac ccttctctac tttttcataa atgacattaa gtagagaaag gttgactaat     37860
     ctttatatat aactgttttt aactttgtat atagagcacg aaaacgtcct ggtgaactat     37920
     gcatcgaagc agtaaaaacg cgtgtaaagt agtgaacgtc tggaaaacct gtttcttgag     37980
     caatatccct aatagataaa tcggtggttt tgagcaatgt agcagctcgt tgaattcttt     38040
     cattttgtac atactcagag tagctgatac ctaattcagc tttaaatagc cgagagaggt     38100
     gtcgactaga taggtgtaaa taagtggctg tatccgtaag tttaatagaa tttgatagat     38160
     tatctttaat atataatttc gcaagggtaa ggatcaaaga agactttttt ggaacagtct     38220
     tctggctatg gtaattcgaa gacacaacaa aggtttgtat taatgaaaga ataagggaat     38280
     gagccaaatt ggatagtatc tcttcaaaaa gagcgctttc actgtttgct gcttgaatta     38340
     aaagagactt ccacattaac ggtgcagctt catcttcttt tacatctatg actacttccg     38400
     aacattgttt cgcctcttca attattgtta cccacttttc acttgattct gattcatcta     38460
     gttcaaaccc gacatataag agaaaaagtc cggtgtcgct ttttatttga tgtaaaactt     38520
     caggtcttga aagaaatatt gtattttctt ctatttgata tgtacatcct tggtctatat     38580
     aagttccccg tccttcgagt acgtaacaca cctcaaagaa tgaatgttta tgaggcaaat     38640
     tattataatg ctgtggcata actccccagt agtgaatata aaaagacact ccattacttc     38700
     ttgtacgttg aatatattca tttaacgcaa tctttcctga gataaactta tccaataaac     38760
     cgcccctcct ctttatgaaa tcagaaaatc tattcattaa ttattaatac aaactataat     38820
     ttaaacgaaa aaatttgtct ataaagactc taaatgaggt tagttaaaga tattatgaaa     38880
     aatcggataa ttttaacttt ttaactctaa gggaaagaaa ataaaagctt aatgatatta     38940
     aaataagaca cattatatat tctacttgga taaaggggtt agggactgaa tttgctttta     39000
     ataaggttaa ttcacttaaa aataaaagat taatttcttt catataaagg agtgaattaa     39060
     aaaactattt tataaaaatc aaagttttat catttactct gcgtgacgac aaatagcgtg     39120
     tttgactaca taataagtaa tagataaact ttttttcaat aaggtagctt aacaattact     39180
     tttttataag taaaaacaaa ctaataatta tttaacattt agaactaata ttatcactct     39240
     tttacgtcca tagatatttt ttatttacaa attagtattt aggattaatc taagcgaacc     39300
     ttaccataaa taacagcaaa attacttgat ttataaaaag cctctctgaa agttcagaga     39360
     ggctaaatta aataatatta gtaaggtaat ttaattgcta cttttataac ccttatggat     39420
     agtttcagtt tgattatttt tgattatttg gtgccgtgac atctaaataa atccaatctt     39480
     taattcgtga aatgaatgga tacactataa cataatgcat ccgtttagta tacctgtccc     39540
     aacaagcaaa caatattacc gttaaaaaac ctatttgcgg tgaaaatagg ggctcatcaa     39600
     aaactcccgt aagaataata ataggcaagc tcaataaaaa gctgtctaat aaacatttat     39660
     gacttcgtat cgaaaagaat aaatgaatac atttgacaag gtttaaacag ataacaagta     39720
     aaaaagctaa ccctcctagc gtcccatatt ccgcaaacat gccaattaag atattatgag     39780
     catgtggcac gacttcatgg taatccttta aatatttttg gccaaagccg attggggtaa     39840
     caccaaagat agaatgatct tgccatattt tataggagct tttccatatg tctttcctta     39900
     cttgcattga tagatttacc agctcgtttc tcggcattaa atgaagtaac catttagata     39960
     gcgagagtat aaacagtata ctaataatga agatatatcg gtttaaacgc atgataaata     40020
     aaagataaat caaaatcatc gacgcaaagc ctgcccttga accggtttga ataacaccat     40080
     agcttagtag gaacagtata ggaaacaccc aaacaaaatg gacgaatcgt ttgctcctca     40140
     aactagcaag caaatgagct aaaagaaagg aaatggaaat taacagaata tatacagtaa     40200
     agttggggtt gtacgtacag ccaactaatc ggtttaaatc aaaatgtcct aagcctaagg     40260
     gtacagtacc cgttaaatag ccgacagcta gaggaaaggt ataccattgt gaaaaccaac     40320
     ctattacaca actgtatacg cctccaaaaa tcatgatcaa tcgaaaatgc tgaaataatt     40380
     ggttcttttc agtatccaag attcttaaat atagtcccca gtatcctaga atcatcccac     40440
     taacacttaa ataagatatt tccttcattg aaatagaggc tccaatagtt gagataaaaa     40500
     gacaaagaaa aaaataggag cttaaggaaa agacgaaacg ctttttttcc ttccagtgtt     40560
     tacagatggt atgtagacca ctaagtaata aaagaaaaac acctaatggt ggtaaaagga     40620
     aacatagcag taatcttaat tctaatgcgg ttaattttct aaatgactga aaaaatatgc     40680
     tcatgaaatc ctcctaattt aaaatggcgt gactcttagt ctttttaaga ttgagattta     40740
     actatttgga ataacattaa tttaaattag gttgaagtat aaaaatttca tgaaaattgg     40800
     tgtaatgact agtaaaacaa tgtagatcaa ttaatgaata aaaatcaatg atttaaaaat     40860
     aacatatttt tttctcaatt ttgtttctaa aaagtaaatg tgatgtaaag tttaaacaat     40920
     tacatcaatt gtagaaaaag ggcccatttg tattggattt cttctaccag aaccaaaacg     40980
     tttatcgaat catgcagata agtcatacat aaaatagagt aaggcacatt atatatacat     41040
     ggaatgatta cagtgaaaat taggaagacg ctatttcagt caacttatct actgggggtt     41100
     atagtgtgga aaataaatgg ttattcatat cagaaaacag tgagaactct cctgatccaa     41160
     atgatactgt aaatctcgac gaatgggaaa gtgagggtgg tagaatagta gagattacga     41220
     aataaaataa aaaaaggtct ttgctcatta taacgttctg cgacaagggt tcttttttgg     41280
     cttgtgttcc gggaagaggt attatgtaaa ctgattttgt atatggtatt cattcacttc     41340
     tcactcttta tttggaaata taaagagagc ttactatgat aaaatcatag taagtagaaa     41400
     aaattgtaac gggagtaaat tatgaaaaat aaagattttc tattatccat tgttttaaat     41460
     gtatttttag cttacctctg gatctttctt atttatttaa tttttgattt cgttaagcta     41520
     aaagataatg ctttattgtt tggcatagtt ttagcatcca caggtacttt actctttgca     41580
     gaggtggtaa gaagggttaa cccctttatt gaatataaaa ttactcatcc tgtaaaagtt     41640
     gcaggtttta tatcttttgg ccttattgct gtggccaatc tatattggat aagtttttaa     41700
     agatgatgat aaagattaga acaagcagtt taaattaagc tgcttgttct tttaagtgct     41760
     gataatcgtg attgtgttaa ctaattttgc acgtgatata cactttttac ctcatttttt     41820
     actgtgtaat aattccctta ggatattagc ctaggacccg taccatttct gcttgcatac     41880
     ctctttggcc attcactact acaaaagtaa ccttttgccc ttcttttaag cttttaataa     41940
     caaccccttc agtcccttta gtccgttcaa tagctgtaaa atggacaaaa agatcaggtc     42000
     cattttctgg tgtaataaag ccaaatcctt tctcatgatt gaaccactta actgttccaa     42060
     cttgtctttc tgccatataa atcttcctcc taaagtatca gtattttttt gtttcgataa     42120
     tggtgattat gttaactgaa tttgtatatt atatacatgc tttattggtg aatattctta     42180
     ttaccttttc cttttaaagc ttccactaca gatatgatta ttagggagat aagtgatgag     42240
     atgaaagcag taaaactaat tgctcctact cccataccag tccatcctcc gataaagaaa     42300
     cttactataa aaacaataac actcagtatt cctaccatta gaggtactac atattttagg     42360
     gtagagttct ttctgccaat tatatatgac agtatgatta agatagcgat catgattata     42420
     gaaattatgt acaaattatc cattattaac ctccttttag tttgcgatat acatattatc     42480
     ataatcttct aaggcttatc gaatgaatat ctggtttatt tccgataata cctgttacgt     42540
     taactagcta tacgttgtcc accttgccca tttaattatg ttccagtgag gaagggtttc     42600
     tccaattttt aaggaattaa ttatcagtag caataaactt aacgaggtat ctagagtagt     42660
     gaaataaatg aaaaatcgaa ctagttattg ttacatgtaa atataggtgt ttattctgaa     42720
     aggggctggg actatgagtg tttctatctt aactaattta atgagaaaaa aaggatctaa     42780
     aaaggacaaa ggggagttca accaatggac agaaataaat tctcatcaat tgcccacagt     42840
     aaccatttat ttagtaaccc gatagctgaa acaaaaatca atagaattat agattttctt     42900
     cagttagaac ctcctgcaaa agtgttagat atcggggctg ggaagtgtga actgttaata     42960
     cgtttagttg aaaaatatgg tattgaagca acagccgtag agttatatga gggttccatt     43020
     ttagaggcga agcaacaggc ccaaaaaaga atccctgaag aaaaaattac gtacattgta     43080
     aaagatgcca aacaagtggt aagtgaatac atcaatcatt ttgatgtagg aatttgtgtg     43140
     ggttctactc atgctttgga tagtctggaa ttaacgttac aatctcttaa aagaaatgtt     43200
     aaaaagggag gctttattct agtaggagaa ggatactgga agaagaaacc tagtccggca     43260
     tatttagaag cacttggtgg agcagatgag tcagaattaa aagaacacca tgagaatgtt     43320
     tttatgggag aaagtatggg gctcgtgccg atttggtcag ttgttgcaag tgacgatgat     43380
     tgggatgaat atgaaggact atatgctatg tctatggaaa aatattgtta tgaaaacccg     43440
     aacgaccctg attgtgctag tatgttaaat aaaattaggt catggaaacg tacttacctt     43500
     acatggggta gagatacttt aggatttggt ctttatcttt ttcaaaatca ataaatctca     43560
     acagaacctg agataccttc cattatggaa caaggaattt caggttttac attttctgta     43620
     atccaaatta tgataactaa acatgtatag ggtataaatt aaaaaagatt ttattattac     43680
     cttaaaggta tggacgaatt tttctgccct caaatagtca gcctttatgt tatgattgtt     43740
     ggtagtattc tagagcagaa atggagtgtt cataatggta aggagaagat aggtagcctc     43800
     ctgtaataga cgtttaagtg atcttaggag gctattttac tatataggag ttgttatcag     43860
     taatgaaaca aaataaatat gatgttgaaa aattcttttt tgcttacgag cagatgccac     43920
     gttctattaa agggcttgaa ggcgctggtg aatggcatgt attaaaagca ttaatgccag     43980
     atatgaaaga caaaaaagta ctggatctag gttgtgggtt cggctggcat tgccagtttg     44040
     cacatgaaca aggagcacgt tcagtaatcg gtgttgacat atctgaaaag atgcttgaaa     44100
     aagctcgtga aaaaacaaag gacccttcta tttcatatat ccaaatgccg atagaagata     44160
     ttgattttaa gaaatcagaa tttgatgtgg tcattagttc gttagctttt cactacatca     44220
     agtcatttgg ggaagttgct aaaaaggtag gcagcttctt aaagccaggt ggtacatttc     44280
     ttttctcagt agagcatcca attttcactt ctcggaatga acaagactgg tactatgatc     44340
     atgatggaca tcctatgcat tggcctatcg atcattatca ggaggaaggg attcgtcata     44400
     cgtccttttt aaccgaggat gtaataaaat atcatcgtac gatttctact tatatgaatg     44460
     atctgattcg tacaggtttt acaatcaatg cagtgaagga accaatgcct tctgatgaaa     44520
     tgttagaaag tatacctcaa atggtagatg aaactagaag accgatgttt ttaataatct     44580
     tagcagaaaa gaattaattt gtttcatgaa gaagaattag ttaattaaat aatgaaaggg     44640
     tgtcctaact taataaagga cacctttttt gtttcctaga acgtgtttta tggtgcgaca     44700
     agaagtcgct ttcttacagt gtagctaacg ctactcatct agacgcagag atgatctcca     44760
     tccgaaacgg cattcttggt aacgagtctg tcggttgcat gaggaaatgt ggaaacagag     44820
     gacaaatgca tggtccagaa tactgctagg agaagatagg tatggcaaac gaaagtgaag     44880
     gtttataagc ttcgtcaacg ttagctcaag ataatgcata ttcttgcttg ggtcttggta     44940
     agaggaaaag tagaatcata aagctactct aatgcgtccc gcatcttgcc cggagtaaag     45000
     aacctgccta cccccgtcga atctgaagga agtggaactt ggtaagccct atgtcatctg     45060
     cacaagcagt aggatgactg caaagtcaaa caatatgaca gagggtatgg gatatgagaa     45120
     aaagcgaaag ccgttaccct gaaaaggaac aggaaagcag aattactgta taactggacg     45180
     gatactgtcg gctctacaaa caatgacagg ctcgaaagag cgcctacttc tcattggtct     45240
     tcaacacgaa aataaatttg tggctatctt ccaacgaaaa ggagcgtgct gttatgaata     45300
     cctctctacg agcgtcggcg cacgtctcgc ataaagattg gtactctatt gattggagta     45360
     ttatacaaaa atatgtagcg aagttacgac aaagaattta tcgtgccgaa caacaaaaac     45420
     aacgaagaaa agtaaggaaa cttcaacgtt tactcctccg gagtaaagca aatctgctgc     45480
     tttctattcg cagagtaaca caacaaaata acggtaagcg aacacctggt gtagatggct     45540
     atacggcctc aaaaccaaac gaacgtatca aactttatca acaactagtt aaatgcaatg     45600
     tctttcgaca tcgtccaaag ccagcaaaaa gaacgtttat tccgaagaaa aacggaaagc     45660
     taagacctct gggcattccc acaatgcgag atcgagtcta tcaaaacgta gtaaaaaacg     45720
     cactcgaacc ccaatgggag gttaagtttg agcctacttc ctacggtttt cgtcctaaac     45780
     gaagcacaca tgatgctata agcaatcttt ttaataagct taacaccaat agtaagaaaa     45840
     agtgggtgtt tgagggagat ttcttaggat gtttcgatca ccttaatcat aattggataa     45900
     tggaacaaac atctatgttt ccgggaaaca ctctcattaa aaggtggctt aatatgggat     45960
     acatagagca ggatatgctt catacgacaa cagaaggaac ccctcaaggg gggatcgtgt     46020
     ctccccttct agctaatatc gccttatgcg gtatggaaga agagattggt attgtttata     46080
     aaaagacata caaatcaaac ggaggatata aaattgatcc aaaatgtaag ataggacgtg     46140
     ttctctacgc agatgacttc gtcatcgtaa cggaaacgaa ggaacaagcc gaaagtatgt     46200
     accagaacct caccccttac ttacgaaaac gaggaattac tcttagtaaa gagaaaacta     46260
     gagttacaca tattgaggac gggtttgatt ttcttggctt ctcgctgcgt caatacaata     46320
     cggggcaagg aaagaagtta tttatcaaac ctagcagaga cagcattaaa aaggctaaaa     46380
     acaagataaa agatacgttc tctgtgatga gaggacgacc agtaaaagaa ctaatacgtg     46440
     ttttaaaccc aattattcgt ggctacggcc agtattggaa acatgtcgta tccaaaaaga     46500
     cttacagcta catggacaat tatattttcc taaaagtgag aaaacacctt aaacaattgc     46560
     atccaaagaa gtcgagaaaa tggattagca agcgttattt taagaagccc caccacggtg     46620
     gaaataataa atggattctc acgtgtccac ttactaacat tcaactgtta aagatgtcct     46680
     ggattaagat agaacggcat gtcatggtag cctataaaaa cagcccagat gatccgagtc     46740
     taagagagta ttgggaaaaa cgagaccgta aggtctttaa tactgaaaat acattggata     46800
     ggatgaaact cgcaagaaaa caaggatatc gttgtgcatt gtgtaagcag actctacaaa     46860
     atggagagac aattacagtg cgaaacctaa aggtttctac aggtaaattt gctaaattag     46920
     tacatgtacc atgtattaaa taaataagtt gttcggataa aaagaaggct tgagccgtat     46980
     gacgggaaat ctgtcacgta cggttcttag gggggcgggc gctcgtgaga gtgcctgcct     47040
     actcgactta accagtttgt aaattagtgt cttaaattat ctttagttgt aatgacccta     47100
     gaattattat gaagttatca tcttttaaat attgaaaatg ataattactt cttatatgat     47160
     tcagaattga taccagatca aatgttatga ctaatcggag gatattatga agcttttaaa     47220
     gaaagtgctt aagcgtaaaa ctacatggtt tgtttttttg attgtaatag cttttattta     47280
     tttaaataat agttctttac tagctcagaa aagagagaat caaccttttt tacttgctca     47340
     tagaggtgtt gcccaaacat tcaagatgaa agatattcaa aatgacacgt gcacagccga     47400
     aaggatttat aagcctcaac ataatttttt agaaaatacc attccgtcta tggaagctgc     47460
     ttttgaggat ggggctgata tggtcgaact tgatgttcac attacaaaag acaatcaatt     47520
     tgcggtattt catgattgga cagtagattg tcgaacaaat ggaaaaggcg ttacaaggga     47580
     ttatacaatg gctgagttaa agaaattaga tattggatac ggatatacag ctgatggagg     47640
     gaaaacatat ccttttcgtg gtaagggagt caacctcatg ccttctctga atgaagtaat     47700
     ggagcatttt cctcaccaag catttcttat tcatgtgaaa agtaatgatc cgaaggaagg     47760
     aagacaatta gctaagtatt tatcacaatt ttccaagaag cgtttaaaaa atataacagt     47820
     ttatggcggg gacgaaccca ttgattcatt gaaaaaggaa atgcccaacc taaaggttat     47880
     gtccaaagcg actatgaaag attgtcttat cccatatata gcaacaggtt ggacgggata     47940
     cgtaccaaag gcatgtgaaa atacagaatt acatatacca gaaaagattg gtccttttct     48000
     atggggatgg ccaagtcgtt ttttaaatcg aatggatgat gtagatactc gaaccattat     48060
     cgtaggagga aatggaagcg agttttcaac tggttttgat tctattcagg atttaaaaag     48120
     acttccagac ggttattcag gaggaatatg gaccaatcgt attgataaaa taggagatta     48180
     ctataagacg aatgaagagt aattctagga tcgttgaagc aattaaatta aataccagca     48240
     atgaggcaat tggtttttat tccaattgct tttcttattt atgtttccta gaatttacat     48300
     tatggtaact aaaaatgtat acttttacga actcagtatt agaaattatt gcaaagtgtt     48360
     aaaggaattg aaatgtatat atatatgttc cttccgaaag tggtgattat ttaaataaag     48420
     agcgaataaa gaaaagcctc cttttaaata aagaaggctt ttaagtttaa tcttctggtt     48480
     ataaaaatat ctatcgttct tttatcccca gttatatgtt ttgtgagtta gtagagccta     48540
     tatatcgatc tttagctgca ctaagaccaa atataaagag taagactgat gcaccgacta     48600
     atattaaaag aggaatagtc caactattag tggcatcatg tataaatcca aaaagggttg     48660
     gaccaattgc tgcaagcaag tacccaaccg attgtgccat gccagataat tctgcagcct     48720
     gctgcgcatt ccttgtacgt aagccgaaaa acatcatgga taggctgaat gcgaagcctc     48780
     ctcctatgcc taaagcaatg atccaaaaaa taattaaatt tgaactaccg tatagtaacc     48840
     caaacgtccc gattaaaaat aaaatcgctg taatagtcac taacgaacgt tgaccggaca     48900
     tgcgtcctgc tatgactggg acgataaaag taaaaggaag aagagccaat agcataacgg     48960
     aaagcattaa gccggattga cttgaattta gtccctgttg cttaaggatt tctggcagcc     49020
     aagcaactag gacataaaag aacatggatt gtagtcccat aaataaggtt acctgccacg     49080
     ctagtgccga actccacaag tttacatgac tgtcagcctt ctctttatga acggtatctc     49140
     ttctcacgtt actatgtttc atctgtaata accaaaaaaa gatagatata aagcttaaaa     49200
     caccccaaat tcccaatgca cccttccagc caaatctcca tccaagtgca atgggaacac     49260
     ttacaccgga agctattgct ccaaataagt tcatagaaat agaatacacg ccagtcatta     49320
     gacctatacg ttttggaaat tcacgtttaa ttagtccagg taacaataca ttcccaacgg     49380
     atatagccaa accaaggatt gcagtaccta tatataaaga agcaactcct gataaggaac     49440
     gtatagcaat accaactgtc aaaaagacga tagagccaag aataattagc tctaccccat     49500
     atttctgccc taacttggga acaataggtg aaaataacgc aaagcttaat aacggcagtg     49560
     tggtaatcat acccgccatt gtatttgaga tatttatatc atccttaata aaaccaacca     49620
     ttggccctac tgaggtcaaa ggggctcgta agttagctgc tataaataca ataccaacaa     49680
     tcattatcaa aacggaatat tttccaactg ttgatatacg ccctttattc tcctttttaa     49740
     ttacttgatc cattgaactc attctgtttc ctcctagaat ttgaaaaatc atgtaatgta     49800
     gtttattcat tatgaattac tgtaaagatg aataacgaat aaagaaaata tttgtagttg     49860
     aacaaatttt atatattata atatataaaa tgtcccgtaa tgtataatat agtataacaa     49920
     ttgaattttg tctatcctca aataaagaac tattttaaat aaatacaagg aatgctccaa     49980
     tccacctaat ggatgggagc attccttgta tttggataag ctaagaaaaa aatttagatt     50040
     gcgtatttca atataatatg aagaacaaca acatcgttag tatgattggt gtacgaatgt     50100
     gtaccatttg tagaaaaact aattgaatca tattgattta ggctatatga ttcattgtta     50160
     actaaatttg tatagaggat acacttagag aatatacatg aaatatgaca ttataggggg     50220
     aatgtgatga agggacaagg aagattaagt ttaagtgtcg gatggattac cttattctta     50280
     atgggaactg atttatttgt tgtatctcca ttattaccat tcatttcaca agcatataaa     50340
     attagttcag ctacggctgg atggatggta acggtctttg caattacgta tgctatttca     50400
     gctccattct ttggatggct ctcagataaa aaaggcagaa gatcttttat tacattgggg     50460
     ttattactgt ttgctgcttc taatatccta acggcctgtg ccccatcctt cttgtggttg     50520
     attgttagtc gtattttagc tgggttctca gtagcttcca ttaccccttt aatatacgct     50580
     attattggag atatcgcacc accaagtcga aggggaacat ggctttcaat cgttgtttct     50640
     ggtcacttaa cagccctttg ggctggaaca ccactcggta cattgttgga acattttctc     50700
     ggttggcgtt ctgtatttat tgtaatggcc atactaggag ttatattgat atttgtaaat     50760
     tttaaagcat ggaagtctgt tcctagtaat gaattaacaa caaatctatt aaaaggaaat     50820
     ctagcgagaa tacttggttc cgtaagcgtt actgccattt gggcgatttc gatgtacacc     50880
     ctgtatattt atttaggtgc agctctacac tttaataatg gattttcatc ggcagaaatt     50940
     gcactgactg ttacctttta tggtattggt gcggttttag gaagcctttc aagtgggcaa     51000
     ttaactgata agtttgggga aagaaaaata tctataaata cattgattgt attgacccta     51060
     atactccttt gcctaggcgt atttttctca tccggtgatt ggttgtattt ctttatgttt     51120
     atatgggctt tagttggata tgcagggttc acatcttatc aagctcgatt agctgttgaa     51180
     tatcctttag aacggggaat tgtaatggca tggaacaata cggctctata tattggcatt     51240
     accctcgggt caatgcttgg cggttacgtg atatcgaatt gggggtattc tactcttcca     51300
     tacgcttgta gtattgctgc tgttttaagt tttataatta gcacccaaaa aagaaagttg     51360
     ttaaaggaaa aaacaacttt tattagtaga taaaagacct cacaaggagg tctttttatt     51420
     ttattatcaa acacttttat taagtaaaaa gactaaaatg tcctagatag ctccgaaagg     51480
     gagtctactt ctcgttgaaa cccttactct cataagggtt ctttcgcctg tttgcttccg     51540
     taaagagtga ttatgttaac tagcattcct gtttgaaatt acttggtgtc ttgaaataaa     51600
     aaagtcccct tgatatgatg cagaaggtca tggccatgac ttcaattcat cattcaagga     51660
     ggactcttat gaattgtact caaaacgaaa agttaaatca agttacaccc catacactga     51720
     ttgtcggggt agatattgct aaatctaagc atattgcccg tgcacaagat aaccgtggga     51780
     agattctttc gcaagccttc cagcaccgaa tgaactgcag ccatttgaaa ttgacgatca     51840
     taaacttttc tacctataaa ccgaatgatc tttttctcct aatttagtgc acagtttatc     51900
     gtaccatctc tacatctgtc ggcaagcgcc gatgcgagcg acgcttgccg attagggccc     51960
     tgcaccttgc ttaatcctag tagatctcgg tcttagtcca gctatgcgcc gagttgctgg     52020
     accaacttga gcatttcttc gacgtgataa atctcggcga ccttgccatc aacgatatgg     52080
     aagatgtcaa tacccttcag cgccacaggt ttgccggtcg cggggacccc caagaattct     52140
     cctgtgtggg ttgcggtcat ctcccaatga acgagcaccc agtcgtcggg aagctcacgg     52200
     taaaaaagga ttcggtgcac cgaattggtg aacccggcgc gattgtcctc aaccaatgct     52260
     cgcatgcctt cgatacccgg tttctcgggg ttggcggggt tatggtcgat cagatccgga     52320
     gaaaacacat cctctatcct tgcagggtcg ccgacgtcga agaactccag ttcgcggaaa     52380
     gcgacctgca acggtgaggg aggtgtcgag cggaccaact cgctcgcggt ttttgctgtt     52440
     gtttccattg ttcatcatcc tttcgtttac taaaagtaat ttaatcgttt actaagatta     52500
     atttaacgat tatagttaca ttgtagatgt ataataccag atttgtaagt acgcacattg     52560
     gagatatata ctatcctaaa agatacctta aaaaggaggg aaatagagtg gataaacaac     52620
     actcccaatg cccggttgaa tttacggtca atatggttgg aggcaaatat aagctagtca     52680
     ttttgtacca gcttgcgact catgaggtta ggcgattcaa tgaattaaga agggaattac     52740
     ccaatattac gccgcgtaca cttactcgcc agctacgtga gctcgaaagc gatgggctaa     52800
     ttaatcgaca agtgtatcct gaaattccac ccaaggtaga gtattcgcta tcagagaccg     52860
     ggaagagcct taattctata cttcttcaaa tagagaattg gggtttgaag catatcgtaa     52920
     ataaacctaa ataatgatag gaagtaccaa gtaggagtag acatcttgaa ggttaatgag     52980
     ctatgtcatt tatttacgta aaaattgaaa tctcaactaa ctttaagctg tgttcttttt     53040
     taatcctctg gtttagagga ttattaacag atagtctcgt tatactcttc gagttgacat     53100
     taatcgaacg aacgtttatt attggcgcat gagacataaa gacgaaaaca aaaacgaaaa     53160
     tatttttaat gcaactatcc aacttataaa tgaaattggt cttgctgaga cttctatgtc     53220
     gaagattgcc aagaaggcta aagtatctgc ttcaacgatt tatgtttatt tcgaaaacaa     53280
     ggaggattta cttaacaaat tatatttgaa tgttaagaag atgatgactg aagcaatttt     53340
     taataatttt gatgcttcgc tatcattaca agaggcattt gaaaactctt taagaaaatt     53400
     tgttgagttt actttggcta ataaggatta ctttttattt atagagcagt ttcaaaattc     53460
     accacttctt aacaaaatat ctcgtgatga aatcacggac atctgtgagc ctctctatag     53520
     tttatttgag aaaggaaaaa aacaacatgt gttcaaacaa gttgatacaa acctgctggc     53580
     tatttttact ctccaaccac tgatgcaatt tgttaaggaa cattttaatg gaacaaccac     53640
     tataaatgaa gctaatttaa acaaagttat tcaaatgagt tgggatgcta taaaagctta     53700
     agagtcgatt cgacttttaa acagagggag aaagcagtaa taacaaaggt ttattaaaaa     53760
     aattctccct ctgaatatga atgactcgaa gataatcgaa cgatcgttta ttatagaggc     53820
     tgtcaagttt agtcagatgt ttaagatttg tttttttaga atataaaatg aacgaacgtt     53880
     cttttatttt aaagaatgat aaattatgac gaatatctaa ggaagaggaa cttttgatgt     53940
     aatgcatcct tagtttaaag aaggttaaga taagcaagga attatttttt tatagattaa     54000
     atgaacgaac gttcgattaa tattaaaggt ggtgataaga ataaagaaaa acgtggctat     54060
     gcctttatga aataaaacaa cctacaacat aagataaata aatatgtaag aaagaggtta     54120
     aaacatgaac aaaaaatata ataacttatt tgaaacattc acatttaaaa atggagttac     54180
     tcttaaaaat agagtcgtta tggcaccgat gacaacttgg tcaagtaatg atgattacac     54240
     ggtttcagat gaagaattaa cctattatca aaaaagagtc aatggagtag gactcgttat     54300
     tactggttgt actcatgttc agccaaacgg tattggtttt acgaatgaat ttgcagctta     54360
     tgacgataaa tttattccaa gtttacgaaa attagctgga gctgcgaaaa gtggtggagc     54420
     tccggcaatt cttcaaattt tccatggagg gaataaagca ctaccggctt taaccccaaa     54480
     tggagaagtg gttagttcca gtgccttgga aactgaagct tctgactttg ctccttcggt     54540
     attacctaga gagctttcac atgatgaaat actagaagtg attcatgcct ttggagaaac     54600
     aacaagaaga gccattgaag ctggttttga tggagttgaa attcatggtg cacatgggtt     54660
     tttacttcaa aacttcttct cgcctttctt caatagacgt gaggatgaat ggggaggttc     54720
     actagaaaat cgcttgcgtt tccctcttgc ggtcgttcag gaaattaaaa atgttattaa     54780
     aaagcatgca actaaaccgt ttattttagg gtacagaata tcacctgacg aacatcaaac     54840
     aggtggttta agaatgaagg atacttatga attaattaat cgactcattg aagcaaatgt     54900
     tgattatgta cacgcttcgt tggctaacgc tctctcttca aaaccggttg atagtaaaga     54960
     tgacaaaacg tatcttgaat taattgctga gcacgtaaat aacagagttc ctgtcatagc     55020
     tgcgggatct atggtcactg cagatgatgt taaaacggca ttagataagg gactctctct     55080
     agcagcaatt ggccatacgt taattatgaa tccagactgg gtagaaaagg ttcaaaacgg     55140
     aaaagaaggc gaaattgaaa cagcacttaa ggcttctaaa atcaatgaga ttgagattcc     55200
     agaaaaactt tggaatgtca ttcaagcttc aggaccatgg tttaaggttg aggaataatt     55260
     ttacccacaa ttaatgatga ggaacaaaag atattttagt gagcaacatc ttttgttcct     55320
     ctatattcta tctagttatg ttttatttcg ataaaaaata aagatgttca caaatatttt     55380
     aacatttatt cacattctta aaataatcgt ttttaattct tgtaatatgc tactctatct     55440
     tctacttacc ttttaagaaa ttgttttatt cataataatc atatggaaaa tttaaaatca     55500
     tttaatgtta atatatattt gataatataa tcattattaa aaataaaaaa taaacatttt     55560
     ttatagtgag aagtaaatga ataaactctg ttatgaaaat ttaagtttca ctatttactc     55620
     tacctgacga caaattggtt ctttttctac atatttttag aagcattttt gtcattttat     55680
     ttttaatatc aaataatgct tcaaaatccc gttgttttat gactattcag gaaggtgtgc     55740
     tttttatggg caaatagaaa accaatatgc aataggattg ggcttctctg cggatttaag     55800
     ttaatcgact ttctccttca tgaatttcta tcaaagcttt tgcgttcata ctaagataac     55860
     gatctttatt atatgtaaat actagggtac gagtaggatt ggagtccaat ttaatataca     55920
     ttacggaatt ttgctgaaga tttttatgaa tgaccatctc aggaacgact gttactccaa     55980
     gaccatttgc cacaagagat tgagctgttt cgatactact tgtttcataa ggaacctggg     56040
     gttcaaactt acctcttgca cataattcta aaactgtacg acgaaaacca tatccttttt     56100
     ttaataaaat aaatgggcaa tttgcaaaat cttcaatgga taagattgtt tgttctttta     56160
     attttgatga agctatcaaa tttttaactt tttttggggt ccaatttttc tgttcttgtg     56220
     gtaaggccag ataaagtggt tcagtaagta ttatttttgt ttctaagcga gaatcttcaa     56280
     tagggagtga cagaatagaa atatcaacta aacctttagc agttaagtct attaattttt     56340
     ctgttgcttc ttcaatgagc tgaatatgta catttggata ctgtttctca tagtttttaa     56400
     gaagtgaagg taaaatatgt cctcctgtaa tggctgttga accaatcttt aaatcacctc     56460
     taatcccttc tttgcgttcc tgtatctccc tttttagatc atcacgcatt tgtagtattt     56520
     tctcagcttg ttttacaaaa cataagccat ctgaagttgg ttctactgta ccgggttttc     56580
     gatgaaacaa acggataccg agctcatttt ctaactttgc aatttgctta cttaaagatg     56640
     gctgtgcaat atggagatta gaagcagctt ttgtaaaact tttagtttta tatatttcta     56700
     gggcgtattc aaatagtctc atatccatag tattcctcca tagcctctgg ctattaactt     56760
     aatagattat atatcttagc tgaatatatg tttatatatt atgataaaaa taacaatagt     56820
     tcaaaattaa aggagtgata ttccgtaagt tcgttgaatg tttggaatgc agatttatat     56880
     gatgataaat taagctttgt atctaatttt ggaaaaggag tggttgagtt acttcatcca     56940
     caaaaaggag aaagaattct tgatttgggt tgtggaacag gcgatcttac atatgtgatt     57000
     tccaagtcag gtgcgaatgt tactggaagt gatttctcag aagaaatgat tgaaaaagct     57060
     cgtagaaaat atcctgaaat cccatttgtt atcgaaaatg gcgaagattt tcaaacagat     57120
     gaaaaatacg atgctatttt ttctaacgca gctcttcatt ggatgaaaca ggctgataaa     57180
     gttgtggaat cagttcaact agcgttaaat ccaggaggac gctttgtagc tgaattcgga     57240
     ggggaaggaa atgtacagac tgtcatcaga ggaataatag agactctatc tcaagattat     57300
     ggaatggatg tagaagaaag aaatccttgg tattttccaa gcataggaca atatagcaca     57360
     ttgcttgaag agcatggatt tcgagtatcc tatgcacatc atttcgatcg acctacatcg     57420
     ttagcagatg gagaaaaggg attaaatcac tggttagata gctttgcaga tgatttcttt     57480
     cctgagtttt ctaggaaaga aaaaatgaaa atttacgaaa aaataaaaaa taaaataaaa     57540
     accaatctat ataaagatga tacatggata gcagattata aacgaattcg aattgtcgct     57600
     attaagaaaa agtagagatt tattaaggag gaggtctacc gtatggaagg gaatattgct     57660
     cgtaatcgag ctcaattatc ggggaagtta acaaacgtat tggattcccg atcattaaca     57720
     tactctcata aaaggcttgc cagtatactt aagaaaggga tgacggttct tgatattggc     57780
     tgtggaacag gggcaattac acgtggaata gcagaagtag taggaccaaa tgggcgtgtt     57840
     ataggaattg atagtaatcc aattctaatt gaaaaagctc gtcaaactca tggtgaaacc     57900
     ccaggattaa cctttgaaac aggtgacatc tataatctta cctataaagg acaatttgac     57960
     attgttacct ctgcccgtgt tttaatatgg ctgtctgatc ctttgaaagc attgcaaatg     58020
     atgaaagatg cgaccaaaat tggtgggcgt attttggttg cagattataa tcataagaag     58080
     atatcatgga aaccacagcc tcctccaagt atgatttcct tttactctgc atatttgaaa     58140
     tggcgttctg atgcaggtat gaataatgca attgctgatg atcttgctca tatgtttcgg     58200
     gaaatcggta ttcaaaatat cattgtgacc tctcaacacg aggtatccaa ccgtacggat     58260
     tttaatttcg aaacaaacat tggtatatgg gcagatactg cttcaagtag aggaatccaa     58320
     atggaaagag atgggtatat taccgaaata gaatatacga caacggaaaa ggaatatcgc     58380
     gaatgggtga ctaaagaggc ccaatcttta acaatgtaca tgttagctgt agagggtgta     58440
     aggactttat aaatacattt catgtaaaaa ctccaattta tattaataaa ttggagtttt     58500
     taactaccta gaagccgtat tatggtaact aactgtgtat agaaaaattc atttactccc     58560
     tttattccaa agaaagaaga ttaaaccagc ttcacacaca gtattattat gtaacttagc     58620
     aatgccataa gcttttctaa atgccccttg gacacatgct acttctactt ctaaatatta     58680
     ctttttaagt ctccaaatgc ttttgagatc acttcgtttg ttgcttctgt aacagcctct     58740
     ttatctttag tcattttagg cacatgaata gcatctccta agatgatagt cctgcgcttt     58800
     ctacctaata aatcttttat cgtatgaggg cctatatata ctgctggtat aataggaaca     58860
     cttgctcttg aagcaatatg aatagctcca ttttttaaag ctttctcttc tgagtttctt     58920
     gttccacttg gaaagatccc aactacttgt ttctttttta gcaattgtaa aggtattttt     58980
     aaaacactcg gtccaggatt acttctatct acgggaaatg catttaattt tgtcaaaaga     59040
     tttttgatga aaatcttatt aaataactct ttcttagcca tgaagtgaat agggatggga     59100
     tgtaacgcta ttcctaaaca cactacatcg atccaacttt tatgagtgca aacaacaata     59160
     aatggttcat tttgagggag tttttccttg tttattacgt tcattcgtcc gttcattaaa     59220
     gatagtagaa gttgtagaat tcttgttgca atggtataca ttaatccttt actccttacc     59280
     taaatcccat ttaataatat gacctgcgtg agtaaggcct cctccaaatc catagagtaa     59340
     gagcacgtct ccatttctta atttcccttc gtttattcct atttgtaatg ctaaaggaat     59400
     agaaacagaa gaagtgtttc ccatgtactc aacactagtt aatgtcttct caattggaaa     59460
     atctgatctt tcacatatag actcaatcat tcgtaaattg gcactgtgtg gaacgaacca     59520
     atttacctga ttcttttgta ggtttgcttg ttctagcaat tcagatatcc ctaaaggaat     59580
     tgttctagat gcccacttat atacttctct tccgttttgc accatcttgc cacttgaact     59640
     taaaggttgt ccatgcatag tagtagataa atttgtacga tatacatgtt tacctccctt     59700
     tccatttgtc ccaatatgcg tagcgataaa gctcgggcgc tctgcatcat tttctaccaa     59760
     aacagctgca gccccatccc caaacagtac gcaagtagta cgatctgtat aatctgtcac     59820
     ttttgataac gtttctgcag ttacgactaa gactttatga tgaagtccag atgtaataaa     59880
     ggcattcgct atatgcaatc catatgtaaa gccagcacag gtggcattaa aatctagagc     59940
     accagttgta ggaatatcaa agtggttttg tatttgagtg gctacgctcg gaaatgcata     60000
     gtcaggtgtt gtagttgata caataataca tcctacatcg cttaactctt tctgatattg     60060
     ggccactaag ttttcaattg ctttaatagc taagttggaa gaatattcgt tttcatccgc     60120
     aattcttctt tccttcatgc cagttcgttt cacaacccat tcatcattcg tatctacaat     60180
     tctttctaaa tcatcattcg taagcctttt ttctggtacg tacgtaccta ttgctgtaat     60240
     acgtgcagtt gatttcatgc tattcacctt tacttattac taagatatat aaattgatat     60300
     tagtactagg tactaacaaa gtcaatgaat ttatatggaa aaattgtaaa tcaggcttat     60360
     gtagacctaa gaataaaaat aaaatccttt aaaactattg attttaaagg atttttgttt     60420
     cttataaatt acattatgta aactgaagtt tgtatatcgt atacataatt ttcaggagtc     60480
     atatttttat ttgttgttag ttagagtagt tgataacact ataattttat atatgatagc     60540
     ttatcagtta cttaacttat tgtattcctc ttcttatata accaattata tattcaggag     60600
     atcccctttc ctgattccta ctatatacac atcttctctt aacaccattc ctttatcaat     60660
     ggtaatagtt ctttcactcc catctatcaa tgtatatatt ttgcctttct tcatgtaaca     60720
     attctcccct tgtataaaaa ccccatagtt atacatacta atgaaaaatg cattttttaa     60780
     aaggagttca ggatagtgaa tagagaacaa gtgattgaaa tttatcaaca tgttctagaa     60840
     aggaaaagaa aacggtttcc taattatttc tttgtaggta aggaaggaaa aaaatatatg     60900
     agctatatga cacgctatct acttgaacaa catttaatga ttcgtgttca tgaaatccct     60960
     cttcaagtag gggcaaatac gttgtggtct catcgcctca gaccacctgc aatgctttat     61020
     ggatggaatt attatgaagt cattgataat gcctatccgg gaagatttaa accttggcag     61080
     ttccaacaag ttcctgataa atattgggat ggagaagagg gaaaaaaacg agctattgaa     61140
     gcagtaaagt atgtaataga gaaaaaacta aaaatccctc ttaacgaaat tcctattcaa     61200
     gttaatattc acttttttaa tcaacatagc ctaggaggtg tcttttccct tttcggccaa     61260
     tctccttttc aagtgataga agctgtttat cctggtgtct ttagaccctg gcaatttgct     61320
     catgtgccca tgaattgttg gaaaaatgaa aaatatattc gggaggcaat ggaagacttt     61380
     ttattcaaac agctccattt ttcttcctat aaagacgctt tactcaaatt aaaaagaaat     61440
     cattttactg atttccaatt aactggtctt tttcaaatgg cttttgattc cagaatgaat     61500
     aacgttaaga aatggataaa aaatcaatta ataaatatag gtaaatgatt attttatacg     61560
     gatcttgact agtagaagaa ccgagtagaa cacataaccc ggactacgtt catattattc     61620
     ccattttcca gcttcaaaaa tgacgattta tacgtatatg gttacttact ttgatttccc     61680
     tttctctcct ttatgaaaag gtaaacagat tcagcgaaaa aaagaaaaag aagaaagaag     61740
     agcacaaata attcggcaac ctccattacc cgaaaaggac tcacagcatt gtacaatgcc     61800
     tgagaaacat caaacccttg aaaaatatcg atacctaaag aaaaagctat taaacatccc     61860
     agcatcaaaa gactaatacc catgattttc atatttatca cgctccattc aataggtttt     61920
     tctcttttac ctattacgat acataaatat taattgttaa aaagtaaata aaaacccttc     61980
     atatggttaa attaataaaa actaaaagaa gggtgcttga atctatgcct tcgtttttta     62040
     aagatcgaaa atcaaaaaag aatcgccaaa aggatgctaa aaatcaagct actgatcaat     62100
     ccgcagaaca tatacaagat tcgttgtcag cgaaccttaa cattattaaa caaaaaacag     62160
     gaaacagttc agacgttgtt attcgtcatt taaaaatggg aagcaactcc aatataaggg     62220
     tagcgattgt gtatctagaa ggaatcgtag ataatcaatc gattcaagaa ttcttacttg     62280
     aatccatgat gaaagataat gagaaagaaa aagtgaatga acacaatgcg ttagagttaa     62340
     tttctgaaga tatgatggcg gttggtaacg taacatttat ccataactgg gatgacttat     62400
     tttcagcctt aatggtaggc gatactcttt ttctagtgga tggaatagac caggcactgg     62460
     gtgctggcac ccaaggggga gaaaaacgtt ctattgcaga atcgactacc caaatggtgg     62520
     ttcgggggcc aaaaggtgcg tttacagagt ctatcggaac caatacagcc atggtacgtc     62580
     gcatcattaa gacccctgat ttatggacag agtcctttaa aatagggcgt gtaactaaga     62640
     cagatgtgac acttatgtac atacatgaca ttgccaatga caaagttatt aacgaaattc     62700
     gtcaacgatt aaacaagatt gacattgata gcattttaga atcaggctat attgaacaac     62760
     tcatcgaaga cgaaacgatg acttcatttc ccactattta caataccgaa agacccgatg     62820
     tagtggcagg aaatctgtta gagggacgga ttgctatatt tgtggatgga accccctttg     62880
     tactgattgc acctgctgta tttatgcaat ttttccaatc ggccgaggat tattatgccc     62940
     gtttcgacat tgcaacctcg attcgtcttt tacgtatttt tatgtttctg atttcactta     63000
     ttgcgcctgc tacttacgta gctgtcacga cttttcatca ggaaatggtg ccaaccactc     63060
     tcattgtagc tattgctgcg cagagagaag ctgttccttt tccggcattt gtggaagccc     63120
     ttcttatgga ggtcaccttt gaaattttgc gagaagcagg gattcgactg cccaaagcca     63180
     ttggttcagc cgtctccatt gtcgggtccc ttgttatcgg tcaagcagcc gttcaagcga     63240
     gcattgtatc accggctatg gtcattatcg tttctatcac cgccattgct agttttgcta     63300
     caccttcctt tgatatggcg atttcggctc gtttaattcg ctttttattt atgctcggtg     63360
     ccgcaacatt tggtttctat gggattattc tggtcttgct gatgatggtc gttcatctat     63420
     gcagcttacg ttcatttggt gtgccctata tggccccctt tgcacccttc atccctgtaa     63480
     ataatgggga tactgttatg aggttaccat ggtggacact gagacaaagg ccacgattaa     63540
     ttagcacgaa tactgttcga gaaggagcaa atcaacgccc gcaacctcct gcatctcgtg     63600
     gtatggtgaa tcgggatttt gaaaaaggtg ataacaatga agcgtaaatg ggctgttctt     63660
     ttgttgatga tactggttac agccttgctc tcgagttgtt ggagtaaaaa agagttaacg     63720
     gaccttgcca ttgtatcagc tgtaggtatc gataaaacga aagatggaaa atatcactta     63780
     acgctccaaa ttattaaccc aggaaacgtg gctggaggca tgcaaggggg aggtggtggt     63840
     acgcaaagtc cccctgttac catctattcg gcttcggggg acaatatagt cgaagcaagt     63900
     agaagggctt caagcagaat ttctcggaga ttgtattatg cccatgcgaa cttggttgtg     63960
     attggtgaga aactggcaag agaaagtggg cttaacccgt taattgatgt tcttgaccgt     64020
     gatcctgagt ttcggactac cgcaaccatg gtgattgcta atcattcaac cgcagcagat     64080
     ttagttcaaa cgttaacacc agtggataag attccagcga ataaagtgct aaaaacctta     64140
     gaatttacgg aaagaaaatg gggagagaat gtaaagttat caatccaaga cgtaatcata     64200
     ggattagaat cccctggagg ggaaactatc gtaggaggat ttcgtttggt tgggaaccct     64260
     aagcaggcac gaatgttgga aaatcttcaa gaaagtgcgc ctgaagcaac gcttcgagct     64320
     tctggaattg ctgttttaaa acaagggaaa ttggtggatt ggctgtatgg aaaaccagca     64380
     agaggaacgg tatggattct cgataaaatc caaggaacgg atattaatat tgattgggca     64440
     ggaaagaaag aagctattgc ttatcaaact gtacgacaaa aaacaagtgt atctgcccaa     64500
     gtcaagaatg ggcaacctca tatttctgtt catacacgtg tggaaggaga tatcggcgac     64560
     atggaggtac ctgttgatat caccaatccg aaggttatta caaaaatcga acaattcgtg     64620
     aggaaagaaa ttaaaaaaga actaaagaca gctattgaac aggcgcaaaa aaacaaaacg     64680
     gatatttttg gatttggtga agtggttcac cgtactagac ccaatcaatt taagaaatta     64740
     aaaacggaat ggaatgatgt gtactttcca aagttagatg tagatattac agtggaagcc     64800
     tatgtacgtc gagctggctt acgaaataaa tcgtttcttt caggagtaaa agagaatcaa     64860
     aagtaaggga aaggaggtgc cagttgaatg gagaaagcaa aaattagtgc cagtcagctc     64920
     tttatcttaa tggttctgtt tgagctgggg agtgctttac tggtacctct tgccataaga     64980
     gccaaacagg atgcctggtt ggctattctg cttggaatga tatttagctt tgttttattt     65040
     tttgtctatc ataaacttta tacgtattat cccaatctct tgcctacaga gtacatgcaa     65100
     aaaatcttag gtaaagtact gggaacgata ctcgccttta tctatattct ttactttatg     65160
     tatgatgcct caagggttct ccgtgatttt ggcgagatgt tgttgacatt tgcctatcct     65220
     gatacgcctt tatttattgc caacgcatta ttaatgcttg ttattattta taccattaga     65280
     aaaggaattg aggtcatagc tcgctcagga gaactgcttt ttatttttat gtatatcctt     65340
     gcggttgctg ggtttatctt aattgtatct tctggcttaa tcgagattaa aaatttacaa     65400
     cctgtattag aagaaggatt gttaccatca ttaaaagtgg cattgtctga aacgttatat     65460
     tttccgttta ctgaagctat tgtgtttaca atgattttgc catatttaaa tgattctaag     65520
     aaggcaaaag tgaccatgtt atgtgcaacg ggattaagtg gaatcaattt ggctattaca     65580
     atgcttatca atgttagtgt gcttggcgtt aatctaactg cgcgttccca atttcctctc     65640
     cttagtacag tagagagcat ccaagtagct gattttttag aacgtcttga tgtgtttttc     65700
     atgcttgcca tggtgattgg tattttcttc aaagtaagcg tattatttta tgcagccgtc     65760
     ataggtacgg ctaacttatt taagattaaa tcaccttccc gaatgtcgta tcctttaggc     65820
     atcatcattc tatttatgtc tatgacgatt gcgagtaatt ttcaagaaca tctccatgaa     65880
     ggactctatg cagcaaaatt tgttctgcat attcctctct tcacagttat tccctctctc     65940
     cttcttcttg tatctttctt aaaaaacagg aagaggcatg gcggataacc cattggtcta     66000
     gctaattttt atatgggata ttacggttat tattaaaatt tccaatggac ttcttaccta     66060
     tgaagacaat aatgctatcc tataactaac tttatagcga atctggtagt tctacataac     66120
     gttcaaaaga ttggaagtaa tgaaaggtcg agaaagcaaa agatcaattt aaataaaatt     66180
     gggaaggagg ttcaaattga atggagaagg caaaaattag tgccagtcaa ttatttattc     66240
     taatggttct gtttgaacta ggtagttctt tattggtacc tattgcaatg gatgcaaaac     66300
     aagacgcttg gcttgcgatt ctgattggaa tggtaggaag ttttgttcta tttttagtct     66360
     atcataagct tcattcttat tatccggatc tcttacctac agagtacatg caaaaaatca     66420
     tgggtaaagg gattggaacg gtacttgcct ttgtgtacat cctttatttt atgtatgatg     66480
     cagcaagggt tctccgtgat tttggcgcga tgttgttaac ctccgcctac cctgagactc     66540
     ctttattcat tgcacatact ttattaatgc ttgtcgttat ttatacgatt cgaaaaggaa     66600
     tcgaggttgt agctcgctca ggagagatcc tttttatatt tatatatatt tttgccatca     66660
     tggggtttgt tctcatcgta tgttcaggtt taatcgagtt tacaaactta cagccagtac     66720
     ttgaagaagg tgttttacct gtcctgaaag ttgcatttac tcaaaccatc tatttcccgt     66780
     ttgcagaagc gatggtattt acaatgatat tgccgtattt aaaagaccaa aaaaaggcaa     66840
     aaatgacgat gttatgtgca acaggactaa gtggcatcaa cttaactatt accatgctta     66900
     ttaatattag tgtacttggg gttgatttga cttcacgttc acaattccct cttcttagta     66960
     ccgtacaaag catccaggta gctgactttt tggaacgtct tgatgtattt tttatgcttg     67020
     cactagtgat cggtggtttc attaagatta gcgtgttgtt atatgcagct gtcataggga     67080
     cggctaactt gtttaagatt aaatcacctt cacgcctttc ataccctttg ggcttcgtta     67140
     ttctatttat ggctagcacg attgcgagca attttcaaga acatctccat gaaggactaa     67200
     aggtagaaat gtttattctg catatgccta tcctcgcgat tattccttct ctgcttcttc     67260
     ttgttgcttt cttgaaaaac agaaagaaac agagaggata acaaatttat ttgtattttt     67320
     ttccgaagtt gaagtaattc atatattctg ttgaattctt ataagctaaa gcttaccaat     67380
     gtgaatttaa actatttgag gtggttttta tgtatacatg gttttatgat catttcgtca     67440
     atacaattct atttcctctt acttgtatag tgatggtagc cgtcacgtta agtgcatatg     67500
     catactttaa attgaaaaaa acaaagggtc aatagtctct tttttgattt aatcaaaaga     67560
     attattacag aagatgaatt taatgatcta tctcatgagc tttataaaaa gtagacaagc     67620
     ttaagatatt caattgagct agaaaaggag ttacaccaga gaggaagctc ttaataaaaa     67680
     aagcaacctc attcaccgtg gagttgaact tttctctctg actaacgtgt ccagtatgtt     67740
     ggcttagatc caaccgttaa tatcccttct atgactttac acagtttttc agaattataa     67800
     tgggttaatt gaggtcattt tcgctagccg atacccattc agatatttca tcaaaaatat     67860
     tctgaacttg ttctttattt aaaacttcaa cttttcccca aacgatggac agatattcct     67920
     ctaagtgatt aggatatgaa agagattcag taataagggc tttataaaat aatggattac     67980
     cccctttatc tacttcacct ttacatctat agttttcaaa ttcccatcct ctttttgttt     68040
     ttttaaaatg ataaaggtcc ttatcccccc attgaggact gtaaatctgc attttgaatc     68100
     tagatgtcct actcaattgt aaatacctcc tcaaaaatat aattttaata aggcactttt     68160
     tatctttacc ctttaaacat atattttatt tacatctttt ttaccataat tttggcagtt     68220
     ctaattacgt cacccctata cggctcaact ctattatgat acttatattt tttcattttt     68280
     acgagcttta ttattcccta taagaggtag tatgataacg aaaaatgcat aatatatagt     68340
     gtaaaagcag aaaaatactg cctcttccca gttaaaagag gcagtatttt tctgttcgtt     68400
     gaatggtagt cgttaggtaa cgctctattg caccttggat agtttgcttc aaatataaaa     68460
     ttttaaacgt tttattaagt aaaaagagct cagtatacta ggatcttttg ctggataaag     68520
     tattatcttt tacatacatt tcataatgtc catttatata actagttacc tttaaattaa     68580
     gtaaaagggc ttttaggtta actagttcag aatctaattc atactctctt gccagatctt     68640
     caatcttctt tttgataatt tgtatattat tttctaaatc agttaccgtt ttttcactgt     68700
     attgaaaggg aacttcatct acaacttctg taattaattg attttgtcct tggtgttctg     68760
     atttcccctt aattgcagcc tgttttccaa tcaatacagc ctgctctttt atgtctgaca     68820
     gaagaatcat taaattaatt cgtttactca taggtatatg atgcttatca aaagtagaaa     68880
     taatttttgt ttgatagtca tccatagttg tatgtaattg atattttgct tctcgaatta     68940
     cttcttcctg atttttaata agtatcattt acgaactccc ctataatctt catatatata     69000
     aactatgatt atcaagttaa cattttctaa taaaaggaaa aaaacaaatc tttaacaaat     69060
     aaagacatgt ttcttttaaa atccaatcca atccaacata ttaatttacc ctttgagttg     69120
     aaaaataaac acaaaaaaag aaactaatta ttacggaaat aatgaaagaa tgaatatatg     69180
     attgccgata acggtgatta tgccaagtaa agatgtatat gaaattgatt tacattttat     69240
     tcatccaaat tggacaagaa catttattct aaagtatcta tcgttaaatt taaaccaaga     69300
     agtgcttgct ctagatttgc ctttacagtt atttcattaa aattaattcc aaggtgaatc     69360
     attgtctgag caacttcagg acgaatacca attaacatag tttttactcc aagaagactt     69420
     aacgcatcta taatattaaa aatttgttga gcaaccatgg tatctacaat catcacacca     69480
     gagagatcga atagcaagtg tgataattgt agtttatttg ctttcgctaa tgtttcctct     69540
     agtaaaagcg ttgctctttc tgtatctacc tctccaatga gagggagtat agcaatcccc     69600
     ttggtgattg gaaccaccgg tacggataat tcaaggaaag cactctttgc tttttttagt     69660
     gtttcttgat gaatatttac atacgtcaaa ctaaaaacat aaacagcttt atctaataaa     69720
     gggtcaataa tagtgattaa ttcaaatatt gtgtctgtag gtatattatg atttcttatt     69780
     tcttctttaa ggacttccca tatgaatttt cggtaatagg tcgtatcttc taaagcctca     69840
     ctcagagaaa tacctagatt tgatgcaaat tctcctgact cttttgccca tttcactatt     69900
     tgatcaaaaa ttgttttttg atcgattttt tccatgagag cctgcccaaa ataactgata     69960
     aagtttgctc tcaattcaat aatttcttca tttgtgagat tgacgtcttt tatttcttta     70020
     aggtcagcca ttctattggt gtgtaccatt tgtgcaattt catacttttt ctctaagatt     70080
     ttttctccta gaaagtgcaa attatccatt taattcgtcc cccgagctta acttctctaa     70140
     aaaagtagtt ttaactattt tatcatttaa aagaaaggct gcataattag gaattgaaga     70200
     taactagaat gttccaaaga taataaaatc cttttaatta attttttagt tcgggaaatt     70260
     tacattatgg taactaaagg tgtatagcgt atacagtcta aaaacagaac aaactaatta     70320
     ttggtagttt gttccagtcg ttgaaatata gatgttaagc tgatgattta ttgcaactgg     70380
     aatagtttac tcaatatatt aaaggacatt caatattgaa atgtgtaaaa ttatcacaaa     70440
     taagaacacc ttattactct atagattttt aggaattttt gctaaaatta ttctgaggtg     70500
     aactatgaaa acaattaatt ctatatctag ttccaaaaaa tttgataaag gccatgtctt     70560
     ttatcgtttt gaagataaac aattttacat aaataattta attagtttta ttaggagtgg     70620
     actagaaagt aaggaacata tattgataat tgagagtatg aggacactcc ctcaaataaa     70680
     agctaacatt gatgaagagt ttagtcatca acaaaaaaaa tctattcgtt tagttaataa     70740
     ttttgattat tacttggcaa atggtgattt tcataccaaa acaattcttg cgcattttca     70800
     agaagatttg tctacgttga acaagaaaaa tacattgata agaacatggg ctcacgtaga     70860
     atgggcttca gaggaaccag atgttttttt actagaagaa tttgaatcaa ctgccgataa     70920
     ttttgttaaa gggaaaggta tgatttcagt ttgtgcatat gctgctgagt ctttgtcttc     70980
     tactttggat actactttgc agcaattaca tcaatatatt atgacagatg ataacttttt     71040
     tatttctccc ctttacaatg ggtgaattta ttaaaattat ggcaatgaat tctacatatt     71100
     catgactttt ttagttccta tatactgttt tatgttaagt aagagcgaat actttataca     71160
     atttaaaaag aaaacaacta ccttcgtaag aagatagcta ttttctactg ataaattaaa     71220
     ttgtgggtga agcctcacta gacttcttga gtagtttgct cgctataggg gagattattc     71280
     aacataggca atttaaatat aataaaatga aaataatatt agattagttg tatcagaaat     71340
     cataacaaag ttatagcttg cttatatcag ttactagtaa tataaagtta gttgattgaa     71400
     gattcagaaa gtccttctgc ataaagacag cgcctaatta tttaggcgct gtctttatgc     71460
     agatttctta taatgtacat tatgttaact aactttgtat atcgtataca gcctaaaaac     71520
     agaaaaaact actgactcat caggtatcag tagttttttc gttcatgaaa cttttgggta     71580
     gaaagctaat gagcttctta agtagtttat tctaaatata taagattatt cttttttctt     71640
     agcaagttgt tccttatctt ttgtaccagg agctatgcag aatccactac tttaatgtta     71700
     tctaaaggca tttatgatag acctcccatg attacctatc ctgagaaggt cgaatacgta     71760
     aaaaaacaat cttatatagt agcagccgta gggaaaaaaa gacctttaaa tgctgtcgag     71820
     cttactgaaa tgttctttaa tattgagcgt aactattttt ctattttact ctgtataggt     71880
     ctattacaag tggttaagga taaagaaatc aaaaattata taaaaaatgg gatggaaata     71940
     tcagaaaaac agattaattt ctttaatgat cttttaaaaa aagaagatct tctcggtaca     72000
     gttcctgtta gcatggaagt gacgaattca accgtttccc ctttttctga gaagctaatt     72060
     gttgcacttt ttcatttttt aaattctatt gacgtcacac ttattggaca tgctttgtct     72120
     ctatctatga ggttggattt agctacttac tacagtaaat tgattggaga aatattactt     72180
     tatgctgaaa agggattcaa tattatggta gaacgacaat ggttagagca accacctcaa     72240
     gcaccaaata gaaagggatt aaagaggaca taacataact tactaagagc aaataatgct     72300
     cccaaaatct gttatttggt gaccgttcag aaaaatgcca tttataaact gaaaagccct     72360
     tgataaaagg gctttttagc atgatactgc cggtaatttt gattatggta actaaaaatg     72420
     aatatgggat acactctaaa aagagaaaaa gaatgctcct taccagtcaa aagaggcatt     72480
     ctttttctat acagtaatcg ctacactgac ttgatgcttt attgcatctg ggggagtttg     72540
     ctcaagatat tatttattat tcaattttgt aatcattaaa taaaaagaaa cagacttgtt     72600
     aggaagtctg caactgcaac aagaaataaa gttatttaca tacaacaggt attgtatatg     72660
     atcaagcgaa ctttagcagt ctgccctatt gagaagattc tataatttat tgaccttatg     72720
     tagagtagat ttgtataccg tatatatctt taaaaaagaa aagactaccc cattcccagt     72780
     caaaagaggc agcctttttc tatacagtga ttgaaatgtt gtgttgacgc tttgttgcat     72840
     cttgagtagt ttgcccccgg cagtaaaaaa tatgtacata cataaaaaat gaagtatatt     72900
     ttaaatttta tttgaatgta tgttttgaaa catataaaaa agggaacagt aacttaattt     72960
     tattccagat aaattttaaa taagaaaaat ggttaatatg ttgaacaaac tgtaataatg     73020
     aatctggagg gaaggtatgt caattaataa agaagttttc tatcgcggta aacgatttaa     73080
     gattattcat atttatagtt ctggttattg tgagcttaga aaagttaacg atccttttaa     73140
     agtagaacta gctttattaa atgatatcct gctaatgggg taatgattac tgcatattct     73200
     tatttaacta accaaaccga actaatttga tttttgttat taaataaaca tattaatcat     73260
     ttttttgata aaaatagaag ccaaattctt catatataaa gaatttggct tctattaatt     73320
     ttgattatgc taactaaaaa tgtatatcat atatagcata aaaatagaaa aattcaattt     73380
     tacaaacaat tagtcatcat tacgtttgtt gttggatttg ccgccctttt caccgatttc     73440
     ttggtaaaat tctttgtcgt gatttttagc tgtagctttg ccacccattc ttccagcttc     73500
     ttcacggctc attttgtcat tatttttatt agttgtcatt ttacattcct cctaataatt     73560
     tttaatatat tttttatctt ccacgtttaa aaggagctaa actatttatt tcattttcct     73620
     aataattgag aatcatttcc ctttttttat ttcgtgactc ctctttttta aaaacttact     73680
     tatatttgct gatatgcttt cttttaatat gagagtacct ataaaaatct attatgttaa     73740
     ccagatttca aataaaagcc aaaggttttt tactttttgg aatagaatag ttccttatag     73800
     agtcataaag gagctgattt cgtgtctaaa caaatgaagg acataaatga aataaaactt     73860
     ttagattctg aaatttattt atgtaatcag attaaagact tgttgaaaaa gagagatcga     73920
     agaaatcgat attctaaacg acattataca gaacatgagg tcttacagat tgctttaaat     73980
     agattaatga gtgaattaat ttctagacag tagaacatca atattactta aaatgttaca     74040
     tattgaatgt acgtaagtta agaaaagaga aggtcaacca tgtgaccttc tctttaagtt     74100
     tatagattcc tcaaagagac attgtgttag ctaaaaatgt atagagtata tagtctaaat     74160
     agagaaaaac tacaggtgcg ttcaatagat tcttctgttc attagttgtt ttttgtttca     74220
     aatcaggcag gttagaattt tgttttaaaa accttgcaga aaacagtaat atcagttttt     74280
     aaaggcttaa gataatagat atgctagaaa aggttatgct aagaaaaaag cctgaggaga     74340
     ttgtgtatgg aaaccattaa acccatcaaa ataggatcta aaaaatcata ccctcatgag     74400
     aaactgacat ctgcagaagt gggaaaactt tgggccactt atatgggaaa tagtatgtct     74460
     acgcgtattc ttagttactt tcttcaacat gttgaagacc aagagatcaa aacattgctg     74520
     gaacatgcgt taaacttgag tgaggaattt caatgtacaa taaaagaaat attcgtcaaa     74580
     gaaaaaattc ccgttcccca tgcttttacg gaagaagacg tgaaccttgg agctcctaga     74640
     ttatttgaag atgagttcta tgtacattat ttaaagtatg ttggaaaggc aggaatgagc     74700
     atctataatg tggcggtgcc tttaatgtat agagaagatg tacgaaattt ttatcttcat     74760
     tgtatgaatt ctactatgga attaatggaa cagatcaaga cgattttaat gaataaagga     74820
     ttcattatta aaccaccgat cattcctata gcagaaaatg tgaagatagc tagtcctggt     74880
     tatctgaaag gcttcatggg agatgttcgt cctttacacg ctttagaaat tgcccattta     74940
     tacgacaata ttgaaagtaa cgtaacaagt aagacattaa ttatggcatt tggtcaagtc     75000
     gcaaaaatgg ataaggttcg agaagtattt aaaaaagggg aagaaattac tcttagatcc     75060
     gtggatcatt acatggagaa gctgcgggat gataacttac ctgctccctc attacttagt     75120
     catttagtca caacttccac cttttcgccc ttctctgata aattaatgtt atttcacaaa     75180
     gtagatatgt tttcaatgaa aatacgagca tttggaaatt cagtagctgt caatggaaga     75240
     catgatttag tcgcactata tggtaagtcc ctagcagaca tatttatgtt tgtggaggag     75300
     gcatccaagc ttatgatgga aaatggatgg atggaagtac cgccagaagc tgcggatcga     75360
     gaagatttag cttcaaatta gtatctttga taaagatgaa aaaataacaa aaggccctta     75420
     ataaaagggc tttttgttat ttaatttccg ataactcaca ttatggtaac taaagatgta     75480
     tggttcaggt gcaaaaactt gtatatgagt cctttaaaaa atatcgtcac tgaaagacgt     75540
     aaatcgtgat tatgaaatac ataataatta aggttagtat cgtacctcca ttaattaatg     75600
     taaatttgat taaaagtatg tttcttacct cttttctatg ggatgcatta tgataggcct     75660
     gggtactgtt agtgtaaagt tttgcaagca tatttaggtt tttcagaaag ataattagtg     75720
     caaaaatagt aataacaaat agtaatatcc ctaagagaat aatctttata atgtccaaaa     75780
     ttcagtatta tcccttccta atagatactt tcttctgtca tttaatagtt ggtttttaaa     75840
     attcagacta tttttttatt cttcttgttt ttcaaactgt tttcgatggc tgcgaataaa     75900
     agaggtaatt ttactgtagt aatgtttttt cacttcatga aatggtatcc ccgttacttt     75960
     tttccttgac ttttatctaa gttaatcaag agataaacaa gcagccaagc gcttttttaa     76020
     gaaagccttg gttttttcgt acgtatctaa acctcgtgtt ataacagtgg ataagatctc     76080
     ttcctaccct gcggcataga agctatgcat atgattaaaa agaagcagac tcaccaaagg     76140
     gtgacgtctg cccaaaacca aaaggaattc atccatcaac tgtttggatt agcttcataa     76200
     gctagtaact taaagagaac agattctcta ggtttctagc aaatgttttt tgcaccagaa     76260
     ccaaatgata aataaacttt acttttctac gtattttgac tgtttagtta gctttgtttc     76320
     acgggaatta gcatctgccc ttaatgcttt taccagtgac caacaaatga gaactaaaat     76380
     aattgcaaac ggaaatgctg ccacaagaga tgcagtctgt aaaattgtta aaccgcctgc     76440
     taaaagtaaa acagcagcag ttgctgattg gataatcccc catgtgattt taattttcgt     76500
     ggaagggttt aggtttcctc tctcactaag catacccagc acgtaggatg aggtatctgc     76560
     aacggttata taataaataa caacaactgc aaatcctatc atacttaatg tagaacttgc     76620
     cggtaggtaa tcaaagaaat taaagataga caatgataca tttgcagtaa tttgtttggc     76680
     taactctgga tgtcctaagt tttggattat gtgaagggca gttcctccaa atatggcaaa     76740
     ccaggcacat gtgccaagtg ttggcacaaa taaaacccct atgacaaatt cacgaatggt     76800
     acgtcctttg gaaatgcgag caataaacat cccaacaaat ggacaccaag caatccacca     76860
     tgcccaataa aatagcgtcc agtctccaag ccacgtatta tcaccgaaag gtgttaaatg     76920
     aagactcatc tgcacatagt ctgttaaata actccctaga gagttaaaca tggttccaaa     76980
     gattgttgaa gtagggccaa gcactaaaac taaaaacata atcaagaaag acaagagaat     77040
     ggcgatatta gagagatatt gaatgccttt ttcaagcccc gtacttatgg aagcaatgaa     77100
     taagatggtt cctaaaccaa tgacaatcat ttgtacaagg atagtgtctg gaataccaaa     77160
     taaagcatgc attccagctg aaatttgcat ggctccgagg ccaagagagg ttgcaatacc     77220
     aaatacggta gcaaacactg acaaaatatc aatggtttgc cctataggac caaaaatcct     77280
     atttttaaga aggggataaa aagcagaact aatggctgct ggtaagcctt tgttaaattg     77340
     aaaataggca agagctaagc ttatgactgt ataaatgccc cacggttgta gaccccaatg     77400
     aaaaaaagag tatttcattg ctgtgttagc tgaagcagct gtgtacccct ctccgtgtgg     77460
     tggattaacg taatgagtaa cgggctctgc aactccccag tatacaattc ccacgcccat     77520
     tccggcgcca aataacatcg ccagccagga tcctgtcttg aattctggtg tggccgtttc     77580
     ttttccgagt ctaatgtggc cgtattttga aaacaatagg taaacggaaa agaggactag     77640
     gaaaaaggcg actcctatat aaatccaacc aagatcatca ataataaagt tataggtaat     77700
     tgttgtaatg tttgtgaagt tttttgtgaa aaatcctccc caaatgataa agacgactat     77760
     taatagaata gagatgtaaa aaacactatg tttacttatg ttcttattca taatatgtag     77820
     aaattgctcc tttcttgttt ttggactgcc caaaaatggg aatagtgggt atgtatataa     77880
     gtacatagtt taacatacct ttattcatta tccaattttc catttccacc tccaaaacat     77940
     ttgatgttgc cctataatac tctggcgcaa agtatttatt aagatcatct tcttccaaaa     78000
     tggagattaa gaagttagtt caaaccgttt atgctgaatg gatatttgaa atatatgaat     78060
     gaagaggatt ggttctagtg tcaaaataat caattagaaa ggtagaaatt gatttaactg     78120
     ttatttttta gattaagaat aaattaccaa tagtttatat gtaaatctta tctcatttta     78180
     gacagactta atctgttgat aaagttgtcc ttttttcgtc atatacattg ccttaattcc     78240
     tgtaagaatt ttcttggtag tccgaaataa tctataaaac gtacttgttt ttagagaagt     78300
     tgtgccctta tataaggctt agaaatttat taccattaca cttgtcttta agttttgggg     78360
     ctagagccgt atctataaat tttgtttgta agtaagtact tttttattat atattattga     78420
     aaaggataca atttattcaa tagtgaggta aaattaacag aatatttgaa taacaaaaag     78480
     atttaactgt ggtaaagaat taactctttc tatcattgat ggtgaatata atatgatttt     78540
     ttggtaaaga agataccaaa cggtttggta ggctaaagtc tttgatttct ggaattacac     78600
     aatgaattca tgttgaccta ttataagatc ttattgtcca tcgtgaagta tattctgttg     78660
     ttctacctaa ggtgaattat tgtgtcaaca cttggcttta taacaattac taagctatca     78720
     aaatgtttga aaattactta tatgtaacac ctgaaggagg aaccaacccg tgaaacttta     78780
     tcaggtaaga aaaggacaat ttgtatatta taataatgag ttacacaggg tatattcagt     78840
     gaaaccttta tataaacagt ctgttcatct tattaggctg agagatttaa ctcagcattt     78900
     aaccaaagct gcaagagttg aaagatacaa accccaaaac ctcgatagtt ttgtgtttaa     78960
     tcgtcaagca tttacgcttt gtaatgatag aaaagctgaa gaaggagatt atattttaat     79020
     tacgaatcca caccccgact ctctagatta ctattcatta aatgaaattg agatagtttc     79080
     aactgttgaa aagaatggtg tcatcacaac taagtctaac gggattcgac atagtgaata     79140
     tttattgatg gttccagggc gtaaagagga cagccgccct attgattatc aagatggtgg     79200
     gaatatggtg gacgaggatt taaacacctt tgaatccaat caacttgaga ccaataatct     79260
     agatcttgaa atgcctaata taggcgatgt ttataaaaaa aataacagcg atattttaat     79320
     taaaacaatg gtggtttcca tacatggcga aacaattttt ttgggaggcg atttacaatt     79380
     atcgaaggaa gagttggccg atactacaaa atggcagttt ttatataacc tccaagataa     79440
     gtaacgccat acctaaaatc acttgattgg gctaaataca tcctgatatt atcctcttta     79500
     agcaaataga aaaaaagaag atcacaaatg tgatcttctt tttttagttt acaggttcct     79560
     gtaaatagtt ttatgttaac taaaaaaaga aaaataacat tagattattt gtgtcagaca     79620
     tcataacaaa gttatagctt gcttatatca gtttccggta atataaagtt agttgattga     79680
     agattcataa atcctttttt tgcataaaga cagcacctaa ataattaggt gctgtcttta     79740
     tgcagattgg acagacattt taattaaaag acaaggtata aaagtcgaaa agagtctgct     79800
     ctcattcttc atatttgagt tataacttta cttctaactc tctaagcagt tgctttactc     79860
     cctcacggct tagaattact tttccttttg ccaagattag attatcttcg gaaacttcac     79920
     ctgtcacttt acaggctaaa ttaggtgaat attttttcaa cacaatgttc tcattatcta     79980
     caaaaatttc aacagattcg tcattcttaa tatttaatgt tctccttagt tcaatgggta     80040
     agactactct tcccaagttg tcaattttcc taacgatgcc agtagctttc aatttaaaac     80100
     ctccataaaa tattacttac atacccatta agtgtacaat atgcttttta ttgttttcat     80160
     tagtaatata ttacatttga ggtggaagaa gatatctcag tatcataagg ttaggaagaa     80220
     agattgcatg gaagaattat aatggaaatt gttaaatcac tcagcatttt tagtttaacc     80280
     tgatgtagtg gttggaaata taacttattc aagttattta caacctatat aaaactaact     80340
     ttagtatatg agtaaatcat aaaacatttt ataaaaataa ttagtttcac catttatact     80400
     tattgaagac aaattagcgt tttttctaca aaatattaca cttctaaatc aaagaatatg     80460
     aattattaat taacagttcc ttcttttact gccactttcg tgtttctaaa aaggtatact     80520
     tttgcgaact ttcatttcat tttgatctaa tactttaact tataaaacct ctttctggtt     80580
     atttgatttt tttagccatt tataagaatt tttcatgttt gtcttaatat tgctataaaa     80640
     tcagaatatt caattattta aattcacttt gtaaacgatt acatatataa taatattagg     80700
     ttggatagca agcgtggcta tcattgtata tggcgtaggc ggggccgata caaaattaaa     80760
     atagcttatc atataaaata ttttgttaac ttgtatgtat aagagattgc tagttggaca     80820
     ataatgaaaa ataagaactt gcacaaagga ggtcaaacta ttgagcgtat ataaacaggt     80880
     tttctctacg tttgttaatg aagaacgatt tgatttacat tcatacctta cttatttatt     80940
     tatcaatgaa tgtcaggagg atgtagtaaa tcagttagaa caggaacatg taaaccaata     81000
     aattataaat aagaaaaaag gaacaggtaa ataataatga atgaaaaaat cgtgtaggtg     81060
     actttatctt tctgaacaga aggaataagt cgcctattag tatttttgtt taagcattta     81120
     gtacaccaaa ttcaacgtta aatctttaat ttattcattt gattaattct taaattaaat     81180
     actgatataa gtaaattaat atataatttc atgaaaaaca aaaaagaaaa gacgacttct     81240
     cttatagtaa gaaaaatcgc ctcttctaca tatacatagt ttatttaata atcatgacag     81300
     gacaatgtac tcttttagcc actttatggc tgacactacc taataccatc tcctgcagag     81360
     aatttaagcc acggcttccg attataacta gatcaaaatc atgcttgtta gcatacgaaa     81420
     caatggttgg tcccggatcg ccacgttcta ttttaagctc atagcttacg ttttcctttt     81480
     cgaacgtgct ctttatccct tctaaggcct gctgtctttt ttgcctgagt tctccatgta     81540
     atacctctgt tttaactttt gaaaggtcaa tgacagaaat aatttctact ttcgcccctg     81600
     gtactaacga agctacattt atagcatgtt ttgcagctct tttagagtgt tctgatccat     81660
     ctacagctaa taagattttt cggtacatac attgtccccc tatcaatgat tggatggttt     81720
     tgcgtttggt ttattataag tggccagctt ttgaactagc tcatcactta catcatttaa     81780
     ccctgttaac ttcacttcag cagatgtttg ttcttttaat ttcaatacga ctttatcaat     81840
     tgctgctaca gctgaatcat cccatatatg agcttctgaa aaatcgatta gaataagatc     81900
     ctgctgtcct ttaaatgcaa aggaatttac aaagtcttgt acagatgcaa agaataactg     81960
     accttttaca ttgtagactg ttcgatgttc ggactctttt gatgaaactt ctaattttga     82020
     aattttagct gcaaagaaaa tggcacttaa aataacacct gcgattaccc cttttgataa     82080
     atcatgtgtg gctacaacag taataactgt aacaagcata accactgtat ctgttaaagg     82140
     tacctttgtt aaggtacgaa gtgaagacca atcgaatgta ccgatggata ccataatcat     82200
     gacacctgct aaagcagcca ttggaatttt cacaacccag tctccaagca ccaagataag     82260
     aaacattaaa aatacaccag ctacaaacgt tgataaacgt cctcgtccac cagattttac     82320
     attaataacg gtttgcccaa tcattgcaca accggccatt ccgccaaaga aaccagcaac     82380
     aatattcgca attccttgtc ctctgctttc tttgttctta ttacttggtg tatctgtcat     82440
     atcatctaca atcgttgctg ttaatagaga ttctgttaat ccgacaattg atagccctaa     82500
     tgctgtagga aagataattg ataatgtttc catatttaat ggaacattag gaatcgagaa     82560
     catcggcaaa gattttgtaa tttcgcctaa gtctcctact gtacgtaaat taaaccctcc     82620
     tacaattgct gcaacagtca taacaataat agctactaat gcggaaggaa cagctttggt     82680
     aatacgcggt agaccataaa taatgactag tgttaaggct acaaacacgt atgtcatcgt     82740
     ggaaattcct acgaagtgcg gaacttgcgc cataaaaatt aaaatagcta atgcattcac     82800
     gaaccctacc atcacggagc gtggaataaa tttcataaaa cgggcaatct taaagatacc     82860
     aaagattagt tgaataacac ctgttaaaat ggtggtcgca aataaatact gaatcccatg     82920
     atctttaacc aacgtaacca ttaataatgc catggctcct gttgcagctg aaatcatggc     82980
     aggacgtcca ccaacaaatg ccatcactac tgcgatacaa aatgaagcat acaatcccac     83040
     catgggatct acacctgcaa taatggaaaa ggcaatggct tctggaatca gagcaagagc     83100
     tactacaata cctgaaagga tatctccttt cacgttaccg aaccattcca tttttaattt     83160
     atttaacatg ataaccaaaa acacccttct atttatacta atgaactttt catacacgtt     83220
     tatttaaatc tctccttaca attgcacgtg taaagcaatt aagacatgaa gtttaaagaa     83280
     ccaaaatagt ccgtttatgg tacctttaat ccataaaaaa atcagtaata actgttgcgt     83340
     cggttatttt tagtattctc tttcatccta aaaactttct tttaaactaa accattattg     83400
     ataaaataaa gaattcattt catttatctt ttgttcattc aattggaatg cttctctgat     83460
     tttattctcc aaattctccg tgacccttct cttaccaact tccactaatg caattaatga     83520
     aaaactacag ttaaccattt tagcaaagtt tcgttggttt aaattatagc tttttctaat     83580
     taatttaatg gtctctttgt ccatgtcatc acctctttac tttttatcaa tggcttccaa     83640
     ctctcataga agccgagacg ttgttaacaa ataaaactct agcagacata aaataaaatg     83700
     tctatcattt tttgtaccta aaacgaactt ttttggaact atcaatgtat ccatatctaa     83760
     aagaaatgtt atgatgagga ggaatttgtt acaatagtaa aatgtaaata aacaatccat     83820
     gcaggagatg gtttagtgat tattggttat acccgtccat atagcgaaga tgaaaatttg     83880
     gacaaacaat tacaggcttt gcaagcctat aattgcgaaa aaatttatca agaaaaaaca     83940
     aattctttaa aaaagagagt ggaatttgat gagatgttaa cttctctcca agagggagat     84000
     atagtagttg tctataaatt ttattgtatt gcggactcta ctcgacacct tattgaatta     84060
     attgaatatc tttcggaaaa tcatattcat tttgtatcta ttttggatga tgttgatacg     84120
     tcaacattag aaggtaaaac atttttcaat accattaaac gtattggtca atttcaacat     84180
     gatgtcatca gtgaacgtac gaaagctggt cttgaagaag cgaaattgaa aggaaaaagt     84240
     ggcggtcgcc ctaaaaaacc tgactataat gttcatcgcg cacttgatat gtattggagt     84300
     aagaaatata caattgctca aataacagag gctacaggta taagtaagac tactctatat     84360
     cgttacttag ataactgaaa cataaaacct catgtgaatt catggggttt tgttgtacat     84420
     agagatagca gatataaaga ctattcctat tagggactag catatgtata aaaggtgcac     84480
     tttttataca tcctcctcct acttgggtat cgagtaaatg gagtcatatc aaggacatat     84540
     aaaaagatgc ataagggaaa atatcatcct atctaaaacc ccatgtgcgc taaggggttc     84600
     tttttgatat gtgtaccgga aaaagagaca ttatgttaat taaagatgta tggaatatac     84660
     actgtaagaa aaggctaata cgtcatatgt ataagtattt tgaataatga gatatttcaa     84720
     gatggtttaa caaacaaaat aatgtttaaa atcacctata acaaacttta ccccaatatc     84780
     aatccctagg gattgatatt gtttttccgt ttcttttaaa cctattttaa ggcttttaaa     84840
     agctatattg acggggtatt ttttgtgtat taatattgat tccagcgctt agttttgccg     84900
     gtaaaacact aggaggaatt aacgttatat ggaatttgtt ttatcgttag ctttaatatt     84960
     atttgccaca aaaattgcag gtcacttatc cgttcggtta ggtcaaccgt ctgttttggg     85020
     taaactactt atcggcatca tattaggccc tgcagtattg gggtggattc ataatgacca     85080
     gtttgttcat tatttttctg aaatcggtgt tttactactg atgtttttag caggtctaga     85140
     aacagattta gaacaattaa aaagaaactg gaaagctgca tttgctgtgg ctgttcttgg     85200
     gatcatcctc ccatttattg gtggatttgg tgtaggagaa ttatttggct taggtgcgac     85260
     gtattctcta tttattggcg ttttattatg cgctacatct gtaagtatta ccgttcaagt     85320
     attaaaagat atgaatagat tgaattcaag ggaaggaagt acaatcctgg gagctgcagt     85380
     cgtagacgat gtgttagttg ttgtcttatt agcaatcatg attagtttcc ttggaacagg     85440
     tgaagaagtg tccttagggc tgcttgtagg taagaaatta attttcttta ttggagctgt     85500
     tttagcagga tggctcgtcg tcccgaaagt tttagattgg ctcacaaatt taaaagttac     85560
     agaacctgta gtgtctatag ggttagctat ttgttttggg tatgtctatt ttgctgattt     85620
     gatgggaatg gcaggtatta taggtgcctt tgcagccgga attgcgattt cacaaacttc     85680
     ttataggcat acaattgaaa gcaaagttga acctattgca tatgctgtgt ttgtaccggt     85740
     tttctttgta agtataggat taaatgtgtc ttttgaaggt gtcggtgatc aaataggatt     85800
     tatcctcctc ctttcagtca ttgcggttat cacaaagcta gttggaggag cattaggagc     85860
     taaagtaact ggattctcaa caagatcttc tttactaatt ggatctggaa tggtttcgag     85920
     aggagaagta gccttaatca ttgcggctac gggacttcaa gaatcgctct tattacctga     85980
     atatttcact tcggccgtaa tagttattat tattacaaca ttagtagctc cacctcttat     86040
     caaatacatc attcaatctg aatcaaagat aacccaaatg gaaaaataga agtatttacc     86100
     taagaaaaag gagctgattg ttctgtcagc acgtatcttt ttattttcat atgaatggga     86160
     tgcagaatca gagacacatg agtgtattaa tgagcgacta gaaaaaatct acgacgtgaa     86220
     acgtattaat aaatctgctt atttaattaa aacggatgac gatatcacaa ttattgataa     86280
     atatctttct acatgttttg aaaaggaaga aaggtacttc ttagtaaata ttacggacca     86340
     acctaaccgt catagtggaa tgagcacttt atctatagat agttggatgg ataatattta     86400
     aatacggaaa agaatctttg atcctccgga ctaataagta aatgtacatt tacacaatca     86460
     aaccttgata gtttattcaa attatgtaga atgaacatag gataaaaaaa tataaatggc     86520
     gatggagttc gccaaaattg tcgttgtgct aatgactcct acccttttac tgggtaggag     86580
     tctatttttt tgtccatatt gaggaagagg tgaagaaaat gaattattta ttggttggag     86640
     tggggggcgt tataggtagt ttgctaaggt attatctagg ggtatttact cattcttggt     86700
     gggcttatga ttttccatta ggtacattaa ttattaatct cattggatct tttgttttag     86760
     gatggctcac aacccacatt ataaaaatga aattattaca tccttctatt ttagctggaa     86820
     ttggtaccgg aataataggt tcttttacaa cgttctctac ttttagtgta gaaactgtta     86880
     cgttaattca acatggatta tggctgttcg ctttgcttta tgtcgttctt agtttatttg     86940
     gaggtttgct gatgtcatgg ttaggttata aagtaggaaa tcatgcagct cgaaatcttc     87000
     aaagaaaaga ggaacataca tcatgagcgt tttattggtt ggtataggtg gatttttagg     87060
     ggcaattgca cgttatgtat taggtacttg gatgaataaa aaatcttcta aaggccttcc     87120
     tataggtaca ttatttataa atttattagg ttcgttccta ttaggatgga tggtaggcca     87180
     aggtgttaca tctggtttat attcttttct aggaattggt tttataggtt catttacaac     87240
     attctccaca tttaaattag aaagtgttca acttcaccaa aataagaagc attctatgtt     87300
     ttactcttac ttagcttaca gttatatagg aggtatcctt ctagcctttg ttggtatctc     87360
     cttgagtgta ctttaaaatc atgtagtact gctgatccat tatacgtcaa aaaagcagca     87420
     tcccttgaac ggaatgctac tttcataaag actattttta tgaggacgag catatgtata     87480
     aaagacagct tttttatgca ttctttcttt acctattcct ctgagaaagt ctttcatatc     87540
     aaggatgtat aaaaagctgt ataattcata ataggaccct tttgaaacct cttgtctctc     87600
     aagaggttct tttcggtttg tattctggaa agaggtatta tgttaactag cattcctgtt     87660
     tgaaattact taagatctag ttcaacgaag caggtttgtt gtacaagaat tgacgtaaga     87720
     aggttttcaa tgaaggcgat cttttttatt ttgtcaattt ttttagaata agggattttt     87780
     aattggaata ttagtatttt agagaggaga gcagtttgat aaggtatggg tggtgagagt     87840
     tatgtgtaag atcattgtcc ttttgatgaa ctaaaacagt ttaatttata aaccttaagg     87900
     ggtgtttatt tatggttata aatagaaata aagacgatag tttaattgga atccttctat     87960
     tcattgtaac gatagggatt ttcgacctta ctgacttagc tgctgagatg accttatgac     88020
     aataaaaaag acaatttctc aattaataga gaagcgtaga acttggggtt atggtgctgc     88080
     tatagcagta acgccttatc tgttaatcaa aattgcctgg actttcggac tcttcatgcc     88140
     gactgaacaa atgggtgata taagttggcg cactgcaaat gccataacaa tggttctcgc     88200
     cgcagttggt atcctgttag cgtttgcgtt cagcatgcct tggggtgaga agctgcctgc     88260
     ctggttggtc gtctttcccg tttgggtagg tactggttta cttattccta tgttgttgtt     88320
     ggcaccggtg cttggtcctg ctgctatgat acgggatcag aagatgggag ccgccaacgt     88380
     ttgggtatat gagcagattt ttgtaataat ttcactggtt ggggtcggca tctgcctgcc     88440
     ttttgcttta gctggatatg ccaagacgcg ttggccagag gcatttgttg gtccaatcga     88500
     tatcgattta cttccaggca acagtcagaa actgtatatc gccttggcta gacttgttgc     88560
     atctggctgt atcctgcttg ggtttattaa gttattctgg gcagctggtg gaactattgg     88620
     cattaaccca tctatgttag ataaccgaga tttatggtgg cacctattgt cactgagtac     88680
     cggggtctgg gcctttgcag ggtcttgggg tttattggta ctaaccaccc gccgcgggtc     88740
     aaaaagtttt tttccaccta tggccacagc atggatcgcg tcgggaatgc tgttctcata     88800
     taacctcttt aatcgtttgt ccgccactcg ccctgataca caacctgcac cagagtaccc     88860
     acttgcacat gtactgacca cagagttagg tagcgtctta ggagttatga tgataatgat     88920
     catcctgatg gtattgcatg atcgccggag agcaatgcgc agcgcggcat aaaatcaaga     88980
     aattaagatt tgggtgggga gaaataataa aaagtgattc cgaaaatatg ttttatgtta     89040
     actggaaagg aatagttaaa catatacttt aacaccggtg tatatagggg tgttaactat     89100
     aggcgtacct ttttataagg gccaaatata tgttgaaggt tataaaaagt ggcagcttag     89160
     tatgagaagt tgccactttt tattttacat gatcagtaac cttatttgtg atacaagaat     89220
     ctaaaaaaga atccttaatt tctgctttca tattccatga ttttaatact tctgtttcaa     89280
     atctttgtat atctttaaag cttgttcata tgtatcgttg ttcgaagcaa tttgataatt     89340
     ttttgtacta tcatctgtat gaaaaattcc cttatcatct atcattaaag ttcccgaaat     89400
     tttatcctga tagacaaata ttattgatat tgccttatca taattcagtt gttggttggt     89460
     ttgtcctatg tattgaagtt gattataaga attaacaagt gattgaacgc tttcttgctc     89520
     aactttatta tatccctcat ataaactttg ccctaaaccg atatcaacgt aatctgcttt     89580
     gattcccttt acagagttat tactgcatcc atttataata aggactatta ttacaatgct     89640
     aagaataaat aatgatcttt tcacaatttt aatcccttca aattattaat gttattactt     89700
     tttaagcttt aataaacacg tcactatctt ttttacttag acctatatat ttaaaatacc     89760
     tcctagaatt ttttttgtat tattaatggt aacatttatt ttttaattta aattactaaa     89820
     gtgtaaaact aattcaaact tcccagagcg cacattatgg taaataagaa tgtatatatt     89880
     attcgcttaa aaacaaagat ttcattttaa ttttttctat tttatgaaat aattgtatgg     89940
     ttcgtttgaa atatgacaat cagatttata aggagaagaa aaaatgaaat cagtaaaaaa     90000
     tattgtattt tttgtgctgt tgttatttat tatttcagct tgttctaatt caaaagatat     90060
     aaagctttca aaagcagacg ctataataac taataacaaa gaccttgtag gagaaactgt     90120
     tagaaccata ggagaaggta agagtcaaac aactgtggac acggcgttat actatacgtt     90180
     tgtagtaaag aacaattcta ataaatctat atctaatgaa gacttgaacc agataaaact     90240
     aaaaataaaa cctaatcaag aattactatc agttgtagaa gatacagtag gatctaatat     90300
     ttataatgtt aacaagagca aaataggagg gggccaagga atagaggaga ttccagctca     90360
     tggtactgga aagtttacta tttattataa cttaagtaca gataaacagg ggaataaact     90420
     accttctata cctactaaag aggagttaaa aagaataaag gaaaatgctt taaaatctac     90480
     acttattgtc tcagaaaatg gagaagagat tgctcacttc aatttaaata aaaattagta     90540
     tgtaatttag agatacatag agtaattaaa gagaagacca tttaaatggt cttctcttta     90600
     attactacag ataagcttta ttatcctaat caaggatgca tagagtatat tacttgaacc     90660
     taactaactt tagatttttc attcatagat tccatcctct agaaaagatt aaaaatgtta     90720
     ttgttttatt agagcagata tacttattac aactttgttt atttccgaca atcttaatta     90780
     tggtgattat aaaaaataat accttgtatt aaaaggtatt attttttata atcaactaag     90840
     aggtggaata tttggaaatt agtagagaga tcttaaaggg tcatattgat acgttgattt     90900
     tgtcgttact ttatcaaagg gatatgtacg gttatgaatt ggctaagatt gttcgagaaa     90960
     aaagtgatga acaatttgaa ctgaaagaag gaactcttta tttgtcttta aagagattag     91020
     aaaagaataa ttggatttct tcttactggg gtagtgagca aggtcctggc ggaagaagaa     91080
     agtattataa gcttacctcc ttaggtaagc aaggttttga agataagcgt ttagaatggc     91140
     aatttataaa gaaaatgatg gattcatttt tatggggagg aactaagtga agagaataga     91200
     agcatttgtg gattctatgt atctaaatgt agacggagat aaacaagaaa tcgacgaatt     91260
     aaaagcagaa atgaaaaatc atttgtttga atcagttcag gagttaaaag aagaaggaaa     91320
     aacagaacaa caagctatta caattgcgat tcaacggttt ggtgaagaaa aagaaatgcg     91380
     cgctgttatt ggacaattgt ttgagataca aaaaatattt gcaaagcgtg tgctttacat     91440
     agcaatagtc tgtttaatat taacaatatc aatgggtagt tttctttgga aaattgacga     91500
     ttcaactgct caaggattat ctgaaacaag tacattaata tctaaggaat tagaaaataa     91560
     agacgttatg accttcagta tgaaaaggaa aattgaaact ttagtagagg atacgaatta     91620
     tatatctgaa gtcactatct ataattcaaa agatataaga agtgttagcc aaaattctgg     91680
     tgagtatcat tggaaatcac agaatccaga ttttcaatat caaagaacga tttgggctcc     91740
     aaaatggcta ggggtggatt cttccacgtc tggaaatgga aatgaacaat ggtttgtact     91800
     aatagagagt agaagttttg atcaattaca ggtaattgta atatttatgg gtggagctat     91860
     ttactggaca ctgttcacta tttgggcaat tattaatgct caccatcaaa aacggttacg     91920
     aattagatgg atttttatat ttgtagggct taatgtttta ggttatttac tttattattt     91980
     tacaggaata cggagcgttt cttctaaaga gcatgagaat ttatattaag attctgtatc     92040
     ctctacctca aagctaatat atacacttat aaactaatat ggtaaaatta ctcatatttt     92100
     gtcgttagga acttaaattt tgttggaggt tacaaatgag ttacggcgtt tcagtatttt     92160
     ttatattagt gcttatgtgt attattgcaa gtcagtctta cttaccaaaa tggttaaagt     92220
     ggttagttgg tgtctactat tctttaggaa tattactttt tagttatctt caaactcgtt     92280
     tagccgataa atggtatgta catactcctg ttccagacga gtattgggat gcaaattcaa     92340
     gattaacaga tctatttgct gctgtgttct ttatacccgt ctgcatactt ttttcatact     92400
     atattataac tggttcaaaa aactaaaaaa gcccctacat cgtgtgtatt tgggaattag     92460
     tgtggttcct gttttactta taggttttgt atgtttcttt atgtttgaat tcttgtatgg     92520
     gtataggcct taaaatcata ttacatttta caactccaga actaagcata caaaaaataa     92580
     acctttgccc atataggcaa aggattttca aatttaaggg aatatgggga atacattatt     92640
     agtgtggcca gatttgtaga ttcatataca tataatttta aaaataaatt ttgtaatcga     92700
     ctctacttag aaaaaaacaa cctttttctg taagtgttct tttggtagct tggttcctct     92760
     aagagtgatt atgttaacta aagatgtata cgatatacac ttaattttat ctttgaatta     92820
     tatattgagc atttgaatta ttaattaaac tactaatacc gttagggtaa taaggcatta     92880
     gattatctgc tgtttttaaa tcaatccatt ctacttttaa aatattttct tctttgggaa     92940
     tttgacttgg ttcctgtata agacgggctt taaagacaac aaaaaagata tgattattat     93000
     caatgaatgc ttcattcaaa cttacaatac catctacctc gatatcatat cctgtctctt     93060
     cttttgcttc tcgaattgct gcttgtttta aagtttcccc tttttctact cctccaccag     93120
     gtaaagacca tgaattattt ctatttagta ccattaaaat tttactttca cttttatcaa     93180
     gtaataagct ataagctacg tctactctat taaaatccac tgctttaacc tcctttttat     93240
     tccaatttat attatatatc aaagctttta ttatttgttt tccaataacg ttgattatgg     93300
     taactagggt tggatgtaat attcatttct cctttataaa ttaaactctt ttgatatatt     93360
     taagattggt attatatcca agaaagaaat aaggagacat acatatggat aaacaaataa     93420
     tcattgagaa ttatacgtct gattgggctt tatcttttca cgaagaaaaa aagcttttaa     93480
     aagatattat aagcgatata gctatatcaa ttgaacatat tggaagtaca tctgttaagg     93540
     ggttaggagc taaacccata atagatatta tgattggagt ttataaatta gaaaaagtgg     93600
     gcggatttat tgaaccacta agtaatattg gatatgaaca tgtatttcat aaggaatttc     93660
     caaatagaag gttctttaga aaaggattat ggagagcagg tacacatcat ttacacatat     93720
     ataaatacga aagtgaagaa tggaatcgta atattttatt tcgagattat ctaagaaaac     93780
     atccagatgt acgtaatcaa tataaacaat taaaaattga attggctcaa aaatatagtt     93840
     gtgatcgagt tggatataca gaagcaaaag cgccgtttat aacagatgtt atacagaaag     93900
     ctaaaggcga aacaaagggc cgataatacg ttttatatta actcacggta tttatcgtat     93960
     acagttatat gaaggagaag aaagggttta aggtgtagaa cgtgaatagg tttgaaattt     94020
     tagataaggg gatgggatta atgaaaacat ttatactggt aagacattgt aaagcagaag     94080
     gacaagaaga aggggcaata ttaactgaag aaggaaagaa agaagcgatt aatcttatta     94140
     cttacttaaa taaagtgaac tgtaaaatca ctaaaattat ttctagtccg tatgaaagag     94200
     ctgtaaaaac aatcgaacct tatgcaaaag aagtagggtt aagtatacaa attgacaata     94260
     gattatcaga aagaaggcta agcaataaat cacttactaa ctggttagaa ctattaaaac     94320
     aaactttcga tgatatagat cttgttattg aagggggaga atccacaagg gaagctacag     94380
     agcgtgcaat caaccttatc agagaagaaa tagaatatag caaggaacag aatacgttgt     94440
     tagttacaca tggaaacctt atgagtttaa ttctgagata ttttgacgaa agttttggtt     94500
     ttaatgaatg ggcaaaccta acgaatccag atgtttatag aatagacatt gaagataacc     94560
     aaattagtat caaaagactg tgggacccaa tggcatacca tagtatctag acgttgaatt     94620
     tcctataagc tacattatgt aaactgaaaa tgaatactgt attcatttat tagtaggatc     94680
     gaaataaatc cctttcagga tatgggtatt tttagtaaaa ttaacacttg ttcatttaat     94740
     tttaaaaaat ggaaaggagt cgttttataa attgctaaaa aatagaaaaa taattgtaac     94800
     aggggcaggt tcggggatag gaaaagacat tgttagattg tgtttagacg aaggtgctac     94860
     tgtaattgca tgtgatatta ataaacattc tttggatgaa ttaaattcaa acttagacaa     94920
     ctcaaatagt ctctatacat atcagttaga tgtaagtaag tatgaaaatg ttgtggaatt     94980
     ttttaactat attgactcaa ggcacagtga tgtaaatggc ttagttaaca atgctggaat     95040
     ttatttggct aaaaatatat tagattatct tgagcacgac attgataagg tactcgatat     95100
     caacattaaa ggttttatct acttttctca aatgttcgga aaaagagtaa ttggtaaaga     95160
     ggctaacgga gttattgtaa atatgtcatc agtgtcaggg atggaaggaa gctcagacgc     95220
     tatctacgga ttatctaagg ccgcaatttt aggtttgact aagagttgtg caatgaactt     95280
     ttctccatat attagagtaa acgctgttgc ccctactatg gtaaatacaa aaatgatgaa     95340
     tacaatacca gactggagaa aagaagaata tttagatcac cagttaatta aatcccctgt     95400
     aacccctcag gatgtggctg atacagttgt atttttgttg tcagataaag ctaagcatta     95460
     tacaggatct acatttgata ttaataatgg agggtactta agatagacct atcatctatt     95520
     tcatcctaaa gagcttactt tttttagtga gctcttttat ttccgataac gatgattatg     95580
     ttaagtggaa atttgtagaa tggtcaaacc ttcttatggt aaatttaaat tctttagaaa     95640
     ggcgggagta ttagtaaaat gcacagatgg aaatttgata atggttcgaa aaagaaaact     95700
     cgagggataa aaagaaaatc ccgtacgttt gctaagtcta ttacagaata tactacttct     95760
     ttaccaagtc ctgaagataa tagctattta ggctattggc atctccatat gccttttaat     95820
     gagtcattta ttgattctaa aaatacatca aattcagtaa gaaaactatg tatgcagaca     95880
     atgattaatc gaatgcaaca tttaattgat ataagaactg aattagagaa ggattatcgt     95940
     atttatattc taatttcatt accaaagtta tttgattccc aaattgtagt tttatttgat     96000
     aaggaagact taaaaggatt ctttgatagg gatacagacg aacaacgttg gattccttta     96060
     tcacctgaaa gaagcataga aaaagaatgg ggattagaaa ttcctaaaga gctagtcatt     96120
     aaaggatata aagagattat taatgatgaa gactactttc atgaaggtga attatggttc     96180
     attggagagc ttggttaatt ttcaaaagga tcttttatta aaaatccttt tttactgccg     96240
     ataaaatgtt ttatgttaac taaagaagca tataatgcat cacttaaaaa ataaaaaaac     96300
     tctgctcata acgtggcccc cagttcaatg actgggggcc acgttactta aacagtagaa     96360
     aactacataa aagcctttat cactttattg atacgttttt ttaaggattt tactttttat     96420
     gatttcacta atcaatataa taattatgga taaaatggag cctataagaa tagcaaaatt     96480
     gattactccg attccaaaac cagttaatcc tccataaaag ctacttatta ttacaatgcc     96540
     tagactaatt actcctataa ttagaggtat tatatatttt aaagaagata cctttttact     96600
     cattctactg gaaagtagaa gtaagcatgt aaccgtgaat atgacaatca tatacattat     96660
     agccattttt taatcctcct tagtatgtat tgtaaatatt accataatat tctaaactat     96720
     gttcaggata tgctgagtat aattttttat tgcaattggg tataaatagc acacactcaa     96780
     tttccttttt atggtactat atataaatac ttactttata ctgttagaaa aaggagataa     96840
     acaatgttgc aatcactaat tttcgatatg gatggaacgc tgtttcaaac agataagatt     96900
     ttagaaatgt cacttgatga tacctttaac catttacgta cgctcaacca atgggatacg     96960
     agtactccta ttgataagta ccgtgaaatt atgggtgtac ctttaccaaa agtttgggaa     97020
     gctttgttac ctactcattc agatgaaata agaaagtata cagatgacta ttttttgaaa     97080
     aggttagttg agaatatacg aaatggtaag ggtgctttat accctaatgt aaaggagatc     97140
     tttagctttt taaaagagaa taattgttcc atttacatag caagtaacgg tttaaaagat     97200
     tatttagaag caattgtaga ctattacgag ttaaataatt gggtcacaga gacatttagt     97260
     attcagcaaa tccaaacttt ggataagggc aatttagtca aaacgattat aaagaaatac     97320
     ggtatcaaaa gcgcagcagt agtgggagat cgtttatctg atattaatgc tgcaaaggat     97380
     aataatttac tagcagtggg gtgcaatttc gattttgctc aagcagatga acttgcgcag     97440
     gctgatgtgg taatagatga tttaattgag ctaaaaacaa tcgtacttaa aataaacaat     97500
     agctcactaa tctaatagat cttcataaaa tgaaagggat ttttaatgag tactttttct     97560
     aaaataatac cgtcaattct tatacttctc tacatagtaa ttttcttttt agatatttct     97620
     tatcattatg gtgttcctta tttatatagc ttctttcttt ttctcttttt atcgttaata     97680
     tcattacttt tatgtttgtt gatatggttt aagaataaaa gaagtctgtt tttaattttt     97740
     gctggagttt cacttcttca acttatattc actgtatttg tttatctttt gccagaagca     97800
     ggaactaaac cattaatcta tgaaaaagta ataaaaaaag aggatttttc caataaataa     97860
     ttttgaacta aaagcctcta aagatctgat gattacttta aaggcttttc tgctaccaag     97920
     aatacgtttt ttatgttaac tagaaaggaa tagctaaaca tatactctag caccggcgta     97980
     tataggggtg ttaagtatgg gtttatcttt ttataaaggc caaatatgtg ttgaaggtat     98040
     aatctgcgga tcgtttatag aaatcagagt tacattcata gctttgtttg ttatatatgt     98100
     agcttacgaa gtaatttaca aaaaataagt aatgcattca aaatagtgca ttgcttattt     98160
     ttgtgcctat aaagcacaat atgttaatgg aaaaactaga acgaatatat tttaaaatat     98220
     aaatttaaat atttactaat ttatgtaata attgtatatg tttatttcat aaattaggag     98280
     aatttttaca tggacactaa atttattcga ggtacgttct ttttaactgc ttccactctc     98340
     atttctaaga tattaggttt tatctacatt attcccttta cggcgttagt aggtaactcg     98400
     ggctatgcat tatataagta tgcctatggc ccctacacat taatgttgag catttctaca     98460
     atgggtctcc cacttgctgt ttccaaattt gtatcaaagt acaatggaat aggaaattat     98520
     cgtgcaggac aagatttatt aaagtttgga ctttatctca tgatttttac aggggtgtta     98580
     tccagcatta ttctatattc acttgcaccc tttttggcag aaatggttat aagtaaacag     98640
     gattcaacag gaaataaact agaagacgtt atatacgtaa tcaggttagt aagttttgct     98700
     ctcctaattg tccctccaat gagtctcttg agaggatact ttcaaggaaa tcaatctatg     98760
     ggaccatctg ctctaagcac gattttagaa caagttgtaa gagtaatctt tattgtccta     98820
     ggagcttata ttgttattaa atttagtcat agtgtaacta aagctgtagg cattggtacg     98880
     tttggagcat ttgttggtgc tatagctggt ctaagttttc taacattcat ctattataag     98940
     cgccgcaact taattaaaaa gcaaatgaca gacagcaatt tcaatcaaag aatcaagcct     99000
     ctaccaatgt ttaaagagtt aattagctat gctatcccct ttgttcttgt tggattggca     99060
     atacctattt atcaaaacat tgatacattt acgattaacg tattattcca atctataggg     99120
     tacaaacaag atcaagctga gagtattaat tcagtaattg gtcttgctca gatattagtt     99180
     atggtccctg tatctctagc cactgcattt gggatgtctt tgcttccagg cattacttct     99240
     tcttacgtaa aaggcaattt aaaagaagtt aaagaaaaga tgaataaaac atttcaaatc     99300
     ttaatgttct ttacgttacc tgcagccatt ggtctatgtt tactaggaag gcctatttat     99360
     atcatgatct ttggtatgaa taatagtcca gttttaggtg gcgttatcct tcagtggtac     99420
     gctccaatgg ccatcttatt tgctttattt acagtaactg cttctattct tcaaggtatt     99480
     aaccaacaga agaaagtgat tatcggcatg tttttaggaa ttgtgattaa acttatttta     99540
     aactttattt tgcttactaa ctttaaagaa attggtcccg ttcttgctac gtacggagga     99600
     tacatggttt cggtgttata taatttctac ctcataaaaa aagcaattaa ttacaagttg     99660
     ttcccgttag tacgagcact tgctttacct gtctcgttgg taatcgtgat gtcaatagtc     99720
     gtattaatag caaattatct tgtaacgact tatttagcaa caaaacttag tatgtatcat     99780
     ctagctatta ctacgtctct attctgtgtc tttgtggggg ggattgtata tataggaatg     99840
     agtttgaaaa caaaaatgtt aagagaggtc ttggtaagaa ggaaaaatgc ataaacaagc     99900
     gtctctgaaa ggaaagaata atgaataaaa taaaaaaggt tttggtattg tttttagcta     99960
     ttcttatatc aaccattata gtgctctctg ttatttttat taactgggag catatctttg    100020
     gtgacactag acctatagca aatgctaaag cgatgtacca attagaattt aaagataagg    100080
     atatagctga aacaacagat gttgataata atattatgta tgtagtacct aaaggacatt    100140
     tagatacgta catcgaaatg atgaaaaaga aagggtacac cttaacagaa aaagacgata    100200
     aacatcacac ccttttatta aagaaaagaa ataattttac agaaatctct tataagagcc    100260
     ttacttcaag atataccata ataagtagtc cattcctaaa ggaagtttaa atttttatta    100320
     ctagaagtta tgaaaagtta ccacttttta ttttcagtaa ttaacattac ataatctcac    100380
     cataaactta catataacaa aaaaagaaac ctttgcccat attaggcaga ggtttttcaa    100440
     atttattgga atagggggaa tacgttatta gtctgtccag atttgtagat tcatatacac    100500
     ataactttaa aaataaatag tgtggtcgat tattttttag taaataacct tgtttaagtt    100560
     atttcatcac ctaagtaaat actaaaatat tttatatatt attaaggttt tattatttat    100620
     acttagtgac gacaaatatg ggctttttct atttatatgc cataaaagat aaagttttat    100680
     tgtatataat ataaaaaaat aaagatataa cactaattta tataaatata atttaatgtt    100740
     attaataaga gtaatgttta acgtatttta ttaaagaata gtttgattgt tacgtatatt    100800
     gtagaaaaat aactaatttg tcgtcactta aagtaaatag taaaactttt atttttataa    100860
     cagagtttat tcatttactt ctttatataa aatacgttaa ttttgtattt ttaatcatat    100920
     ttatcttgtt aaaaacgtat taatattaac tatgtgtgag ttttattttg tgttattata    100980
     aatgtgacaa tttcctaaaa agggagtaga agatagattg gtatatgata agaggtgaaa    101040
     atctctattt gttgccactt tatttgaata atgcaactaa tcaatttaat gagatacttt    101100
     attatttact taacataatg tgatttatat gcagtgacgt ttatgagagg ttatatctac    101160
     tatctcatta attcatctta ttttttatta cgcatatctt tttttatttg tttcataata    101220
     aagaggaatg aatgaagaaa ggaagcgaaa tcaatatgca aaacttgacg gagctagaag    101280
     tagagaattt gcgtcatctt atcggagcac atgggacact gattaataaa ttagaacaat    101340
     acgcacaaga atgcaatgat ccacagctta cagcaatgct acaaaaagat gcacgtgacg    101400
     ctagaaatac aaaacaacag ctcatttcat ttttaggata ggagacagat aaagatgaat    101460
     gaaaaggata tcgtaaatga ttatttagca ggtcttaatg caagtttaac aggttatgcc    101520
     aatattatta gccaaacaaa taaccaacaa ttatatgaga cacttattca aatacgtaat    101580
     caggacgaga cacgccaacg tagtgtgtat gagtatgcaa aacaaaaaaa ttattaccaa    101640
     ccagctgctc cagcaaattc tactattgta caacaactta aaaatcaatt acaacaagga    101700
     tagaagaaac tacctaagca ttaggtagtt tcttcacttt taatctgtat atgtcatttc    101760
     tagttaccat aattcagaat aggaacacat aaaaaaagag aagagtactt aaagtatctc    101820
     ttctcttttt atttattatc tataaaggtt aagatttgtt gcctttttaa ttgagccaat    101880
     ccttgaaaag tttcatttat tacatgattt gttaactgat tatttatata aatgatattc    101940
     taaactttgt taagaatatc atttagtata tcctcaatag aggaaaaact actctttcgt    102000
     atccctttca tataaatata aaacataatc agtcataaca ccaggatggc ccaattgccg    102060
     caacatagct gtgatattgc cacgatgata tgttccatga ttgacaacat gttgtactaa    102120
     gtcagataaa cgagtttcga gtcgtccagc aaatcgggtt tcaagtacaa tggccatttc    102180
     catatcctct tgatgatcga gaaaggcttt gtaccggtca gataaatcga aaaacatcgt    102240
     ttctacttcc tcgattcttt tcgtttccat ctgttctctc aattgatcag ccgacgcata    102300
     tacttcatca aatttttcac cagaaataaa atctaaccat atgttatcag agacataaat    102360
     gtgcgccatc acctttgata tagaaggaaa aacgctctga atttcctttt cgtaaatgtc    102420
     ctcagaaagt tcttttaatc ggtcgaaaat tttatggttt gcccatacat ggtagtcgta    102480
     caattccaat gagtgatgtg tcatttgaaa ttccccctat ttcactattc actatcgaca    102540
     taatacaagg tatcagtagt caacttaact ataattctat aaaaataccc tccagacctt    102600
     ttgcctaaag gagtttcttg tttacgtaat acctctttta ggaacacatc ccaaaaaaga    102660
     atccttatgg gagtaagggt tctgccaggg tcacttttat agaatatgta gctttttata    102720
     catccttgat ataaggggat ttccttggat aagtgggtag aatttgatgt ataaagcgag    102780
     cacgttttat gcatatggct aatcagaaaa atatagtatt tatagaaaaa tgtgttatta    102840
     tttatttact aatatttttc tacctcatga caaatattag ctgtaaaaag taacctcgct    102900
     tgccaattgt cgaggttgct ttttattttg ttcttattta aatattccct cgctacctat    102960
     atgtttattc cttaattatc catcataaca tatgttagat agttgttcag ttccattggt    103020
     tatataatgt gattttatac caatttaata aaaggatagg ttttctataa gttcgcaaaa    103080
     gtatactttt acggactttg agtttgtata aaaaatttat cattctcgac gttcgtttaa    103140
     atttaaaaat aatttacgaa cgttctttaa aatacatgta gttttacgaa cgtttttagc    103200
     aaagtaatag attgaaaagt ctacttccta taatcaaact tatgtaaact ctaaagaaaa    103260
     aagctactcc cttacccatg gaagtagctt ttccttagaa catcatacat gaagaatagt    103320
     aggaattggg gttcctatcc tcttagtttg ctctagaagt tgcattttat tcttttattt    103380
     taagtaaaaa agagaacacc aaaggaataa taacaagcct tcatcatatc gcaaattttt    103440
     gcaattggtt tgcataaaaa acagtctcga agtaagagac tgtcatctta atctgcttac    103500
     tataataaga tttctttata atttctctat agaagctctt ttcattagcc gttttaactt    103560
     attttccgta tccgtttcct ctactggtgt gtagatacta caccgcaaat ccatatcccc    103620
     ttgaacttgg agggaagtta aattaaataa cattttccct gctttggcat gtctaaattc    103680
     aataaccatt tcgggagctt tacttacttg gctttcattc cataaggctt ggaattctgg    103740
     atgtaaatga ctcatctgac taataaactg gttgtaccat tcatcaccta aatagtgtcc    103800
     ataataggta cggaaaatag caagaaaacc tttcgcaaaa tgctcccaat tgacagctaa    103860
     tgctttcaat tcttttcggg cgaacactaa ttgaattaga tttcgttgat catttggaat    103920
     ttgttcgaaa tctagaaaaa catgagctgc tgcggggttc catcctacaa tatggcaatg    103980
     gcgatctgtc acgatagtcg gacaataggt taattcagct agtattcgct tgagagaagg    104040
     gctaagctct aattgatctt tttttggatg aacaatttct aactttgttt ctaatgctag    104100
     attatataaa tagtctcttt catcgctatt tagttgtaga gctgtagaaa tacaatcaag    104160
     cacaatagaa gaaactttta tatctcttcc ttgctctaac catgtgtacc aagtggtact    104220
     tacccctgct aattgtgcaa cttcttctcg tcgtaatccg ggtgtccttc ttcgggttcc    104280
     agctggtaac ccaatagact ctggcttaat ttgagcacgt ttagctttta ggaatgtaga    104340
     cagggcctca agtctagttt tatcgttcat ttttaaaact cctcatcata caatttaccc    104400
     tagtagtagt tataccagta taaacaatcc cttgtaatag gataaaagga ctgtaaaata    104460
     caagtatatt attgatttgg agtgatgaaa agtggaaaga gttgtgatta caggtatggg    104520
     agtagtctct cctataggaa ataacatcag aacattttgg aacaacctaa ttaaaggaga    104580
     gtccggcatc tcctctatag atacatttga tattactgac cataaggcaa aaattgcagg    104640
     aattgttcgg gattttgatg cagatgaaat tttaggaaag aaagaagcaa ggcgtttaga    104700
     tcgcttttcc caatttgcta tagctgcagc tgaacaagcc tgggcagatt ctaagttaga    104760
     tctcaatcat atagatccag aaaggttagg cgtatacgta ggttcaggta taggcggcat    104820
     tgaaacctta attgaaaata ttgatgcact tagacagaaa gggccaagga gagtcagtcc    104880
     aactctcgtg ccgggtatga tttctaatgc tgctgcagca caaattagca tcaagtggaa    104940
     tgcaatgggc ccttctatgt caccagtttc tgcctgtgcc attggaaata ctgctattgg    105000
     cgaagctttt agacttattc gttctggaga agttgatgct gtgtttgcgg gtggaacaga    105060
     ggctgctata actgacttgt cagtagccag ttttgggaat gctaccgcat tatcaacaag    105120
     aaatgacgct cctactcaag ctagccgtcc tttcgatgaa gaccgtgatg gatttgtcat    105180
     gtcagaagga gctggaattc taatcttaga atctctgtct catgctttgc gtagaggagc    105240
     aaaaatttat gcagaagtca ttggatacgg tgcaagttca gatgcacacc atatggttgc    105300
     tacacatcca gagggtaaag gtgcttatct tgcaatgaaa gcagctttaa aaaatgcaaa    105360
     catacccctt gaagagattg atgttattag tgctcatgca acaagtacaa aagtgggtga    105420
     catctctgaa accaaggcta tcaaggaact gtttgaaaaa caagcttatc agattccaat    105480
     aacagctaat aaatctatga ttggtcacat gttaggagca gctggggggg ttgaagcaat    105540
     tgctttggca atgagcctta aggaaggcat aattcctcca acaataaact tagaaaatcc    105600
     ggatccatta tgcgatttag attatgtacc aggtattgct cgccaagtaa aaataaatac    105660
     tggtgtatct aattcatttg ggtttggagg tcataatgca gctattgttt taaagaaata    105720
     cgagtgagta tatttttagg gagtttaaat ccttgataaa atataattgc aaattgctat    105780
     ttaagttgga gtaaagatac ccaaaatcga atacatctgg caaaccatgc cctaattgta    105840
     gaagttcctt aggtactcgc tgaagagcca gattaatgtc cttttatatc ctaactgcca    105900
     ccctaaacta tattttcaaa atactaaaaa aaatgttgag aagtgacaag caagcattaa    105960
     agtaaaagag caaactctag tgacaaggag tttgcttttt ttatttatgt cttttgaagc    106020
     caaagctcac catataagct attaccaagg agataacagc agcaatacta acctttatgt    106080
     aagaaagttc taaggcccac ggaccgtatt tatgtggatt caaacgatac atagaccacc    106140
     actgtccatt tacaccttca aagaatgaaa tgacgatcca taaaagaacc aaaactaaaa    106200
     accatgaaaa aaagataata taattagagc gttttttaac cattgctcaa tccttcgtct    106260
     tctcaattca tctacaatat tcttctctct tattatagta acaataatcg ggaaaacttt    106320
     agagttttta tttagggagt tcttttaatg gattatggca gctaccaaac agagtcatta    106380
     tttgcatcga catgaggagc tgtttcgctt cggtttcctc tgtcatacgg ggattagatc    106440
     cgttaaaaat aaggcttgct gtggtaggag atatcaaacg gtcaggatcg gttgtgctag    106500
     ctgccacacc tttattaaag aacgaaggga tcaaaacagg cagccgtctt tttgaaattc    106560
     ctaaaaggaa agatatccat gtcgtgaatc catcaatgga gagatatatc aagacttcga    106620
     actatatttc aagtttggtg ttacagtatg tggctcctga ggattttcat gcgtatagca    106680
     ttgatgagtt atttattgat gctacagctt ctttgcattt attcgctcgt acaccagaag    106740
     aattagccca taaaatcatt aacgagattt atcgcaagac acggctgaca gctaccgcag    106800
     gaatcagtcc gaatctctta ctggctaaag tcagcttaga tcatgaagcg aagcacagcc    106860
     caacaggggt tgcttattgg cgttatgagg atattccctt taagttgtgg tcgattcatc    106920
     caatgaagga tttctggggg atctcgtctg ctacggaaag gcgcttacac cggttaggca    106980
     ttcataccat caaagaactc gctctttctt caaaggagaa gttgcaaaaa gaatttggca    107040
     tactaggtga agagttgcat caacatgcga atggtattaa ttacagtcgt atttcggatg    107100
     tgtacattcc tagctctcgt tcctttggaa agagtcaaat tctattccgt gattatacaa    107160
     accgaaaaga agtggagtta ttgctgttgg agctattgga cgatgtttgt tttcgtttac    107220
     gcatgcatca agtggtggct caaacgattc gtttatccat tggctacagc aaacaaacag    107280
     gtggaggctt ctccagacaa aagaaaatgg ggagagcttc gaacttaagc caagatatct    107340
     ttccgtattg tttaaccatc ttacatacat atgataatgg aatgccgatt cgctccattg    107400
     ggatctcctt atcaaacaca agcattgaag aagaggagca aatgagctta tttgatgaca    107460
     tcgatcagcg tgaaagagcc tatactcttg ccaaaacgat tgatgacatt cgactgcgtt    107520
     atgggaagaa tagtgtacta cgtgcgtcta gtcaccttcc ttattcaaca gctcgttatc    107580
     gaaagggcct tatgggtggc cataaagctt aagtaggaaa aagagatgga acatagagga    107640
     atgaaactaa caacagtata ttataagtgt gaatataaag tatacaaaga ttgtcattca    107700
     cctattattg tttctttata aggtagataa aaataataaa aatatgcagt atctatagta    107760
     ttcatagaaa taaatattag gagacgaaat caaaggttaa agtaaggaaa aacccaatct    107820
     taccattaca gaagattggg tttcctccta tttatcagca aaacacttag ttatgaccaa    107880
     ctattgggtg tggtacatat ggatcttcaa gaaacgcaat ttcttcaggt gttaacttaa    107940
     tcgataaagc atctactgca ttttcaagat gtgatgtttt cgtagcacca attataggag    108000
     ctgttactgg ttctttctgt agtaaccagg caagtgcaat gtgtgtacga ggaataccat    108060
     gtttttctgc gatggatgct acccgttcta caaccaatcg atctgagtcc gcagtcgcat    108120
     cgtatttaga tttttgaatt tgatctgtct cggaacgatg tgttgttact gaccagtcac    108180
     gggttaatct ccctgatgca agagggctat atggagtgac accaattttc tcttccttac    108240
     aaagaggtaa catttctcgt tcctcttcac ggtatattag atttaaatgg ttctgcatgg    108300
     acacaaactt agtccaacca tttttttcag ccacatgtaa tgccttttgg aactgccaag    108360
     cgtacatggc agaagcacca atgtatcttg cttttccagc cttcactacg tcatgtaatg    108420
     cttccatcgt ttcttcaata ggagtatcgt aatcccagcg atgaatgata taaagatcta    108480
     tataatcagt ttccagtctc ttaagacttt tatctatttc actcataatt gcttttcggg    108540
     aaagaccaga gccatttgga cctttatgca tttgtccatg tactttagtt gctatgacaa    108600
     cttcatcacg attagcataa tccttaagag ctcgtccaag atattcctca cttgtaccca    108660
     gtgagtatac atttgctgta tcaaaaaaat taatccctaa gtccagggct tcttttataa    108720
     caatgcgaga gtcatcttca ttaagcaccc attggtgaag ccatttgttg gcgtccccaa    108780
     aacccataca tccaagacaa agtcgagata catctaagcc tgtattacca agttttacat    108840
     acttcattta attgccccct acttttctaa tgagtcatac acttttttta aaaaaagacc    108900
     ttaacggtaa caactttttt tcagcaaggt ctcttaattt ttaggaataa tttcattgac    108960
     acatgctaat gtgttaagtg ttctaggaaa gcccatatat ggtaggcagt gagtgatagc    109020
     agtgattaat gtttccttgt cattgcccac atttatgtta ccctgcacat gtgctttcac    109080
     ttgaccttca gcgccgccca acgcgcttat aatacagagc gttaatagct ctcgggtttt    109140
     caaatcgagt ccgttacgag tataaaaatc tccgaagcaa aaagcagaaa gaaattcctg    109200
     catatgcttt tgatttaatg gagcactctc ctgcattttt ttatgccatc tctaaaaatc    109260
     tctccttgag ttgcaaggcc cttttgaaag cgattatctt catcgaccgt cttttggctt    109320
     tcaaccggta aagcgatatt ctttgctttg aatacctcat taacttcatt gatagcattt    109380
     aacgttttcg gaaatccaat atacggagca cattggtaaa ccgcctcttt gatttctaca    109440
     ggtgttagcc caacattcaa tgctgcacta acacatgctt ttaattgagg taacgtctgg    109500
     ttagtagcaa gaaccaccaa ggtgattaac tcacgctgtt tgtcatccag attaccttga    109560
     taaaaaaact tccccaaaat aaaatagctc agaatgtcct ggaaatcagg atcagtggca    109620
     tgtgtaccag gtactccttc accaaatagc tgtttgaatt tttcttcgct cttttcgata    109680
     cgattcataa acaagcctcc tgataaaaaa tagacaagtt cacatttata ttagctactt    109740
     ttattacagt tgattagttg tgagcttctt tgaaatcctt tttccttaac gcttttaatt    109800
     atgtcataaa tatcaaaaaa gccttagcct attattatca agtttttgcc taatcctctc    109860
     aaactttctt acaaaatcta tgactatcag gtataatgaa ccgaaaataa agaaaaggag    109920
     aataagttat gtctaacaca ccctataagc agcaatatga actttctaga ctcattgaac    109980
     gcctttgcaa gcaggacggt gttcatccta ctaccattcc atctttattt ctcatacgcg    110040
     aatccattat tactgaacct atttctaggg ttaacgagcc atctttttgc attatcctcc    110100
     aaggagagaa ggaggtatta ttgggagagg aaagattttt atacggtcct ggccattata    110160
     ttgtggcatc agtggactta ccagttacag gtcaagtcat caaagcctca gccgattccc    110220
     catatttagc cttcaaactt gaatttacct ctagccaagt tttagaggtt ttgaatggca    110280
     cagattttaa aacggggcag ggaaagaacg caaaacgagc tatgtacgtt agcgaaatag    110340
     agccatcttt gttgaacgcc gtagtaaggt tagcatcttt gctaggcact ccaaaacata    110400
     tccctgttct tgctccatta ttaaaaaaag aaattcttta ttggattttg caaggtccac    110460
     atggcgaagc gcttgaacaa atggcattag aaggtagcaa tgcctctaga ataagagagg    110520
     ttatagatca tatcatcaat aattacgaag agtcttttcg tattgaagag cttgctgaaa    110580
     tagcgaatat gagtgtttca tcgctacatc gacattttaa agatgtaacg gcaatgagtc    110640
     ccattcagtt tcaaaaacga ctgagattgc aggaagcaag gcgcttgcta ttagctgagt    110700
     cattagatgt agctgatgtc gcattcaggg tgggatacga aagtcaatcg caatttagtc    110760
     gagaatattc ccgaatgttt ggctttccac ctagagtaga tataaagcga atgagagaac    110820
     actacgttta aataaagaaa gattgcaggt tgtaaaaggt ggtacttaaa ttaaagggta    110880
     ctttagttcg ataaaaaata gtaattttaa gattttcaac aatctggatt tttaatggaa    110940
     gaaagattaa aaaaataatt atccatgtac acatagctaa atgagtaaaa acaattaaaa    111000
     caaaaggttt ttttattgaa tcttgataaa atgaaaaatg gcgtccattc gccactatgc    111060
     cagagtaata cagagagtta aaagaaatga ataaataagc aagtagaagt agctcaacct    111120
     gttttaacag aagagcaaat agaacaaatt aatttcacct ttattgaagc cttacataca    111180
     aataaataag tatactgtac atattatata taacaaaaac gggatgcaaa cgattatgca    111240
     tcccgtcatg tgaagaagga aaaagtagct tttaatgcag catatgatct ttaaggaaca    111300
     cctcatttac gtaattgcat tgcctaatga aacagtaact tgaaaaagta tattctcttt    111360
     aacaaacacc tcatttaagc attgagctaa aaaaatatac aatgtgaacg aaatcgttct    111420
     tggtctggga caaacacctc atttgtataa ttataaatga atattattgt ctacccatta    111480
     tatatattct tactacgttc atgactacca tccccttatg aatcaaacat acatcgattt    111540
     acaataaggt tttctcaaat atgcctgctg tagacacctc atcccaaatg taagaagctt    111600
     tgtaatgatt agttgtaatc aataacttgt tttccttctt ccctaaatag aatatcccaa    111660
     tagcctattt ataattcagt aaagctaaca ggtgtttttt ggattacatg tatccttcat    111720
     ctataagata gattaaataa cgaagtctta ttatggatag ctataataaa cagagatatg    111780
     tatgtatcga ttcattttat tcgatgtatt cgagcatcga aaagccatgc catttatgcc    111840
     gtatcataag tttttgatag gggaaagatg aatagatgaa attgttaaag gtattgtttt    111900
     ccttatttgc tatcaatcct actacatgtt acactgcaga taacttattt ttgttcggta    111960
     tattgagaaa agaaaaaacc ctaattagaa gtttttatct tgaaatagta tgtttgggca    112020
     agattggtaa tacatttgtg gagtattcca cagcaggagg caacattatg acacaaggta    112080
     cagtaaaatg gtttaatgca gacaaaggtt tcggtttcat tgaaatcgaa ggcggagacg    112140
     atgtattcgt tcatttcagt gctattcaag gggaaggttt caaatcatta gaagaaggtc    112200
     aaaaagttac tttcgatatc gagcaaggtc aacgcggagc acaagctgct aacgttcaca    112260
     aatcataatc aaaagtaatc aaaaaaagga ctcctgtaaa ggagtctttt tttatggttt    112320
     tatgattaga aaacctttat ttacctataa agaaatagat gtagaaaaag aagcattctt    112380
     atgcgtaaat ggcataggca tgcttctttt ttctacagat gtaggttata cctatacatt    112440
     ttcttttaca attcaacata ttaaacctta ttatggaatt aaactcaaaa taaggtggga    112500
     gatgcttgta tgagagctaa gattgagaaa gcgaaccatg tagtgatgtt tgaaacaact    112560
     ggtgagtttt atgcacacga agtgactcaa ggtcctaaag tgggtttctt tgcttgcccc    112620
     tcttgtggag taaaagttta tcataaacaa gaccatttct tttcacatga tcatgcgcgt    112680
     acgtgtactt acgtacaaga gcaatctaag ataaagttct aaaactgtat cctaaaaccg    112740
     attttgtaaa tttattattg gctaatttat acatttacag tataatatta aagttgtagt    112800
     tgtgaacgta taaaaggaga gtcagcatga agggactaag tacgttgaga aagatagatg    112860
     cagtgggtcg tatagtgatt cctatcgagc taagaaagct actagatata ggtaaagatg    112920
     atgaagtaga gattatattg gaagatgatc atatagagat aaaaaaatac aaagaatcta    112980
     atgaatgtct aatcacaggt gagataacgc ctcaaagccg tagatatgca aataacttag    113040
     ttctaagtcc attaggtgca aaaattttat ataacgaaat aaaagacaag caaaaaacct    113100
     ttgaatcata aattcaaagg ttttttattg aattattttt tatgttgtat actctctaac    113160
     caattttgga cagaagatcc caaactagtt gctcctactt ttaattcatc cataatataa    113220
     gaaatcaaat tgtgtagact gtactcttct ttataaggat tatttttatt gatgaatttt    113280
     aaaacctctt ttaattcctt tattcttccc tggtccaatt cttcttctaa atggcgagtc    113340
     atgtattcat caacaaaatc agaatttcta atgctagcct caattaagaa agatgctgct    113400
     aatgctggag aacaatctaa agcgtaagct aagcgtttta gaacatcata tgtttctccc    113460
     tgtccatcct ttaagcgagt agaaacacgc tctttttcta tatttttata taagtgtcta    113520
     atgggctctt tggacatatc gcccatatac acggtgctgc ccaaactaaa tcctcttcta    113580
     aaataatttg ataaatagtc catcactttt gaagaagcaa ggcctgctat acaaattgac    113640
     tcaactacac tttttacagg tgtattcgta atgtaagaca atcgataaat acattcttta    113700
     aggtcaattg gaagtgacgg tttaacatct cgttttttgt cacttcggat ttttcttttc    113760
     ttctcttcta ctctcacata atcactccta aaatctaaaa ttatctctag gacaatgact    113820
     ttttgtacat acctaaaaca tgtatatggc aggggaggga ggagcatgta tatttttttg    113880
     agatagtgga aaaaacttat agtagtagaa catgagagga gtcttttgta tgaaaatgac    113940
     gaaaaaagaa gcacaagaaa tcgcaaaaaa aataaaagaa aactctaata agtacggatt    114000
     gcctgtgaaa aaaaagaaaa atgctagcgc aacctaaagc cggatatata agaaaaagtc    114060
     ttcaatttaa taaaaaatag aagacttata tttttctact atagtacgca ataacattta    114120
     ttccactgtg taatgaagat acgataaatg tgggtaaatc ttataaaaaa gaaatgacct    114180
     ctttaatttt ataaacacca taatttcaaa ttagatgtgt tgataggaag aagttcaaaa    114240
     agggactgcc tgataaaatc aatttatcag acattccctt ttttgaaata tgattattgg    114300
     cgacgtaatt tattaatttc ttctggtgta aggttcatga attcagcgat tgtttggtta    114360
     tctaaacctt tttgaatcat acttaaagct acttttatga ttcctttctt ttcgcctatt    114420
     tcttcaccta tctgttttcc tttttcttct ccaagttttt cagctctttt taacgctgac    114480
     ttttcatcta acaatgcttt tcttcgtgct tcatatgcta atagcacttc tggatcttgg    114540
     ctaacacgtt cccattcatc catcgctttc tttaatactt gatcttctcg tggatctacc    114600
     tctctgttac gccatttaat gagtaactta ggtaactcca taaaatgaat ttctagcata    114660
     tctgttaaga gtaatttctg ctctcgctca tataactgaa aggtcgagtg ataattatga    114720
     atatgagata aataacgaaa gttcacaata ttaatggtaa tcgttttaca aagctctccg    114780
     tagtccatgc cttctttcat ttgactacta tacattttag accagtaata gagtgttcgt    114840
     ttttccatgt catgtttgtt attaagctga atttcaatat tgacgcggct tccatcctct    114900
     aactgtgcgt gtacgtctaa aatagagcgt ttatcttctt ggttttcttt attaaaatgt    114960
     gggtctaata actgcaccgt ctgaattttt tatcatctgg aaaacggagt gctgcgttta    115020
     aaaaagcagc taaaatagat tcattcccat gtgtgccaaa tagtgattta aatgcaaagt    115080
     cgacacgcaa gtctaatcgt tttttcataa taccctccat catttccatg tttgttatta    115140
     gtataccatg acggtaccga tttcttctat ctaacacttt aggagcaaat tgagtatcaa    115200
     tacggtattt atcacaccta attatgaatg ttcttcagac aaagaagcaa gaagagtatt    115260
     tagaacaaat agaagtactc gtgctgattg ctattgctaa taaataaaat cctctttgcc    115320
     attattcttt taatttgagg acgttctttg tacatatgag aatacattaa aaaccaataa    115380
     acgactgaaa gcaaaaaagc tactagtatg cctagtagct ttttacttaa aaatcgctat    115440
     attcctctaa atcatcatca tctagagagc cagatacctg ttctaaatct gcaatcttac    115500
     cttcttttaa ggtttgactt tctgaaggct tgtcttctat atcctcttgc ttgactacaa    115560
     agccattagt cttagctaat tgttttaatt ccttcagttc tgaattgata tgttcaagaa    115620
     gttcttctgt tctgtgacct gaatctactt ggtcgttaga tgaacgatga aggtcccgaa    115680
     caattaaaga tgaaatatag tctcctaatt ttcgagactt tgcatatttt gcaagtatgt    115740
     catagacttc atcactcaac tggttggtct taattgtaaa ggcgttttga cgctctgaca    115800
     tggttatcac ctacgctgtt aggatttaac ggctttcttc tcagcttgtt tcttttgaag    115860
     gtaaccgatg cttcggattt ctaggccaaa taagtttaag tgacggctat cttctggtac    115920
     tttatgatat ttctctgtac gttcttcgcc aatcttttca ctcatgcttt tcataatcgc    115980
     tacttctagt gttggagcga caccaccact atatacgtat ttacggattt tatttgccgg    116040
     tggtggggcc acatcattta acttcgctag taaaatttcc acatactctt ttaaagaaga    116100
     tgtaatttga gctgttaaat caatggctgc gcctgtgttt tcatttttca actcgaattt    116160
     ttgtttacta tagttatcta aaataaattg gtcaaaagca cgtaaatcgg taaacaactc    116220
     tgggaatttc tcttttcgta acttatcaat atgcgctagg tatggaatac cttcaatact    116280
     ttggaatgat tcacggctat tcgcagcctt taatccttcc ggtaaaatga cgacatcaat    116340
     cgagccacca ccgatatcaa ccatcacggt ttcacattcc acatattcat tggcatcttc    116400
     acggtcttga agtgttaggt ctttcttcaa cgcaaagcgc gcgatttcgc cttctttcag    116460
     gcaagcactt tcgtccacag ctacctttaa ttctttttca aatcctggag tatgaatacg    116520
     gaatgtatgg tcacctagga agcgagtagc catggctttt tgcgcttcgc caaacgtact    116580
     ttcttttttc agtaaccaaa ttggtaacat cgtagagaag tagtcaatct ggatgttatt    116640
     atcttttgga tctttcgcat gcaacgcatg gtagtatgca atagcagcta aaaatgttac    116700
     gtaaggaatg tggcttgtaa ttttgttatg taggtgatta atgtgattgt ttgcaagttg    116760
     ttggcttgct gcgatgtcac cgactaagaa ataacgttct gtctcttcgt caccgattgt    116820
     tgtagatagt aagatacgct tcttaaattc ttctggtgct gttaccgcat ctgtaaagaa    116880
     tgaatcagca gcttcttttt ggagttctac tacgttagtt ggaaagtcaa ataggtaccc    116940
     atccataatg ttcatatcga ctgagttccc acagtccttg ttaaaacgtg aaattttcat    117000
     ctctatacac ctcgttttta agttgaactt ctattgaact cattatacac aaaaaagggg    117060
     taatgttcaa tctttaagtt gaacttattt atcatcaaaa actcacatat ataaacaatt    117120
     aaatttgatt agttgaactt attataaagt taagagataa aggttaggga gtggttctca    117180
     taaaatgaaa agatgataag taatttataa tgaaaaagaa agtataaggg gaatatgaat    117240
     ttcacataaa acaagtagat agttttaaag cttcaaaagg aaaataagag ggcacacaaa    117300
     aacaattctt aactagaaaa ataaattttc tacactatat tttaaaatat aaaaagtggt    117360
     tatataaaaa cttttgggtt ttaattccat gataaagcga acaatcaata caatagatta    117420
     cttataaaaa ataaaagttt gtgaacgtat acttttttga acgctttttc aactttagga    117480
     taatgttata ggtctatgaa tatttcctta aggttaaaga accgataatc attgttattt    117540
     gaggtgaaag tagtacaagg taaggtaaac taaacaggag ttttatatag gaaacaaagc    117600
     agtatgaatt cccaaatagt aaaccactta actagacaaa ttattgaaaa agcatcatat    117660
     ttataagtgt tgtgtttgaa tataaactag tcaaaggggt tttactatat tgaagttagt    117720
     ttgtaaaagt tgcgaaatag aaatttctaa cgtattaaca gaactaaatg acataagcct    117780
     gatcaaagag gaaatggagg aagattatat tcctcaaggt tatttcttaa ttgtgaatga    117840
     agaagataaa gtcgatgaaa aaggtacaat tattataaat atgaaggacc taatcaattc    117900
     taatcatcat ccagatggag atcgtttaaa cggatgctgc ggtttagatg gcttagacgg    117960
     tatgaacaga gtctgtataa atgaccatga aattggtact gagaattcag attgctggat    118020
     gcctcattac atagctataa atccgaatat ggtaaacttc acgtaaagct tttcccattc    118080
     cttcattgaa gaaaaataac tttttttagc attgacgtag gaaatatggt tttatgggaa    118140
     caacaatgac agttaaaatc tcatattcct tttctattca cttcaatcaa tataagaaaa    118200
     aagcgtcaga aacgtttcta acgcttttta tttacccatt atccttcaac cttcagaatc    118260
     ttgacttcat tgctcaccga aaatgtgatt accaaaggtc cttcaggtgg gttgtgtgga    118320
     cctgtaaacg tatggtattt cactttcatc acgaaatcat agttcgaaaa cccacccgat    118380
     acacgcttca aactcaaaat atttgcattc cataaactat aactacgatc agggtatttc    118440
     gttcgaatcg ctttctctgc atagggattc agcagcatca aaaaggcatc atagaaatcc    118500
     gtatgctttt gagtgatgga cggtttggga gcagcttctg tacaagtggc cattcttcct    118560
     gttaagcata ggacaagagc tgtggcgacg atgaatcgtt tcatccgtta tcctcctgtt    118620
     agtatttgtt ttagttagtt tctccatatg aagatggacg atacagaggg tgaaaaaacg    118680
     atattggaag cttactttta tgcaactata cgcgcgttca gtgcctccta aagcattgct    118740
     gtaacaacga tgtataaaat tctgcataaa tgacaaaacg aataagcaaa caagtccttg    118800
     tgtaccaaga gcttgttttt tgcgtgtgta ccggaaagag actttatgta aaccagcatt    118860
     cctgtttgaa attatttgat gtcttgaaat aaaaaagtcc ccttgatatg atgcagaagg    118920
     tcatggccat gacttcaatt catcattcac ggaggactct tatgaattgt actcaaaacg    118980
     aaaagttaaa tcaagttaca ccccatacac tgattgttgg agtagatatt gctaaattta    119040
     agcatgttgc tcgcgcccaa gatgatcgtg ggaaaattct tgggaaagct ctaaccttca    119100
     cgaatacaaa agaaggattt gaaggattct ttgcctggtt ggaagagatg caacataaac    119160
     atgagaaatc tgatgttcta gttggtatgg aacctacagg tcattactgg ttaaatctag    119220
     cctatacact aaaagaaaga cttgtctcct tcggagtcgt taatcctctg cacgttaagc    119280
     gaagtaaaga actcgacgat aactctccaa cgaaaaatga tatcaaggat gctagagtta    119340
     tcgctcaact gataaaagat ggtcgatttt cttatcctcg cttaccaatg gatcaagatg    119400
     cagaagtaaa ggcaggaatt acaattagaa accaaattgt aggtgattta caggctctac    119460
     aaggacggat tcataattgg ctagataagt attttccaga gtttttaacc gtttttaaag    119520
     actggagtgg aaagatggcg ttggccacgc tagaacatat tcctcttcca gttcaactta    119580
     atcaaacaac acccgaaagg gtggcagaaa tatggtccac gtacggaggc gtacaacgcc    119640
     caagccataa acgaatacag cgacttcaag aggctgctgg acgttcagta ggattaacgg    119700
     ttggactaca gatggcacaa cgagaaatag ccacaaatat caaacgatat aagatgctta    119760
     aagaagaact acatgcatta gaaaaacaat tggaagacct tgtgctgacc ctgccgggta    119820
     ttgctgaaat gctgactgta cctggtgttg ggatggtaac tgttattgaa ctttattctg    119880
     agttaggtga tattaaaaac tttgaaaatc cacgccaaat cttaaaatac gcgggattaa    119940
     atttgcgaga atccagctca ggaaagcata aaggacaaac acgaattacc aaacgaggaa    120000
     gggctaaatt gagggctttg ctctttcgga ctgttatgcc ccttgttcga cataatcgag    120060
     cctttaaggc tctgcatcag tactatacaa cgagacaaga aaacccttta cgtaagaaac    120120
     aatcactgat tgtactttgt gggaagttag ttcgtgttct acatactgta ggtcagaaac    120180
     aatgtccatt tgatgaagag cgaatgatac gagatattcc ccatctttct ttagctctag    120240
     gagcttaacc tttgtccatt agaaatgaag cacggagtat ttgggataaa gcatttttcc    120300
     aggcattcga ccttgcaaac tagcattacc aaactctatc tcatagacag attgaacgaa    120360
     ggaatgtagg cgctaagacg ctgagagaca tgggaggttt catcgctatg aggcacatag    120420
     agatccattg tgcgactata tgtatgtctc catctttttt taaaataatg gaaaaagaat    120480
     agcgaagcta ttccccttag taccagttta ttgtaaaaat gaaaatataa ggttagaaat    120540
     ggacataaaa aaatttttta tattttattt cccccctata aacccttgat attactcaat    120600
     ttatagaggg agctttgtat atgatataca tttcaaagaa ggctagattt tgcaggataa    120660
     ggctatataa cataagattt taatttgata taatattgtt ttgaattttt ttccgcacaa    120720
     ctcgatggag ggatacaatc aaatgagtaa aaaaacggct ttgttgctta tcgatgttca    120780
     aaacatcatg ttttcttatg aaggtggatc tttatggaat gaacagcaag tgcttcaaaa    120840
     tattacttct ctaagagaga aagcgtacca atctaatgta ccaattatct atatccagca    120900
     tacagaccct agttctggca gtatgcttag cgaaggaaaa gtcacatggg aaatccatca    120960
     ggatgttcgc cctttaccaa cggacatagt tattcaaaaa tcttcttggg atgcattcta    121020
     tcaaacaact ctacataaaa aacttcaaga gcttgaaatc gaaaaattag tcattgcagg    121080
     catgcaaact gaattttgtt tagatactac ttgtagaaga gcatatagct taggttataa    121140
     agagaatatt ttagtaaaag atgcccatag cacatttgat acggctgtgc tttcagcttc    121200
     taaaatagta gaacatcata ataatatgtt gggcggcagg ttcgttacat taagagaagt    121260
     aaacgaaatt atattttaag ctaataaaga aatacttaga gacaaaaaac agcctttcaa    121320
     aggctgtttt tttgttccta gaacgcacat tatattaatt aagattgtgg ggcgtataca    121380
     gtctgaaaat agaaaaagac catttcttcc cagtcaaaac tgagttaacc cattttatcg    121440
     agaaatataa agagcaatac acaggagtaa agaacaaact ttataaaatt tatgtgtttt    121500
     gcgggatata ctagttattt attcgatata ttcagattat aaatctatca ttattcgtta    121560
     tcttatattt ataggatcta ggtggaatag ccaagtggtt aaggcaaagg tctgcaaaac    121620
     cttgatctcc ggttcaatcc cggattccac ctctaaatta taaatataag gagaagatta    121680
     tgaaaaaaac ctctatgact attattacta ctctcttaat ttgcttttgt tttactaatt    121740
     atgggcatgc taaaacagaa acaaatcaat attacacagt tatcttgaaa gaccgttcta    121800
     agtggacgca atctattaag aagattaaaa agagccaggg agaaattact tataccgtcc    121860
     ctgagatagg actaattcaa tttaaaggaa atcaaaaagt ggctaaaaca aatgcttctt    121920
     tatttaaatc tttaagtcct tctttaaaat tagaaaagcc ttctacatct acatctaagt    121980
     cttttaaaaa acctaattca agtgtaaact caataaaagg tttagatagc actcttcctg    122040
     ccttatggga tatgcagtgg gatatgaaag aaattacgca caatggagaa agttataaca    122100
     tagaatcagg ttcttctaat gtaactgttg gaattgttga ctctggaatt gacattgacc    122160
     atccagacct ggtagacaat ctgaaaagtg gatcaaaaaa tcttgttccc aaaggtgggc    122220
     ttagagggac agagcctgaa gaaacaggcg atattaatag tattaacgat attaatggac    122280
     atggaactat ggtagctgga tctattgctg ccaatggtga aattaaaggg gtagcaccga    122340
     atacaggaat taaagtatat cgtgtattcg gtaataagtc agctgatgct gtgtggatca    122400
     tcaaagcaat tattcaagca gctaaagatg acgtggatgt cattaatctt agccttggtt    122460
     cttattatat tgatggtaac atatataaag atggtgaact tttagataat aagtgggcag    122520
     atgttgaagg atataaactt gcaattgagt atgctaataa gttaggtagt gtggtagttg    122580
     cttctgcagg caatgactca atagatgttt ccaacaaatc agagctgaat gattttctta    122640
     agaaaaaata cgcggaagaa ggaaaaacat ttaacggagt aggaattgaa gctccaggag    122700
     aattgcctgg tgtagtcaca gtatcttcta ctggtcctac gcaacaactt tctttattct    122760
     ctaatttcgg aaaaaattat attgatatcg ctgctccagg gggagattct agattgttag    122820
     agaaatacgg ccaagaggca tggtgggatg gtggactttt ccgacaagaa caagtattaa    122880
     ctacttttaa cactggaaga tatttatttg cttctggaac ttcgatggct gcacccaagg    122940
     tttctgctac cctcgcctta attatcgacc aacgtcacta caaaaaccgt ccaagtaact    123000
     ccattgatta tctatacaaa aacggagtaa aaaaagatat tgaacctaat ttagcttatt    123060
     ggggaaatgg tcaactggat gtatacaacg cggttaaata aataaaaaat gaactatgat    123120
     actcatagtt cattttttat ttatttatgg aagatatggt gaattcaata catgctcctt    123180
     gaggttcatt atttctggca tgaatttctc caccatgttt tataactaac tcttttacaa    123240
     tatataaccc caacccatgg tgaagttggt cattccttga aggatctcct tgatagaatt    123300
     tactgaataa aaaaggtaaa tctttggtat caaatccttt tcccgtatcg gaaatagaaa    123360
     aagacatcat atctttctct atctgaactt gaacatcgat actcccattc actggggtaa    123420
     aacgaatgct gttagaaatt aagttagtca gaatttgatg caatcgtttt ggatctaatg    123480
     caaattcgga atttccctct ccaggctttc tattcaagct gtaagtgaac tttatttctt    123540
     catcctctgc ccatttttta aattcctcta gcatttccgg taacatttct ataggaataa    123600
     caccttcaat atcaagtgta aaatctggat tatctacctc agacactctt ttcatttcct    123660
     ctgtcaaatg caatactctt tgggtattat tttttattgt ttgcaaatat tgtggcaaac    123720
     gcttctgtcc atttaatgat ggatccatta agacctctac atgggataat ataattgtta    123780
     gaggcgttct taaatcatgg gcaatcgagg caaccatatc tcgacgctct tgctctaatt    123840
     tccattgaag ataaagtgac gttttcaact cttctttcat actgttaaaa gagtcaatta    123900
     atacacctat ttcattttca ctctcatatt taatctcaaa atccaaatct tgatttttaa    123960
     ttttctgaga agcagcactc agttctttaa tcggcttatt taattctttc ccaaaacgtc    124020
     tcgcaaatac gtatgagtaa agtgttaaaa ataaaaaagg aattaataat attataagaa    124080
     atatgtattt tatataatag tcaatagatg atgctaacac atatcgtaca gctagaactc    124140
     cttccattcg atttttgtcg aggataggaa gatatttcgt tatgaccttc cctttttgat    124200
     cggatctatt aactttttca tatatacttt tgttattttc tattaattgg tcatctaatg    124260
     taccatatat tttatttcct cgaaggttta tgacctgata tgtaattcct tccataggaa    124320
     taactttttc taaatttttc tgaaaagata cttctaatat cttttctcct tttaactcaa    124380
     caaatttttc tatgctagga acttttttct cgtaataatt agcaggttgg actgactttt    124440
     cattataaac ggagagaaaa taatataata aaactaagct gcaaattgta cttataaggc    124500
     ttaaaaagat tactgaagca aaggttaaaa taaactgatt ttttaaagat agccgtttaa    124560
     tcattaacgt ttttccaact tatatcctac tccccacacc gttttaatgt gataagttga    124620
     catacctgaa gtcaatttag ctcttaaatt attaatgtga actataatag tatttaagtc    124680
     acccattgca tcaatacccc aaattttctc ataaatctgt tctttagaaa atatttgtcc    124740
     taagtttact gttaaaagtt ccaatatctt aaactcttta cttgttaagt ctatcttttt    124800
     accatccaat aaaacgtcat gttgtgaata attaatagtt aaattaccta agagacgttg    124860
     attctgagta ctaactcgat ccctctgttc acgtcttaag tgcgcctcta cccgagcaat    124920
     aagttctttc acttggaaag gcttcgttat ataatcatct cctcctaaag taaatccctt    124980
     tactttatcc atctctgagt gcttcgcact tagaaacaga ataggacaat aaatttgttc    125040
     tctgataact ttacaaagat caaaaccatc catctggggc atcataacat ctaatattat    125100
     taaatctaca tttgtcttta attgatctaa tgcttgctcc ccattataag ctttaagaac    125160
     tctataacct cggtcttcaa agatatcaga gattatatct acaatctcca gctcatcatc    125220
     gactacaaga atactttctt gcataagtat atacctcccc gcccccctag tattttaatt    125280
     atctaggaga gataaattag taccctccta gacaaaatat catcttttca tagaaccttt    125340
     ttagagtaaa agtaactaga aataagatag ataataaact gagacactcc aaatattaaa    125400
     aatattacta ttatagaata aattgtaatt ccttctaata tattttgcaa ggcattagta    125460
     gctataaata aattcaatcc ccctaacgat aaaggaacaa agaatattac cgaaatttga    125520
     atgtacaaag tccttttaat ttctttagca gtaagaccca cttttcgtaa tgagtggaat    125580
     acttttttat catcgttcat atcttcatac agtttaaacc aaagcagact agctaaagca    125640
     agaaacaaaa ctaagcatat aaacagtcct gtaagtctca atattgaaga taattgaact    125700
     gtattttcat aatcgagaag tcgaatacta tgaagattat ccgatttgaa caaggttgta    125760
     tctgataatt tctttaaaat gttataaatt tttgcatcct ctttaaaatc taatttatag    125820
     agtgacaatc ttttttcaga aatcgttgtt ttatatattt cactaaaagt gtttttcggt    125880
     acagagataa taccctcaat tccatctata ggattaagaa ctcttttacc gttcatattt    125940
     tttactttta gatctctctc ccctttttca gattttaatt ttaagatttc attagtaata    126000
     tcatcagttt ttttattatt aaaaatataa ttattatttt ttaacgaatc ttcatctttt    126060
     ataaaagatg ggtcattctg tattactaaa aattgcttct tcccactctc tgaagaaatt    126120
     tttaatcctt tccacttatt catgtgtaaa tcctttattc cttgtctctt caattcagct    126180
     ataatatctt ctattttgtt ttccttcccc tttgatgcaa caaataatgc tccttgaggg    126240
     tgagtgcttt gcattctttg actgttcttt tctatatata actgaatagc accgattgat    126300
     atcataattg cagataatag aatagatacg atgaagataa tctttgcatt ataatataat    126360
     ctttttctca aacttataag agttaacatc tttatcccat tcaactgccg tttttcttta    126420
     ttattcaaat aagatattac acctactaaa ccatttgaac agaataggta tgtgcctact    126480
     agtaataatg ctaatagggg taaaaaagca aataatagca taggtaaaga tgcataagag    126540
     ataaatatat aagaaaccaa aagaaagcag atagataaaa tgaatttaac cctagagaat    126600
     tgagctgaag gtttaggttt tttttcttct tgaaataact ctagaactgc aattcgttta    126660
     atcttgaaat aactacgaca tgaaacaagt aaaaatacta ttccaaataa aataaccgta    126720
     acaaaaacag ccacgggaga gaaagtataa acgaacgatt gatttgaaaa tagaatatca    126780
     ctcatgaaat taaagaaaat ctttgataac agcattccaa ataaaatgcc aactaaaata    126840
     gaaaacgtac caactacggc gttctctaaa acgagcacgt taaacaattg ctttctagag    126900
     gccccaaatg ttttccaaat acccatttct ttttttcttt ctctaaggaa atgctcatgt    126960
     gaatatgcga taaaaaaaca agaaaatagc aaaataataa tttcacatgc aattaataac    127020
     tgttctgttc ccgaaacctt tggatataaa agaaaggctg cgtacatata aaaaattgct    127080
     acagaaagaa tgctactaag tatgtatact gtataatgag aaagattacg ggttatattc    127140
     ttagttatat atttccacat tgatatcatt atcctccact tccttagcga taaaagataa    127200
     gattctttga ttgaacttag acgtatcttc taatttggaa cgcttcattt catggacaat    127260
     ttggccatcc tttaaaaata tgactctgtt acaaaagcta gcagctaccg aatcatgagt    127320
     taccattaaa atagttgttt tgtacttttc atttaacatt tttaaagtat gtagaacatt    127380
     ttgagcagat ttagaatcta aattccctgt aggctcatca gcaaataata aagcaggatt    127440
     gttaataaga gcacgaatga tggcagctct ttgctgttgc cccccagaga cttcataagg    127500
     atatttagtt aaaaattttg tcacttccaa ctcttcagca aatttttgaa gtttattctg    127560
     tacacctttc ttatctcctt tttttaaagc agcaggtaat aaaatatttt ctttaatagt    127620
     caaatgatct aacaagttgt aattttgaaa gatgaaacca atatgctcac gtcggtaaat    127680
     acctaattgt tcttctttca tacctgtgag agtagttccc ccgaccttga tatccccttc    127740
     tgaggggata tcaagggaag aaagcacatt taataaggta gactttccac ttcccgaagg    127800
     acccataatt gctacaaaat cgccttcttc aatatctaaa cttatattct ttaagacagg    127860
     gtacgttctg tacttagttt tataaacttt tgtaatttct cgtgcttcca atatagccat    127920
     tttaattctt cctcctatct ttatttaaga agtaaattct tttttactcc aaatccttac    127980
     acaagcacca aaaccaacta acataataac aaatgcaaaa acatataaag aattgctagt    128040
     agtactcaga gtatgaaaga tactttgaac tgataataag aaaaatgaaa gttggctgga    128100
     aacatacaaa caacctacat ataacccaat taacaagaag aagctaataa ctgcatttga    128160
     aataattaca ctaattaaac tagcaagagc taaacagcac atctggatga tgaaaaagag    128220
     accatacact tgtactgtat ataatatagc ttctatagca ttcttctgtt gaccataaaa    128280
     agtaaaatca ttatctggtt ttaagaagat aaaaccaaac gctatactaa tccctaggat    128340
     aattaataaa tgtactagta ccattaaggc aagagagaac cattttgaaa ttagaaatga    128400
     ttttctttta aaaggtctaa ttaaaaaaag acgatatgct cctgagttat attctacatt    128460
     aaggctattc agaaaaaata ctggcataaa gatcaatgta agtaagaatg aagattcttt    128520
     taataagaac catggaaaat tccaagtatt taaaggaact tgctgatcgt tattgtaaat    128580
     tccaactcca tagtatctta agaaccaagc ttgaagaagt acaattacag taaaaatccc    128640
     aatcatccat ttactttttc tttggctcca aagtctctcc cattcgctta taaataatgc    128700
     tttcaattaa aaccctcctt gagtcaaata aaataatctc tcttcacaaa tgtccaataa    128760
     ccaattaagc caaatagagc aatgtatacg gcttgaacta aaatgatgta agaatttaga    128820
     ttgttagttg atgaaagtaa aaacgctatt cctgtgtgct gaattttcac gatagacatg    128880
     tacataaggt gaaccactgt gctgtgcccg ataattgttt gcgtcgagaa ttctaagagc    128940
     tgaggaatgg caattgctaa gaaaataaag ccaacccctg ccccaagtgt tatcattgta    129000
     cttctgctta tcgatcctaa taatgtaaaa actgatacaa cgctaatcat tgtcacaaaa    129060
     caagcaaaga aatattttac gttatataat aaagctgctg ctaaagataa tttctgctca    129120
     tctagaaatg ttattaaggt attaacctta ggaaaaaaga tataaccagc aacggtattt    129180
     aaaatccaaa atagagttaa atacaagaac atggttgtta aaatagtagc taattttgct    129240
     aaaaaaagtt gagtggtaga aaaaggacgg atgaggatca ttcttagctg cccattttct    129300
     atctcattag ctataaccgt agaaattagt attatagcta tgatattaaa agaaacaacg    129360
     agatgttcag aaatgctaat tatagggaag ttcaaagaag ttacataatc tggttgtcct    129420
     ggtgacactc gttcattcca atttaagtaa tatttaactg aacctagcga cattaagggt    129480
     ataaaaaata gtatgatcca tgatatcttt tgggaccata atcgttctaa ctctgaagtg    129540
     aaaagtcctt tcatgatgtc atcatctcca caaatacatc ttccagtctc ttgcttggat    129600
     ctttaattaa ctcttcttta cttccttgtg taacaagttt accgttacga ataatgacaa    129660
     gatgatcaca catttgttgg atttcatcaa gtaaatgact agaaatgaaa aatgttagat    129720
     ttttcttttc tcgaagttca agaattaatt ctcttaattc tctcattccc atagggtcaa    129780
     gaccatttgc tggctcatct aataaaatga catctggttc tcctaagagg gcttgagcaa    129840
     ttcccagcct ttgtcgcata cctaatgaat aattcttaat ttttacatcg gcatcttccg    129900
     ttagtcttac aacagataat gctgcctcca cttgctctaa ctgttctttt ctcgaaaggt    129960
     cgggatatag cctcgctaaa ttttgtaaca tctttctgcc tgacatatac gggaaaaaga    130020
     taggggactc tataatcgct cctacatttc ttaaagcctg ttgtctatct ttatttacat    130080
     ctttaccccc taccattatt gtgccttgag tagggcgaat aagccctgta aacattcgca    130140
     taacagttgt ttttccagct ccatttggtc ccaaaaaccc gcatatatct cctttataca    130200
     ccttagttga gaattgactt acaatattct ttccactcac tgtttttgtg atattatttg    130260
     cttctaaaac aatttctttt ttcatattca atccctcctt atggtttaat ataaaagaca    130320
     aatataaata aaaaataaag aaaagaaaaa aactcacatt tttgtgagtt tttattgaac    130380
     ttcaactttt tcacaaatat tcgctagtct atttctttct tctaattgtt tagaaatgat    130440
     gttcaatata ttttgcggat taggtaaaac atagttaggt ctcaatgaca tagttgcaat    130500
     ttcaaaagct gttgttttta caggaggtac aacaatatga tcatattgtt gtagtagctt    130560
     aacattatgc tgaactactt tcttttccca cattaattta ttcatgtttg gaaaaaagat    130620
     aacaggttta tcatgagcta gtattactgt acttaataaa tcagttgcta gaccatgagc    130680
     tgctttagat aatgtgtttc ctgtagctgg aagtacggcc attaaatcgg cccacctcgc    130740
     taattccaca tgtcctatgg ttccacttat gctaagcttt tcatcaataa atacctcgtc    130800
     acaatataac tttactgtct cagctgggat aagttgaact gcacctttcg tcattacaac    130860
     ttttacctca ctaaagtttg cctttagcat agctaaatat tgaaaaatgc ctgctactgc    130920
     aatcgaccca cttaccccta ctagtatttt tttctctaca atattcttaa cgtccattta    130980
     tcatagcccc ctgaatctta attaagaaag taaaaatgcc ccgtcccacc aaggttcttc    131040
     cactgaactt aaacttagta aaggtaataa tacgccagtt acaccttcga gtaatccagc    131100
     cttgtttaat tgatgtgact tctctccatt ggattctata tctctaaaac caaagggtgc    131160
     attaggatca tatgattctt ctatataatg tactaactct actattgatt gaactgagat    131220
     ttgattctct tcatcttttg ccatccttat aagcatttgt aataatcctg ctcttccatg    131280
     acaaaatgtt ggcgatacta attcccattc ttcttttggt tctactatta tgtcctgata    131340
     agctcccact gcactcctta ttgctgctgt gtcgcccaag gcctttcctg ctaaatatat    131400
     acttctcgct acgcctgggt ctccataaca ccagccctga cgttttggat aagaatgaga    131460
     tattttagaa gtggctactt cttgaaaact aagtctggaa ggccaaccac tgtctacttg    131520
     tttccacttc attaaccaat tggtaatctt gagtacagct tccctctgac caggtatttc    131580
     aattcccttt tgaatcgata aagccataaa agacagtgga cccggtatgc catgagcaag    131640
     accacaatta aaattccctt ctggaaacat aattctatct ttttctagta gttgattcgc    131700
     ttttgaaaca taccaccccg gtactttttc accatttacc tcgatatcag aagccatatc    131760
     cacaaaataa gtaagtattt tttttagtgc ctcatgattt tctttatgct tcgtattttc    131820
     aatgagatag cgacctattc ctgtcattcc ttgtatcaca tcatatttta gaggatgtac    131880
     acctagttcc ttctctggtt catttaatat cttttctaat tgcatcaata taaaattatt    131940
     taagacttgg aggaatctag aatacctctc ataattatgg gatatatata acgtggcata    132000
     agcgacacct gttatacctc caaacatcga aatactattg accccttgcc tttcaataac    132060
     cttctgtact tctactaaat ggttatgtgc gacaaggtca aacccactat cagggaactg    132120
     acggtcaagt tctccaaata ataaaatagt gcctggaaaa ccatgggaca atgtgatagg    132180
     gtcccatgga ttcaaattac ctgccaatga tacgttatca ggagccatta ctatcttttc    132240
     tataccactt ggatccttta acttttcagc tatgcttaac actaatttta gtgctttatt    132300
     tcttgtctca ttatcaattc cctttaacca atacgttttt tggtcagtag tagatggcat    132360
     aattttctcc tttctcctta catcttatga gcttgcttgt gttgcactgg cttctatata    132420
     actcttagct tgcagattaa ataatctggc gtatattcca tttgtgtcta aaagttctac    132480
     atgagtccca tactccgcga cctctccttt atcaagtact ataatcctgt cagcgtattt    132540
     tacggttgag tagcgatgag atatgaaaag tcccatactt ttctgagcaa tctcttgaaa    132600
     atcttgaaaa acttcttctt cggctgctgg atctaaagca gcagtcggtt cgtcaagaat    132660
     atataaactt gctcttctca tataggctcg cgcaatagca attctttgcc attggcctcc    132720
     agataattga ataccgttag caaaagtttt tccgagctga gtatccattt tatcaggcaa    132780
     gctatcaatc attgtaagcg ctccggacct cttagctgct gcttgtatag ctactaaatg    132840
     attagacctt ttgtaatcac cataaccaat gttttctttg acatctaact catatctcac    132900
     aaaatcttgg aaaatagcac taattctatc ctgccaatct tgcggctgat agtcctcgat    132960
     tcttttacca ttcaagagaa taatcccctc ataatctgta tatagtcgtg ttagcagctt    133020
     aacaattgtt gattttccag atccattaga tcctactaaa gccaaagtct ctccaggttt    133080
     aatatgaaaa ttaacatttt ttaatgtgta attctcttgc cctggatatt taaaggatac    133140
     atttaaaaat tgaatacctt cttccgttga agagacattt tctaacgttt tttcctctga    133200
     gacattaggt ttatctgtgc tttctggaac attaaggaag gaaaataatt gtgtcatata    133260
     tagattgttt tgatgcatgt taaaaaccat atacattaac tcatttgacg ttttttgagt    133320
     cgtgttgaca gcttgaaaat aagcaataag gctaccaata gcaattaatc cctggattgt    133380
     atctttaaca atcataaatt gaacgaatat tacaaaaatt acacttatca attgaaaaga    133440
     taaatcaatt ctcatctttt ttaaaagcaa atggcgatcc tgattataga acttactaaa    133500
     taagtctgaa tagtttctta gtagtaagct gcctaaccca aatattttaa cttctttaac    133560
     ggtaatatca gtggtcatta gatagtagta ataaaactgt tttcttgtct cctctgctcg    133620
     cttatggctt actaaaaata tttcttttcc cacattcaca atagaccagg cggatattaa    133680
     aggtaataaa attaagatca atgtaaattc ccagttccaa accattaaaa ttattgaaat    133740
     agaaattaaa gtaatagcac cttttacgat ccccattaac tcttcaaaaa tagcaaacgg    133800
     cttatacgtg gaatcttgcc ttgctcgttg gagtttattg tatacctctg ggttttcaaa    133860
     gcttgcataa ggtagtcttt tcgctttttc aatcaatttt acatttatct tgttagacag    133920
     taggtttctg tatagttgct tatgcgtttc taggattgaa ccggtagcgc tggttaataa    133980
     agtgacaact gaaaagaaga taaaaaaagg taaaatgtcg taaaaatagt tatctttgta    134040
     cccttggata tacagattct gcaccatatt tacaagatat tttattgcta aaatcaagga    134100
     agctggtaat agcccattta gaaaatttag gacaagaaca cagaagaaat atcctctgtg    134160
     tgtctcccac aaaagcttaa atagactcgg ccagtatcga aaagatttta gaatgctaac    134220
     aaatgatact ttctcatttt ccattgtagg atctagcgta ttcttcattc ttattcctcc    134280
     aatacttctg gctggacaaa atatgtctag taaaagctaa tgctttcttc tctaattctc    134340
     tatttgctcc taataatcga ttacagtaca tatgaataat tgctcccata atcatttgat    134400
     gctcattcca aagcatatct cttttctgta actctttaat ttcagtcaca taacgggtta    134460
     aagattcttt acgaatcaag aaactttcat atatagactt accgactcca gaattataat    134520
     tacgcaagtt ttcccaatca tttcgtgaat ctcctattag agataattct tttcgcaacg    134580
     gtctaaattc atctatatac tcatattttt ctgtattatt ttctatagag gctacttgtt    134640
     gcgcgtaatt caacccaaag ttatccatga tgtctataat tgagagcgat gccattacat    134700
     aagctggaag atgattttgt tgatttaacg tactgagaat catggctaca gactgactat    134760
     cgtaatgaaa ataatcctca gctttttcta ttaacatggg accaccataa cgctctactt    134820
     ctcgttcata tgtgtcgata gtaatctttt ggagtaatcc taaatccatt agtttatctg    134880
     cccattccct taaacgagga agaactagac cactaagttt agaagggtct ccctgaaagc    134940
     gtaaacgaat atgttcatca gtgtctcggt aacgcataaa gaaccatgat gatgccatat    135000
     cacttttaac catttcacta gcgaaaggcg taagatattt tagtattaag tcattctctc    135060
     ttgcgtttgg agcatagagt tttacatata accactcgct ccctggtaat ttgtagatta    135120
     ttttattact tacaatatct tttttcgctt cccctattgc accaattttc tttcttcgct    135180
     cagtattttc tgtcttcttt aaaggaacaa ctatttctac agcatgtctc cctaaagggc    135240
     tatttaagca attttgatcc cgatcttgaa gagtttctct taattgcaac cttccttgct    135300
     tgaataattc attttttagt tcacgtaggt gtaaagtgtt ctccaagtca attaagatgc    135360
     gattgtctcc ataagtcata aatacattac gaggaactga ccacttttcg cgccattctc    135420
     caaaagcttt aaaaaattct tcctcattct gaggcttctc tctcataccg aaaacctctt    135480
     tatttaattt ccaaatacta ggtgaaagaa caatgttttt atagcgaatt cttggatagt    135540
     aaggagagtg tgccatactt ccccagttaa atggtcgcca ttggtctaaa tcattgagtg    135600
     aaatctccct cataaaacga taaatattag gcgcactttg ataattaagc atgttaccgg    135660
     ctactacttt aattcgtttg cctagttttt ttgacttcat atagaagttc tctaacgatg    135720
     ctcctaccac aatatcatcg ataggtaact ggattgtctc ttcatcaccg tttgttccca    135780
     gagtgacgtt cacttttctt gtcgtttttc caattgctac gttggctgat cggccagttg    135840
     ctggcagaaa ggagccttct accatcacgg tatcttcgtt gaattcaagg tcaatttttt    135900
     gttgatactg ttgtattttt aacgaaacat ccggatctaa gatatctaaa aatcgaccaa    135960
     atgtgctacc taaggcatta gatccagggt taggacttaa acagaatgta tagttacctt    136020
     gatctaagtc ctcttgtgaa gcagcatgta actctccata tacttctaaa gagtcaggcg    136080
     catatcttct atctttttct ttactcattc tctgagctat ttcttctgta atctcgattt    136140
     ctttttcttg attatgaata gctttaataa gaagatatga taactgacta ttacgttctt    136200
     gatttataga agaggtggta gtatctcctc cccttttccc atgtggattt tgataagagg    136260
     caggtgcacc gagacctaac tcttcactta ataattctag taaaggaact tctctagatg    136320
     ttccgtattt ttctaaaaaa tcaacatgat acttttgtaa atgtggaaat cccactccct    136380
     catcagctat cgaccataat atttgggcag ctttgcttat gtcttctcct accttttctc    136440
     caatagttaa gtctgtggca tttaaggaga aatctacttg aaggggagtt gtaacttcat    136500
     aaatatgtcg catttgtgaa atcaaatcac tataaaggga gagaccttct cctaatggta    136560
     attgattata agtattgatt agttccctta cctttaacag ttcctcatag agctctatct    136620
     tctcatcttt ttcttctaat tttctaatga gataattaaa tggattatca atagttaaag    136680
     gaggccttag ttccgttata agatattctt gttccaatag ctgtataata aagcgttgga    136740
     ttattgtcac atctgtattt ggataaatag tatgtaacct ttgtgtaatt tctctcactg    136800
     ttattctttc ctcagctaaa ttaagaacct tttcaaccac ttcgctataa attatggaaa    136860
     tattttctct tttctccatt cccttttttc taagttgacc acattcagtt gaaaatggca    136920
     aatgaagacg atcgcctact acatacgatg cacgattctt atctacaatt agagaaggaa    136980
     ggatattgct tctttctaaa actgaaataa ctcccaaaag ccactccata tctggtcgtg    137040
     ccctcttctt aaactctttg aaatgatcta ttttcaggga agaattcttt ttaaattgtc    137100
     cagctgctac tcctgaaaaa gctccaaaag gagttggtct agttgtcatt cttaacatgt    137160
     aacgcaacat agaagataaa acttgttggg tttttctatt atttaaatca ccatgtatgt    137220
     aatgaaggga atttaataga gaaggacttg caatagcaat ggcttctttt acataatctt    137280
     tttctgcata agctcttaac ttttccacta atactgcttc gtctttaagt tggtcgaagg    137340
     tatgggttgg taaaaacggg gctcttaaca taaaaaatgg aagaggttca aataaattat    137400
     tttcagtagt tacgctagat ttatgattga atttttcttt ttgtaatatc aatgttaatc    137460
     tccctttcct tttataatat aattcaaaag aagagaaaag agggaacaac attgtttccc    137520
     tctttttcaa cttctaatta gcagcagaag ctgttccaac tacctgtatc tccacaacct    137580
     ggtgtacata aagatacact tgtaatttgt ggatctacat cacttgaagc agttgttact    137640
     tgtacatcta aatcaaaaag gttttttacg ttattcattt ttcattcccc cagaaagttt    137700
     ttattaagaa ttacatcttt tccatttcct tcttataaag ctctattact aattaacagc    137760
     agaagctgtt ccagctacct gtatctccac aacctggtgt acataaagat acacttgtaa    137820
     tttgtggatc tacatcactt gaagcagttg ttacttgtac atctaaatca aaaaggtttt    137880
     ttacattatt catttttcat tccccccaga aagtttttat taagacgcta tgtcttatac    137940
     atttaattta ccagacgctt ttttataaag aatccgtata taccgcaata agattttgta    138000
     aatttccgca tatgcaaaaa aatacataaa agtatagtat tgaaaaataa atagttctaa    138060
     tgtacatttt tacttatagt agtttaataa ccattttcta gaaagagggt ttttcttatg    138120
     actaaaacac tatggaattt tttaatggag atgaaaaaaa ataatcttac ctttgaaaat    138180
     tatgagttat gtccatcttt gaatgccctg tcacctgaag aaaaagttgt attaaatgaa    138240
     tatgcaagaa gtttagtttt agaaaacgag gttggaaatg aatgggttta gaagcgattt    138300
     aattgatcat attaaccagc atctttctag ctataagcaa agtggaagag cagaagtaga    138360
     ccttcttgct ctaaagcacc tctctaaaag aggaaaatta ttaaaccaag aactttcagg    138420
     attctcatgg ggagaactat accttactct ctcttatttt ttaaaaagaa gaaaaatgac    138480
     agaagaagat tttgaaaaag cttttggtat tgaatgtata ttcttatctg ccgacatagt    138540
     agatgatata tgtgatcttg atgatccgaa tcttccaacc tttcaaaatg aagatcgata    138600
     tcttatactc atttctcaat atctactggc aaaaggcttc ttctatctca gacctgtatc    138660
     agactcttat gaagacaatt gcctctttag cctcataatg gattcaggat gtggagaatg    138720
     gaaagacctc cactttcgtt tctctataaa taaaagagtt atacctactg aagaggagta    138780
     ttttaaactg attaaacaaa aatccggtaa attaacagag ataatttctc aagctatcga    138840
     tccttcacaa cttatattaa aaaaaatcac ttattatata ggcatagctg gacaattgag    138900
     aaatgatgct gcagacgtgc taaatgacaa aaaaagtgat cttcgagatt taaaagcgta    138960
     tctgcctttt ttaaaagctt atgagtacag ttgtgaagta caagatgaat tctttcataa    139020
     gttaaaagat gaagaaatca tggcctctcc tttaaaaaga cagttgataa gagaatacat    139080
     agaacaatct ggctctatcg attattgtca tatcttatcc aggttttact atatgagggc    139140
     atttaagctt ttagaggaac attttaagct ttcaaagaaa gaaatgaact acttcaaatc    139200
     tttatttcta caaaggagtc aacagcatga acaagcataa tttattaatt tgtttgcctt    139260
     taggcacttt gtacatcatc atttttatgg cgaatggtta ttatttatat ctaagcgatt    139320
     ttagaagatt tgtggattcg gcaactttaa attcttttta tgtaacaagt gttattagtt    139380
     tgatattttt tagcatcgga ttatttagct tttttaagaa acaaaaatcc atcgtgataa    139440
     aaaatttctt cttattaaca tctgtctctg gtattgctat ttctacttct gttttgtcca    139500
     gtcaggatat accagttttt aaaactatag agatcattag tgtatttatg ctctcttacc    139560
     tattactaag tttcttcgcc cacttcccag tttcgactaa acctaattat gtgaaaatta    139620
     taattttttc atcattactt ttctcaaccc tgtcatctgt agtgtactta atttgcaatt    139680
     accttggtta tgtagagcat tctaaatttt tttacatata cagagtttta ttaatcggta    139740
     acttgttctt tagtattgtg ggctgtattt ttcttatctc tttacatcta aaaactaatt    139800
     cattaaaagt aagaaatcag ttatatatct tgatctttgg aattgttttt agctttggtc    139860
     cacttttttt attcaattta atacctggaa tgatttttgg agaatctcaa ataccttttg    139920
     tctattgttt acccagcatt atagtcttcc cactgacaac ttcttactta ttagtaaagc    139980
     atgaaattat tgaagttgaa ttggaaattt ctaagtggat taatatattg atttattaca    140040
     tacttaactt tttgcttttt agtattttaa ttaaacaatt tatgcacctt tctaatagag    140100
     aattatttgt catatgtagc gttggccttt tatctgcatg ggcatctatt ttcctttata    140160
     aaataggtat taacactttt atacaaaaga agacaaaaaa tagagagaac acggacctga    140220
     atgaaattga acttttccaa acattgtcta aagaaaaaca tgctaaaaat cttgcaaaaa    140280
     ttataggaaa agtcattcat cagaagttcg atatcaatgg tttatgcatt gtgtggaatt    140340
     ctaataatat atatcattca ttacatgaga cgggcatttt tcaaaccatg aatcaattta    140400
     actttcttaa tgaaataaac aaacttgaaa aagatatact tcttgttgaa gatcaaaccc    140460
     ctagcataca tatgcatttt gaaaaatatc acttaatctg ttttccaatc gcaataaacc    140520
     aattagttca aggtgttatt gttataggtg aaaaaaacaa ccatactctc ttccaaggga    140580
     aagagttcat tgagcttaaa gaactaatat gtgaatcagc agatatactt tcaagtgcag    140640
     ctattctcaa tattaatgac aaacaaatac gtcgaacaaa gacaagagtt cagaactgga    140700
     accaatttaa tcaccaagtc attcagtctc tagaaaaaga gaggaaaaga ttgtccattt    140760
     tcttacacga tgaaatcctt caaagtctta ttttgcaatt gaatgaagtt agaataatgc    140820
     aaacaaaaag gaatttctca gtaacattac tagacgaaat ggatgatcag cttgaaggaa    140880
     tgatttataa cattcgaaag atgtgtcatg acctccaccc tatcatcgtg gaggatttgg    140940
     gtctagagcc aagtttacag tctttaaaac gagaatttga actaaattat agtatcttaa    141000
     ttcatgttca atttaattgt gagttcaaaa tcatttctaa aaatcatgaa atacaagttt    141060
     atcgaataat aaaagagctg ttaaataatg ctgttaaaca ttcaaaaggt aaaaacatta    141120
     aggttcttat tttagaagag aatggtttct accagtgcag cgtaaaagat gatggcatag    141180
     gatttgatgt cccagacaat ttctttgatt ttagtaaagg taaccacctt ggtttactaa    141240
     ctattcatcg tcaaattgct gaattaaatg ggagtatgag aatttcttct gataaaggac    141300
     aaggtacttt tgttacattt actattccat tggactggga ggataaaaat gagtatacgt    141360
     acgctactag tggatgatca tttactcgta atgttaggaa tcagaagatt actcgaaagc    141420
     gaagaagaca ttgagattat agatacagtc agtgatccct cgtctttaat agaagttgta    141480
     gcaactacat cccctgatgt agtcgttaca gatgttcgta tgaaagaatt taacggaatt    141540
     gagttaacaa aagaactttt gtctaaattt ccagaaataa aagttgtcat tttatcaggc    141600
     tatgatcacg aggaatacta caatgcagca tttaaagcag gagctagtgc gtatattaca    141660
     aaagaaagat ctgctttcga tttagcaaat gctatccgtc aaagtaatat gggctatata    141720
     ctattctcta aaaaccagat tagcacgaag gactttgaaa cccttacttc tgcggagcaa    141780
     aagatacttc ttttaatttc caaagataag acgaattatg aaattagtat ggatctttca    141840
     attagtaaaa gaacagtaga atatcatatt tcttctatta ttagaaagtt agatgtagat    141900
     tcacgagtag gagcagtagt aaaaggcatt aaaaaagggt tgattgaaga tttttaaaat    141960
     ttagaaatag ataaaatagc agaaaaagat atataaataa attcaaaact agatatttct    142020
     atatcgtaag tgtgcacgat gaaagattta tcagatggaa tacagttaaa ggtgagctta    142080
     atgaagatat agtagatgac aattgccttg cctaactaaa agaagaagat aaataattca    142140
     ttagaaaaat agaaaaaatc cctggtgcgt tagggggagc ttttctgtta cacatatctt    142200
     atttaaagaa caaactcctc aagtcatctt gaggagtttg ttccaattaa taataattta    142260
     tttattgatg ccatctcttg tctacatact tcttgaaaat ttagatttag ttatttttta    142320
     actcttgtta cactaaaaag tttttctcca taattaactt tactaatacc aactcttgca    142380
     agtccaccca caatagcagg aaggatccat cctgacccta tttcatacat aggaaaatat    142440
     agaaggaaat aacttattaa aatgtgtaga acatgcactt ataagtccta cactgtttgt    142500
     tttatttaat aatgacaaac ggtgtctttt acttcttatg gtatacagac ctatcctcta    142560
     cttacctttt aagaaattgt tttattaaag acaaccaaac ataaggttta taaacattca    142620
     atgttattat ctttttaaaa atatatattt aactgaaaat ataaaagaaa tgtattctat    142680
     acaaaaaagt aaatatataa acttctttat aaaaaataaa gttttaatat ttactctttg    142740
     tgacgacaaa tacgaacttt ttctacaaga taggttataa tcaatatgat tatatataaa    142800
     actctttaaa tattactctt attaatgtca ttaaattata tttatattca ttgatatttt    142860
     aactttctct tttgcacagc atgccataaa actctattat aaaacaacaa agagaggaat    142920
     aattcctctc tttgttacac tggtaattaa ttattttagt tatctagttg ttttttattc    142980
     gatctaaaga ctaatttttt aaataaagca ggctctttac caatatcaac ttaactaacc    143040
     ttgttttctg tacttaaata ttattagttc attttagaaa ataatgcttt ttaaattcaa    143100
     acaacctaaa tattcattta acactatttt ttgattttaa tacagaaatc aaaattaatt    143160
     aactagttgc tattatagac ttataaaggt ttaaagaata tctccttgcc cagttgtctg    143220
     cttcaactat ttcatctaaa ttgggattat tagttaaaga atgtgcattt aaagcttcat    143280
     aaatgattct ttctatttct aaaaatgtta ttttatcttt taaatacagc tcattggcga    143340
     tttcactact tgcatttaaa acagcaggca aagtaccacc ttctttagca gcgttaaggg    143400
     catagtctaa acatggaaat ctaattaaat caggcttttc aaaactcaaa ctctttatat    143460
     ctgaaaggct taaagtagta tatgatttat ttatcctact tggataacta aatgcatact    143520
     ggataggaag cttcatatcc ggaataccta gttgtgcaat aaccgaacca tcttgaaact    143580
     gtaccattga atgaactata ctctctttat gaataagaat ttctatatca ttgaaatcta    143640
     cgtcaaagag ccacttagct tctattactt caaatccttt attcagcata gtagcagaat    143700
     caatagttaa cttatttccc atactccaat tagggtgttt caaagcttcc cttgccttaa    143760
     gtttctccat ttcttctcta cttttttctc gaaaggctcc accagatgca gttataatta    143820
     atttagacat acttaaaggg ttttcaccat ttaaacattg gaatatagca gaatgttcac    143880
     tatcaacagg aataatggta ctcttgtggg atttcaccag atccattact aggtgccctg    143940
     cggctactaa tgtttcttta tttgcaaggg caatactctt attacttttt attgcttcta    144000
     tagttggttt gattcctgct gctcctgaaa ctgataccaa gacttgatca gcctctgaat    144060
     aggtagctac ctcaattaaa ccttcttccc cataaacaac cttcacgttt gaattgttta    144120
     ggtttatttt tagcttttca gctaactgtt tatcgcctac ggaaacaatt tttggagaga    144180
     actctcgtac ttgactctct atagtactga tatcgttgtt agcagcaagc ccaaccactt    144240
     taaatttatc tagattattc tttattacct ctagactaga tttaccaata gaccctgtag    144300
     aaccaagtat gcttattttc ttcaatcttg ctcatctcct ttcatatttt ttaaaacacc    144360
     atgaaaccat aaatagttac taaagataaa agcgctatag taaacaagta aaaagctaaa    144420
     ccttgtgtaa gcttcttaac tcttagagat gttattacca taaggcttgg tactattaat    144480
     gaaaagatat aaaagaatat atttgaattt aaagatatat taattaaaaa tgttatactg    144540
     agtatcatag gtgaataaaa aacaggtaat ccgtaaaaga agcccttgtc atttagtcct    144600
     acacagttaa agtaagcaag cctcaagaaa caacagaaca ctatgtaaaa gaccaatgat    144660
     aatgtaaata aatcattact atccaagatc gtataaacaa aaactccagg agccactcca    144720
     ctgtgaatta aatctgctaa cgaatctaac tgtactccca acatgtcttg aaaattgctc    144780
     ttttttttac gaaattttct tgctaccatt ccatcgaaaa catcacaaca aacagctact    144840
     aacatagtca gcatagccaa aataaaatgc gagtttatac ttaagataat actgctagta    144900
     cccacgatta gacctagact agtaattaga ttggcccaat caaataatga ttttatcaac    144960
     ttaaaaaacc tctcattaac gttagattaa tacttccctt tgctctgcta ctttttgaat    145020
     ttcataatgt attgcagaaa ccaattcttt gttctcttta gcagttctag aacttaccct    145080
     gaagaaatat tcggaatcta tcatttcctt cccagagcat tcttttatat agattgagtg    145140
     atttatgagt aatttttcag caaaatcatt actattaatt aaacaatctt ttatcttaca    145200
     caaaataaaa ttagaatctg tagaaaatac cttaagttgt tttatatctg ataaattatc    145260
     tactaactca tcggtttctt ggcgtactaa attacagctt ttactatact ccttaaaata    145320
     tcttggtaaa tttaaaataa attcttctgc aaaaccatta atattccata ttggtatttc    145380
     actatataga ttttcaagca actctttatt agctgttgct gcatatccta atctgatacc    145440
     tccaataccg aaagtcttac tcatactttt taaaactata atcctagggt atttatcaag    145500
     ttcgttcaaa aaagtttcat ttgccttact agagaagtct aagaaagatt catctacaat    145560
     tatatttgta cctatctgtt cagtctcttc atatatatct atgatatctg ttttatttat    145620
     taatttccca gtggggttat ctggagtaat taaaactaag gccttagcat tggcagattt    145680
     tatagtagag attaatccct ctttatctaa ttcaaagttg ttttgttcta aaatatcaaa    145740
     gttaataatt tgctcatttg aaaaacaatt aaaatattca ttaaaagaag gtctagttaa    145800
     aactacttta ccagatatga ttctaggtaa tactttaatt atttcagata cgccattggc    145860
     aattaataat tgctcttcag atacctttaa gaatttagat aggtgtttaa caaagtactt    145920
     tgaactggat ggataattca acaacaagtt gtcaaatctg tcaatcattt tgttttttaa    145980
     ttcctgtgga ggaaagtgaa aattataaat aagtgcatgg tccgtaatag gatacctcca    146040
     ataaccacca tgttgggatt ttagttgttc atgcggtgtc ttagagaaaa tatattcact    146100
     taaacttaaa tcatattgat catcaatttc catccataat tccggttcaa ccttcgaaat    146160
     ttcaaatgaa aaaccttctt ttaatgcttt tttgaaaatt gtttcataat agatattaac    146220
     cttgttttga ctgactgctt tctctaattc tgtttttaca tacacacata aatcattaga    146280
     taacttatag atatttaaag ttttaagggg atcatctata ttatgatgtt cgttagattt    146340
     tgtagaataa aatcctgtaa ccttgttgtt ttgagcagtt acaaacgcac cttccattaa    146400
     ttcgtttaat ggtgaagcta acaataaatt tttttcttcc atgtcaactt gctttaaaat    146460
     cttgctatca aaaaatatat ccccttcaat aagcaatgtt tcattcttta aatattgtct    146520
     tgctaaatat aaagaataca gattattggt aacgtcccat tccttattat taattacaac    146580
     gatatccaca gtgtcctcat attcctttag aaccttttca atcatttcat ttttataccc    146640
     tactacaatt actaatctat taactccaaa ctcaattaga ttttttattg aattttcaag    146700
     gatagtgtcc ccgtttacat cggtcaatgg tttaggttta ttttcagtat taatccctaa    146760
     cctgcttcct cttccagcac atagtaagat tgcttgattg atcataatta tcccctctcc    146820
     acaaaaaaat atgaatcttc ctctatcttc ttgatagcta tattagcgac atctaaagca    146880
     tttgctgctt caagctctaa ttgatttaaa tgtgattttc ttaataattt atccttcatt    146940
     aattcgtttt ttatacgatc gaatctccta actgtattta tatccttgct ccttgcaaac    147000
     aattcaaatc ttctattact aaatccagaa ccaaaatcta cagggtactc ccaactaaca    147060
     tattccctat aaggaacttg catttcctct tctatagcat gaatagtagt acaagagttc    147120
     cagtctgctc ctaacataac tatagcaacc ttctcgttag taatttttga aacagctgta    147180
     cccttaccat agccagattg actattagag tttagaaata agctctcttt tcttccttta    147240
     acagcaaaag aaaacattgg attaaacgtt cttttaaaac ctaaaaattc tattgctaat    147300
     tctgataata ttcctgtttc tgatttatct tttcgaatgt tataactgcg tttttgagta    147360
     aaagaaaatg taaaagaagg caacaaaatt gtcttgtttt cgtttaaaag tttttctaag    147420
     aatgacatta taccttcttg atactctttg ctttttttat atccaagttt tgataatgat    147480
     gagtgaatta agataatttc ttcatcattg attagttgat ttactgcatg gtagatttcc    147540
     tctcctatac aattcacatt aacacctttt tctatatgtt tactttgttt tctgcctgaa    147600
     ttgagtaaga tatatcctct acaatcctct ttgatacctc atgctggtat acccagaccc    147660
     catctattct acctgtgtaa tttaattctc cgccattttt agggttagtc tttattcctg    147720
     aacctaatcc ataagtgtaa aatttctcaa atacattatt agaattatgt atataaggtc    147780
     tgcaataatg atctgtcaat agttgacctt gctctaattg aaatataatt tcttcatgat    147840
     tagaatctaa tatctcaaca gacttatttg tatatcctgt agcacatatt actaagctcg    147900
     aatccaggaa gtcgctttca gtgaattctt tattcttgat ttcaacattc ttatatttat    147960
     gactcataca ttctttcgct aaaataaaag aatcatatct taaccctgaa taacgattta    148020
     cacgattact taaataacaa acatcctgat ccatattaaa ttggtaatta tcattaattg    148080
     cttcctcaac agagttataa aataatttaa tgttactcct attaaaaact tgaatcttta    148140
     tattgtttct attcaaaaaa ttaaaattat tcttcaatct atataatgag gaaaaggcac    148200
     tgtgagaact tcctactatt gatatgactg tcttattctc agaattagaa aattcattaa    148260
     caaaatcatc gtgtagtcca ctaataaagt catcagaata aataacagtt ttttcttttt    148320
     caaagagttc attttgcttt ccaccgatat tgaatattac gtgtctagct aatatagttt    148380
     taaacttatt gtcaaaagat tgaagtttta tttcaaatat atttttctta tttcttttca    148440
     cctcaaggat tttatgattg ttataaactt ctccattatt acgatctctt attttatcaa    148500
     taaaataaga gccaatatct tgtaacaaat ttcctacttc ttttaaataa ggagcagatt    148560
     ctaatttact actaatattt ttataactct ccttgctcat taaatgttta tacaaactac    148620
     tgttttcttt ttgaaaaatt tctaaaaaca ctttacctaa cgaattagct gttatgttat    148680
     agtttattag tttacctgct cctatatttt ctttttcatc aatcaagcat attccttcat    148740
     ccaaatattt ctctaggagt ttattctctt ccaaatacac tagaggagat attccggctg    148800
     gaccacaacc acaaatggct aaattataaa cctgtctctc caattgattc cctccttatt    148860
     tgatttctat agattcgtaa aaccacttta gagcttcatt caatctaata tcaatctgct    148920
     ctttagaatc tccttctatt attatagaaa aatctttttt gtttttagca tgtaaagttt    148980
     ctcctaattt aaaattaatc tcacagtcta acatccaatt tttatttggg atttggtcaa    149040
     catagctaac tattcctttt tcaatgaata gttgtgcatg tcctgcatag cctttggctt    149100
     taatactaaa tttcaagggt tcctttccca tttcaaattc aatatactgc ttcattaagt    149160
     caaaaccgaa tttcctctta attgctggat atattttccc tccacctatt ctacaagcta    149220
     tctcattgat aaatggtttt ccttgattac taataaagac ttcagcatga aataagcaag    149280
     gaaaaccatt agataaagct ctcaaagctc tttccgtaat agaaaatata tcccagtaat    149340
     tattatcatt ttcctgaaga gtagtcgtaa gcaaaggctt accatttatc aaatctaaac    149400
     aagaggttaa atactcagag ataaagaaat tttgtacctt tccacttccg aataaaccat    149460
     ctacatgaaa aagtgttcca tcaacaaatt tttcaatcat ccatttatta ttgtcgtctg    149520
     gggagaaata attactattt aataaagctt gtaggtcctc ttgggactta attatagtta    149580
     cgcctctaga tccggcttca cgtcggggtt ttactacact tttcccatac ttatcgaaaa    149640
     aggtaataat atctgttata tcatcaattt ctttgaagtt cgtaacagga atgtttgatt    149700
     caaataaaat gtttttcatt gcaaccttat ctctaaatag ccatgacgtt tttttattca    149760
     ttccaggcac atgtaaaaac gttcgtaaat tacctgccct caaaatatct ttttcagata    149820
     aggcaattat tttatcaatt ttaatgcttt tatttaggtt aataatgtcc tgagtaacca    149880
     aatttgagga gtcataatct tcataaaact tggcataatg ataatcactt ttatgaactt    149940
     catcttgaac tttggaaaat agaaagattt tgtgcgatga gtcaaaccat tcatgatact    150000
     ttattttatc caaagggaaa cgatttaata taaccacatt catttgatac actcctctaa    150060
     attaatactt tcataaaaat cattgatagt attaattccg gcatcaatag attcacctat    150120
     agccatcaca tgtaaaattc tatctttgtt agaaaaatta attgtaaaat gctcacccaa    150180
     atttttataa aacttaacct ccaacacatt tgggaagtta ttcaacttaa aatcagggta    150240
     ttgattaaga attccattct ttctcgccac aaaaaatttt ataacagctt tttttccagt    150300
     tatatttaaa ggtgccggtt ctcccttttc aactagggac ttcaaatatt ctaaaataat    150360
     atcataacca taaacctgtc taattaattc aggaatcctt ccacctgcta ctctagggtt    150420
     cgcttcaata aagtgtatgt cattcttatc taactttatt tcaaggtgca tcaatccaaa    150480
     tttataatca attaagtcta aaaagtcata aatataatta tttatccttt ttattttttc    150540
     atccgaaata tttgccggta attcgtgctg tacttctata aaaccaggag aagtagtgtg    150600
     ctttctaatg atagcaataa tgctcgcatt cataatttct acagaatact cttccccatc    150660
     aataaattct tctataagaa catctttggc aactgtttgt cctgtatact gacctattcc    150720
     ctttatttcc ttcaaagctt cttgtaggct ttgagaatcc ttacataatc tcacaaatgc    150780
     acttccagta agattaacag gttttacaac aacaggataa tttaaatgat agtcagctaa    150840
     atctccattg cttagtactt taaaatctgt gttatctact tttaacttac ttactaacga    150900
     tctaaatttg gatttatctc ttaagatatt aacaatttca ggatttggac ttttaaggtt    150960
     taattctttt gctaatttcg cagcaatata ggtagaatat tcatacagtg aaagaatcgc    151020
     cttaatttta tagctttctt gcattctctt tacaaaagat agtaattctt cgtaattata    151080
     tgtattgact ttctttattt ctattccatt tttataataa tcatccatca cccattttgg    151140
     ttgactctca ggactagata ttaagataat aggtttaata tctaattttt cacatgcttt    151200
     aacaaagtcc attcctgcac ctgttcttgg tgtttcgatt aataaggcta cgctattaga    151260
     catactgcta aattcctttc tcaattagtt aaaatttact acaggttgat catatacacg    151320
     tgcatgttct ttccttttta tgaaatctaa ccaatcattt tgattatttc cccttaacac    151380
     tgttattgga acgttcaaat tcaaaactct aaattttatg ataaaccttg tgatagttgg    151440
     aggcattatt ttaaagttcg ctgcttgttc ttcaatatct tcaaaactta gaccatcaaa    151500
     tctaatccat gatccatcct gaggtttaga atgaactacc ttatagcttt ttttgtaata    151560
     cgaaaacaat ttattagcat aatcagaaat ttctttctta ttatttacaa actagggagt    151620
     actttggtta ttaattacaa gttctcctat gtatattcca tccttagcct tggaaaaaga    151680
     tatttcctga atatcaaatg agtggaacca ataatctaat tctatttgat ttttttccag    151740
     tacttgtatc ggtgcaaatc ttattcctaa tttctttaaa gcgtttaacc tatggtgcgc    151800
     ccatcaataa ccaagtaccc cttatctatt ttgatacatt gaattgggtc attaataatt    151860
     tttgtttttc ttaaagttct gcatattctt tttatttttt cttcatctac atattcgtgt    151920
     tccaataacc tctctgttgg aaccattttt agatttaatg attctgccga ataattatac    151980
     atatatttca cctttttctt caaaaataac atttaataca ataattacct aaaaagacac    152040
     aatgaacata ataaagtata tttctaatat tttcaagtta aaatattaga aattatgaat    152100
     tatttagtta attcttttta ttttaaatat tggatttatg taatataatg gttttttcag    152160
     gagggatttt attgaaattt aaaaatttaa aaaaaaattt aaaagtaaga atagtgacag    152220
     gcttttttca aagaattatc agtcaaatga tagttccctt tatttcagtt tatttggctt    152280
     cattttacgg agccactatc gctggttttt taacaataat tattataata acaggaatat    152340
     tgtctagctt tttgggaggg tatgtttcag ataataaagg tagacgaccg gtaatattga    152400
     tagctgaatt tacaagcttt ttagccttat tactcatggc cctttttaac tctccgtgga    152460
     ttataaatcc aataattaca tatatgttat ttttagttag caatgctctt acttttttta    152520
     gtaaacctgc tcttgatgca atggtaattg atatcacaac tccaaaggaa agaaagtatg    152580
     tcttttctat caattattgg agtattaacc tatctatttc tatcgcagca ataataggct    152640
     ctatttttta tcaaaattat ttttttgagg tacttgtctc atgctctatt ggtacattag    152700
     taatattcat tgtgttttta ttgtttatca aagagtctaa acctgatatc ataccgaaac    152760
     taattaatga aaatctacca agaaataatt tcattaaaga ttacaaaaat ataataatgg    152820
     atcctatttt tttaaaattt tttattgcct cagtattgat gctgggaatt gaatctcaat    152880
     tgatgtatta cattagtgta cgtctaactg aaaatttccc tactacaaaa ttatttcatc    152940
     aatggtcttt atcaggtctt gaagtatata gttttctaag atttgaaaat accatcggcg    153000
     tagttatact cgctttgtgt ttcaaatctg ttcttaaaaa ttattctgac aaagtaaaat    153060
     tttatgcagg aataatatta ttcacgttag gatttagtat cttagggttt agtaattcct    153120
     tttggatact agttacatct atgttcgtac taacctttgg agaaatcatt tatataccta    153180
     ttaagcaagc aattttatca attttagtag ttgataatca ccgaactaaa tatatggctg    153240
     tatatggtct tcaccaacga tttggcatga ttattgcttc tttaacacta actatttctc    153300
     cttttttaaa tccttatttc atctcatttt ttatgattat tatgggtata ggttctctat    153360
     tcttttatag aagtgtaata aatgaaaagg agacaaaaca attgttagag aaaatttcat    153420
     agaaaatgaa ctataaaaat tgatatatat atatatatat tatttaacca aacaataaaa    153480
     aataaagtat agatatactt aattcatatt acattggagg aacacaaaat gggcaaagct    153540
     attatctttg acatggatgg tacattattt caaacagaaa agattcttga aatttcactg    153600
     cactcaactt ttaatgactt acgtaataaa aatttatgga aagaggagac tccaattgaa    153660
     aaataccgaa atatcatggg agtaccttta ccagtagtat gggaaacgct gttacctaat    153720
     catgctcaaa atattagaga acatgctaac cacatatttc atatacaatt aatcaaaagt    153780
     attaagaatg gaaaaggagc actttatcct aatattgaag aaacttttga aaaactttct    153840
     caatattttc aattatatat tgcaagtaat ggacaaaaag aatatttaag agagattgta    153900
     gaatattacg ggttaaatcg ttgggtacaa caaacttaca gtattgaaga aatacagagt    153960
     ggaaataaat ctgatttagt agctagaata agagcaaacc atcaaattac agaaggaata    154020
     gtcgttggag accgcctatc cgatattaaa gcaggaaagg ataataattt ttttactgtt    154080
     ggttgtcgtt tcgacttttc acaagaaaac gaattaaaac aagcggatat tataatctct    154140
     gatttatctg aactactaaa ttgctttcag cttatttagt aaaataactt caaaatactt    154200
     aatttcaaca tattaaaaat gaaaaattaa tcattttcta tgtaaagttg tttgcaaaat    154260
     aattttctag ataaggcaga tttgttacaa tttggttcac ataaactaaa ggagagaagc    154320
     aagaatagtt ataattttgt taacaactta tataatttca ataataaata gtttaattta    154380
     caaatactaa ctaaataagt agttaaaaaa tccggttttc aattaaaaac cggatttttt    154440
     aactttaatg atgatgttca tgagcctcag tttgtttttg aactcctttt tgtaacaact    154500
     ctaactctga tttagaaagt ttccctacaa taaactgttt ctggggcata attattgaat    154560
     tatcattact tgcatgtact ttaacgtaat acagaccatc atggtctaat tctttactca    154620
     ggctataagt accatttcct tcattttctg ccgcctccat attatattta acagacccat    154680
     cttgtttcca tatctcaaag tgaacataat ctggattttt caccctctta ccactttgag    154740
     taagaataac ctttatggtc tccttctcat tattagaaaa agatttcggt ataattattt    154800
     gtgactcaag aggtgcttct tgtttgtata aactggcagc atcctgttca agtgaacatg    154860
     catttagcat taaactgaga ataaagatta aaactatact tacacttttt ttcactttaa    154920
     aagccacctt ttacttttca aattatgcat tcataaaatt tttaactaca gataaccttt    154980
     gaataattag caagtcaact aagcaaacaa taatgagtga taaacctact aaaggaaaca    155040
     aaaaacctag acctaccaac aatattaaga aggattttat attttttata ctggtagctt    155100
     ttggcgcacc taattctttt ttaggctttc ttttccacca tagatataag ccactaccta    155160
     taacaaaaat aattcctaaa caaatgagaa gactgattaa ttgatttata aaaccaaatt    155220
     gagttccttt atgcaaggta attcctaagg ctactatttt tcctattaag ccgtagttat    155280
     cataacgata atcagctaga acggcacctg aatattgatc aatatgcatt gttacttcat    155340
     cttgtgccct gggcggaaaa gctgacaagg tgtatacacc ttcttttttc tgtggaatat    155400
     atacagtata acttgaattt attttctcac ggtttgctat atggactaca tcatctattg    155460
     aaagaggagt aagaccttgg atctttgaaa caggaacttc tagattttct gctgcccaag    155520
     ggacatctgc tatatccttt gttttagtta tagactgcgg agcactccct atccagatag    155580
     aaggggggta acctactcct gaattagtcg ttaatgtttg aaaattattt ccccaaaaac    155640
     ctgaccaggg caatcctgtc ataatcagaa ataacattcc tccagtgatc cagaaagccg    155700
     gtactacatg tagatccctt ctaaaaatct tttttccttt atgtattctt ggaaaaagaa    155760
     cgccagataa actggttttt tttcttggaa accacaaaaa aattccagat ataattaata    155820
     ctattgccca acaagcagct aattctacga ttctgtctcc cactttacca gccattagtt    155880
     ctccatgaaa ttcttcaatt ctgtccataa ttctatcttt atcatttaat tctccaagtg    155940
     atttccccgt ataaggattt ataaagactg taagagactt gccattagag agaatactta    156000
     cttcacttga gcgtgtagca ttatctccag gccaatattt cgtcacctct gcttgaggat    156060
     acagtttctt tacttcctcg atttgctgag acgctgacat tgcatatcct tgtgggttaa    156120
     cattgtaata gtctttataa agtacttgtt caatctgtgg cttaaataaa taaatagagc    156180
     ctgtaaatgc aaggataata agaaatggtg caaaaataat tccagcataa aaatgccatc    156240
     tccatacagt tcgataaaaa gagtttgaag tacttgcttt cgctgatttt tctgaataac    156300
     gtaccagatt ttcctcattt ttgttcttca tctttatact attctcctat tttcaaatgg    156360
     tcgatcttaa tcttcttttt agaattgaca aaatccaagt atgtaaaaac aatatgagct    156420
     atataatagc tgaataatgt tattaaaaat catctataaa tataagtagt atttttaaac    156480
     ttatataata tatacctcta gttaacataa tgctgttcat gaatttctct agataaagaa    156540
     gagcgttttt ataattctta gtaattttat aaatatataa atgtatagcg tttttcccta    156600
     ttaagaagtg cacatattgt attaatgtgg tattgtttaa taaatatacc agttttattg    156660
     ttatatttat acatttaagg ttggtgatta aatttgggta ttagcttatt ctttttatta    156720
     ggattaattg gtattatgtt tttattgatt tttaaaggta aaattctttc tagaataaaa    156780
     caggaaggta gatgggtaca aactttacaa aaaaaatctt ggtttgaaag tccctattca    156840
     agcggaatta tattattcct atggaatact ttaatgaccg gtgttgtagc tttctttatc    156900
     tttatactta ccaaagtaaa tattcctttt cttcatcttg tgattttggg cataggaaca    156960
     ataataagta tttgggcgtg gtcgatattc aatatagctt ggatcggttc tagaaaaaat    157020
     cgatttaaaa tggctagtat aggcagtagc ttttacgcaa tattaggtgt gtatgctctg    157080
     tatcgatatc ttactttaaa accgtcttat cctggagaag atttatttat ggcagcttta    157140
     ggtttaatgg ctgtcttgat tattgctgta gtagcattgt taacctgctt cgtttttact    157200
     ggctttccaa aaaaagaaca attatattaa tttaacaaaa actaaacata aaaagggctc    157260
     taactaaatt cattaaatta gagctctttt tatgctttaa acatagtttt tctatgcagc    157320
     taatttattt taggagtacc atatccaaca attaaagttt tctgtttatt accagacatt    157380
     ttttgtaaaa tcctcattat ttcatcagaa tttaaatttt tatcactttt ttccataatt    157440
     ctagcaacca ttccggtcaa taatattgct gatacagaag taccatattc ttcctttcca    157500
     tctatagttg ctgaaccagg taaagagaaa tcaacattaa tcccatagtt agaatagtct    157560
     gcaataactc catctttttc aactgagtta actgcaatcg tataagatga accggccgga    157620
     aaattaacag tattcagccc ttcattacct gtagatgtaa tcacagttac cccttgctta    157680
     tgtgcctttt caagtaaagg tgttaaagct ggtatttctt ttttaaagtt gagactgata    157740
     ttaattatgg atacattttc attcaatgct gccttaaatg ccttaactaa aaagtctggc    157800
     ctaacgtctt catcacttgg agatattccg taatgataaa catctgcgga aggtgctaca    157860
     ttatataaaa cttctagcat ttttgaacca tgtaaatgag cctcttcttt tgttattgga    157920
     gttaaagata catatttttc aacttttttt tgcaaagtgg tatctatatt tgtatcgatt    157980
     acgccaactt tgacatgctt tccagtataa tgattcttgt caaaacctag ataggaaaag    158040
     taccaatttt cattcgaaag ttttttttct tctttagtca cttgcttatc aacttttaac    158100
     tctttcgagt acatgaaaga ataacataat ccaatcaaaa taataataat tatccctaaa    158160
     cctataaatt taatctttac ggatctcata ttttgctctt agataattat ttaaatcgat    158220
     ttgctcttta taataattat tagctatgta attatttgta atttcttgct tattttcttt    158280
     taaatttaat ttataattat cttttatgtc acttattatc aataacgtat gagtttcagt    158340
     gttttcttca ttattatcat tatcttgagc gttcatgtct ttcatgcctt ccatatcatg    158400
     agaagtatgc tcgtccatat tcatgccttc catatcatga gaagcgtgct cgtccatatt    158460
     catgccttcc atatcatgag aagtgtgctc gtccatattc atgccttcca tatcatgaga    158520
     agtgtgctcg tccatattca tgccttccat atcatgagaa gtgtgctcgt ccatattcat    158580
     gccttccata tcatgagaag tgtgctcgtc catattcatg ccttccatat catgagaagt    158640
     gtgctcgtcc atattcatgc cttccatatc atgagaagtg tgctcgtcca tattcatgcc    158700
     ttccatatca tgagaagtgt gctcgtccat attcatgcct tccatatcat gagaagtgtg    158760
     ctcgtccata ttcatgcctt ccatatcatg agaagtgtgc tcgtccatat tcatgccttc    158820
     catatcatga gaagtgtgct cgtcttccat agaagaatgt atatgaatag aatcaccttt    158880
     tttatactgt gaaagatcta catcatatat attatcttta ctaaaaacta tatctttctt    158940
     gaagcttata tttttctctt tttgtatatc ttctatactt ttaccttgtt ttatagcctt    159000
     atctatatca ttaattagag tatgatcacc ttctaattta taaaggttat ataccttatc    159060
     tcccagtgtt tcttcctgtt cttcaacata actgttcaat tctttatttt tcactgtata    159120
     ttttttgatt agtgcgttgt tatagtaaaa attccccact tcaccttttt tagattcaag    159180
     atcggttgct tttctatcaa ctaattgata atatctaaaa ctttctttta attgtttatt    159240
     agttggtgga tttattttag ctttttccaa atcgattagt tgttgatcaa tgtaattatc    159300
     acgagcatta tcaaaatatt tatcttcaag aagcttgtta acatctttct tatgaatttc    159360
     tttgccattt acttctgcta caacttgata attagtagaa aaatacttta gagaaaagaa    159420
     acctaataca ataataagac tatataaaat tacattataa agtttattcc acatgatact    159480
     ctccttaata tttttaacat agtcaagcca ggagttaata gctcctggct tgattatatt    159540
     ttatttacca cttggtccaa agaaacttgt atgtttatga tagcgagtag aatgtgattt    159600
     catctttgaa cattgcccat aatgagaaga acttactaaa ctgcaataac gaagtgatgc    159660
     aggtccatga tctctcaagc attgtacact attggctaat gcaacatcac aatcactttg    159720
     aaaaaagttt ttaactgctt gtgcagatgc ttcatttgaa tagtatttac catttccttg    159780
     atagccatta aatcgattgc aagctacaat atcacctttt gaaggaagtt ctccatcgct    159840
     ttggcctatt gacgtaacac ctagattatc tgtagaatcc ggagaatctg tatcgactgt    159900
     atcctcttct atagaagctt cggagcccat attattttgt agttcattaa catcaatgat    159960
     agattcaata gttgaaacgg tacctttatg taagttaatt tttctatctt catagtttac    160020
     tccatcaact ttaacaccca cagtcttctc tatagaatcc ccttcaatat ccactacata    160080
     tttcccttgc tcatttggcg ataattcttc gccatcaact ttaagtttgt cgtcttgata    160140
     ctttactttt tttacaaatg cagatccgtc atactcccaa tcatcagatt cgtacatttt    160200
     aattaattca tcatttaact gatcagaact aacagtaaac tttagaactc taataagttc    160260
     aatttctgct tgactagaag tatctgactc tgcgtaagct gcttgcgcag aaaccaaagt    160320
     agtgattcct agcataaaca ttactaataa tttgctaaga atcgtagaaa cttttttccc    160380
     cattttacat acctcctatt tattaacaac attttcaatt atataacttt aattcaaaaa    160440
     aataaacatt attccataaa tatctataga tatttatgga ataatgttta tttttttacc    160500
     agaagaattt tttccagttt atcgtttaga aaccaaaatt ctagattaat ctttaatttt    160560
     ttatcaggat aacctataat ttcaaaactt tgttcttctc ttttataata tttctcacca    160620
     tacaaagaag taatttcttt aaaggaagaa ttcaaaccta cttttttttg ggtaactgtg    160680
     ttattcgact ctgtagatac agaattaact atattctttt tacttacttt gactctagta    160740
     ccatctttgt atgtaaacca attatccgat ttatcattta aatctttaat atttttcttt    160800
     attttttcaa agtcttcatc aatctttatt ccgttgagat tctcttttga taaattaaca    160860
     ctttcagctt tatagtaaga gtatttttca atttgactag aaccgataat tgttatcgga    160920
     ataataagta ttaaaccaag cacaattatt cctgcaattg tataaattat tttgatattc    160980
     attttttaaa acctacacct tccatttttc cttaaatttt accacaaaaa atatataaaa    161040
     tgttactttt atatattttt tacattaaaa gacaaaaagg aaggcgtgta gaatgtgaat    161100
     attaacaatt aaggcctgaa aattctctat aaaaatacca agccaagtat ctgcctttct    161160
     aaatatacat tgcttttatg cctttcatta tgtaaatatc tataaggaac tgaaaaaagc    161220
     taattagctg aaaataagta gttaactttg ttttcgaatt cataagatat atgaaatcag    161280
     ctcagttgag taagcgaggg gcatagcgcc tctaactacc ctaagaactg tacatagctt    161340
     ttcaagtcat acgactcaag ccttcttttt attcagacta caacacttaa ttaacacaaa    161400
     gtttatatat tagcttattt gctatccttc ttgagttttc taaactgtgc aaaataatca    161460
     cttctccatt tatgaaatat atttcatatt tagttataat ttttcggaaa aagactatat    161520
     ttgtaggaac tagcacctgt ataaaaggtg cgctttttat acatttcttg ttcagttgtt    161580
     tctcatggaa aagttggtct atcaacgatg tataaaaagc aacatactct gaaaaaaaaa    161640
     cctcggtgga agcttacttc cccaagggtt ctgttttatg ttaacttttt ataatactca    161700
     aaatacaatc ttcattttaa aaaagcaccc tcatgctttg aagcgtgtgg gtgttcccat    161760
     ttgatttagc tttagttgtc tttcatatga taactcctga atgtatcccg atacactttt    161820
     gttaactcaa caaagctctt atagggatat gccctgtata gtaagagcgg tttttaatct    161880
     tgtttaccac tttaaaaaag ccaacaggcg gttttttctc acgttctgcc cgttgttgct    161940
     actggatcaa tactttcaat atagccatta tgaaaaagca gactcttcag tcttcgcttc    162000
     gccttcaaac ttgttctatt tttcacattc catttcttgt gcagcatttc tttttttgta    162060
     gaatgtgctc cattattccg tgcaaaaaat tttgcaaatc tattttatga tttctctttt    162120
     ctccctttgt cataatcctt tatctctctc agtacctccc ttctatctaa accgactttt    162180
     aaagaaatct tcgcgaggaa tcttttttcc tttctgattt tatctatttt tttaagggca    162240
     attggatcaa tatttcgtaa gaacagatcc atgatattcg ttcctttctt ataaattgtg    162300
     gttccccact acaaaagaga gaagagcata aggggtttct gctatcacat agggtgatag    162360
     gctaggcaaa gcctagcaaa accgtgatat caaagaaaag ctctccatgt cccttttacg    162420
     tccccttttt agtcttagat accgtttttc agattgaata ctttccttta aattccatat    162480
     ttttgccctt agtccccttt gagtccccct ctgttttttc acttcatggc taaatcttgc    162540
     tgcttctcat tcaatttttt tggttttttt tgcaaacttc tttgttcatc ttcatagggc    162600
     tgaatgcttt catcactgta ttgaatcgca tcttttttta tcgcaatttt tgattctgta    162660
     ttagcttttc catcgttttt tattttcttt ttgacaacat ctttttctaa cttgtgtgaa    162720
     ccagctgtga ccatgaaaaa gataaatatt gatggcctgt gaacctgcat ttttttagaa    162780
     cagtcatcat ttatagaata aaaattgatt cataaatgat aaaaaagcac gcgtaaatca    162840
     cttgtattgt aagtaaaacc agatggccgt tttgctcatg aacgtgtgaa caaaaataaa    162900
     aaaatcgctt gcttctgcct tatttttttc aaaaaacact tcaaaatgaa gtgaccctcg    162960
     aggggacatt tatcaactat gaagggtcgg cgaaggggtt tctgacaaaa atgttgtgat    163020
     tactgaaggt gcggtgaagg gactatccct taatttgagg gttcgctgag ggggttcttg    163080
     tagacatttc cttgtaccca aggttttgtt aggctctgcc taaccccaca cagcctgtgg    163140
     gggcaaaaac cccttatgct cttctctcta ttttttaaag ggcactagta ttttgggaat    163200
     ttcaaataaa atatggaacc taaaataaga aatgttgcta ctgcggtcta aaaaattgtt    163260
     gagttagtaa agaaacatga ctaatcctga cagcagcttt ttaaaaaatc aagttcacac    163320
     attagctatt tttagtcaat actcttaccc agaagaacct cttgaaaatt tgctttggga    163380
     tcacattaag acgataggac ggtgtacaat ttgaatggaa aacctgaatg atatgttaaa    163440
     agaattgatc gaagaatatg aagatgatga ataaaatacg ccaaatgatt tcactcgatg    163500
     aagacaccca tcaatccatt caaagttata tgcttaaata aaaattagat atcttggtga    163560
     tgctatatct aacatttgta tcagatttag ttatgagtaa aagaaagaat ggaatgtaac    163620
     aacccttaca gaaactgttc ccattgagtt gaaaaacaat ttaaaaaagc aacttaaaaa    163680
     gttacaacct ggcgttaaca ataccctcaa gtatgtgcaa attgccaacg atataggaca    163740
     atttccaccc tcagaattca acaaaaaagc agcttctaca tgaggtagaa actgcctcta    163800
     tcacattttt aacatgatgc atagggtgat tttttctcac cctttttaca aaaaaggact    163860
     acaaaaaatc accctaccca ggagaaccat ttgcgattac cattgaaagt gtactaatca    163920
     ataaatcttc gaagttatta aaaatgtagc attataacat acttttaaat acttggggag    163980
     gggtaaaaaa atacccctcc ccagattcca caaatttaga tatgatgaag tcgactccta    164040
     aagaaataac gaatgaatcg tagctaaaaa tacttgtttt gatatatttt gctaattttt    164100
     tattgaatta tgagactagt taacgctata attgaattaa caaaaacgtg cggatagaaa    164160
     aaagactcca actgtttaag tagtgtaaca gcactcttaa accgttcccc ctagttacgg    164220
     tagggaaaac acttgtcgaa gtctcttgtt aatagagtag ttttgtataa aataaaactt    164280
     atggctttat tttatacgaa attgacatct atttcaaggg cttagttcat caaaatcacg    164340
     gcattgtttt cctttcttca gggaaacagt gtcttttttg tgttccctaa aggagaagat    164400
     gaacaa                                                               164406
//